Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B035502.287ON37237219710.0
NCAS0B062502.287ON37337418130.0
Smik_9.852.287ON37137217240.0
YIL094C (LYS12)2.287ON37137217130.0
Suva_9.1052.287ON37137217110.0
KNAG0A054202.287ON37237217050.0
TDEL0G021802.287ON36937216990.0
Skud_9.792.287ON37137216960.0
KAFR0J013602.287ON37337315990.0
CAGL0G02585g2.287ON37237315920.0
SAKL0E07656g2.287ON36837215780.0
KLTH0G10384g2.287ON36737215660.0
Kwal_27.115282.287ON36737215660.0
ZYRO0A01914g2.287ON36837215590.0
Kpol_1003.392.287ON37037215530.0
KLLA0E08339g2.287ON36937215530.0
TBLA0B059402.287ON36937215080.0
TPHA0C034102.287ON37137215030.0
Ecym_33262.287ON36637214340.0
ADL214C2.287ON36737213580.0
ADL223W2.278ON3623844901e-57
Ecym_23135.473ON3703544788e-56
Suva_8.1885.473ON3693554761e-55
NDAI0C014105.473ON3693864762e-55
NCAS0H022505.473ON4223864765e-55
Smik_15.3165.473ON3693924726e-55
KLLA0E03125g5.473ON3683544726e-55
KNAG0B040705.473ON3733534701e-54
Skud_15.3005.473ON3693544641e-53
TBLA0B022405.473ON3733974613e-53
YOR136W (IDH2)5.473ON3693924595e-53
KAFR0B063705.473ON3783544589e-53
TPHA0D015602.278ON3603534552e-52
CAGL0I07227g5.473ON3683554534e-52
KLLA0F04103g2.278ON3613514515e-52
Kpol_440.125.473ON3683904501e-51
AFR137C5.473ON3673544491e-51
SAKL0E07876g2.278ON3613544481e-51
Kwal_23.50122.278ON3613544482e-51
SAKL0G03520g5.473ON3693544482e-51
KLTH0F15048g5.473ON3683544463e-51
Smik_14.2902.278ON3603774454e-51
NCAS0B062902.278ON3593524437e-51
YNL037C (IDH1)2.278ON3603774411e-50
Kwal_55.212735.473ON3683544412e-50
NDAI0B035902.278ON3593524402e-50
Skud_14.2932.278ON3613774376e-50
TDEL0C038402.278ON3613524377e-50
Kpol_543.85.473ON3683554379e-50
Ecym_33162.278ON3623514351e-49
Kpol_1039.352.278ON3593764342e-49
ZYRO0D02838g2.278ON3613514332e-49
KLTH0G10186g2.278ON3603514332e-49
TPHA0J027705.473ON3763544324e-49
TDEL0A033705.473ON3713544254e-48
ZYRO0D11220g5.473ON3683564245e-48
TPHA0E014805.473ON3773564247e-48
TBLA0B069102.278ON3653524167e-47
KNAG0A052802.278ON3613824106e-46
CAGL0G02673g2.278ON3583514072e-45
KAFR0J014102.278ON3503813956e-44
TBLA0C015001.402ON3653713853e-42
Ecym_12961.402ON3633633835e-42
AAL012C1.402ON3723673706e-40
NDAI0G042301.402ON3633653618e-39
KLLA0D04906g1.402ON3623713592e-38
KNAG0I012801.402ON4473633623e-38
TDEL0B060001.402ON3623713564e-38
KLTH0H12188g1.402ON3643653548e-38
CAGL0H03795g1.402ON3653653503e-37
Kwal_0.2251.402ON3643693461e-36
Smik_3.661.402ON3643653452e-36
KAFR0I022001.402ON3653693434e-36
Kpol_1048.631.402ON3643643425e-36
YCL018W (LEU2)1.402ON3643653391e-35
Suva_14.3022.278ON3002943342e-35
Skud_3.431.402ON3643663347e-35
ZYRO0E04796g1.402ON3623713285e-34
Suva_3.31.402ON3643653251e-33
NCAS0C048701.402ON3653673198e-33
SAKL0D08690g1.402ON3643663153e-32
TPHA0B037301.402ON3653723022e-30
NDAI0D043604.254ON4241151452e-09
CAGL0D00770g4.254ON4231301452e-09
KAFR0H031601.396ON4211271443e-09
YDL066W (IDP1)4.254ON4281151434e-09
Kpol_1055.784.254ON4271151425e-09
TPHA0B022104.254ON4331821391e-08
Skud_4.1894.254ON4291151382e-08
CAGL0H03663g1.396ON4181261382e-08
AAL022W1.396ON4152061382e-08
Kwal_23.42104.254ON4222401353e-08
TBLA0C012901.396ON4181261354e-08
Ecym_13061.396ON4151261345e-08
KLTH0H12012g1.396ON4131941345e-08
KAFR0G032604.254ON4212031345e-08
Smik_4.1694.254ON4281151346e-08
Suva_4.1844.254ON4291151336e-08
TDEL0E011604.254ON4232051336e-08
SAKL0D08426g1.396ON4111261328e-08
KNAG0I013201.396ON4121261328e-08
KNAG0H016701.396ON4241261328e-08
ZYRO0E05016g1.396ON4111271329e-08
SAKL0H02860g4.254ON4212071311e-07
KAFR0I021301.396ON4081261302e-07
NCAS0A087201.396ON4131301302e-07
TDEL0B061001.396ON4141271292e-07
Smik_12.2351.396ON4121261292e-07
KLLA0B03355g4.254ON4291151283e-07
NDAI0G008501.396ON4191301273e-07
KLLA0F12342g1.396ON4151981274e-07
Kpol_1048.701.396ON4191061274e-07
NCAS0G036201.396ON4181311264e-07
YNL009W (IDP3)1.396ON4201261265e-07
TPHA0B036601.396ON4221261265e-07
NCAS0A025104.254ON4261441266e-07
Kwal_0.1911.396ON4111271257e-07
KNAG0D044104.254ON4281671257e-07
Skud_12.2391.396ON4121261248e-07
AER061C4.254ON4251371249e-07
Skud_14.3181.396ON4201261231e-06
TBLA0A080104.254ON4281141231e-06
Suva_10.2711.396ON4121261231e-06
KLTH0D14476g4.254ON4201151231e-06
YLR174W (IDP2)1.396ON4121261231e-06
ZYRO0B12496g4.254ON4221161222e-06
CAGL0B04917g1.396ON4111301212e-06
Suva_14.3391.396ON4171261212e-06
Smik_14.3191.396ON4181261212e-06
Ecym_32654.254ON4241161151e-05
NDAI0G051601.396ON4201271087e-05
Suva_14.303singletonON5350951e-04
TDEL0H036407.86ON1237130703.9
KNAG0D012307.491ON65558695.3
Suva_8.164.6ON1599228687.1
Ecym_50207.21ON790142678.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B03550
         (372 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   763   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   702   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   668   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   664   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   663   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              661   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   659   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   657   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   620   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   617   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   612   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   607   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   607   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   605   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   602   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   602   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   585   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   583   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   556   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   527   0.0  
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   193   1e-57
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   188   8e-56
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   187   1e-55
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   187   2e-55
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    187   5e-55
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   186   6e-55
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   186   6e-55
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   185   1e-54
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   183   1e-53
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   182   3e-53
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   181   5e-53
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   181   9e-53
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   179   2e-52
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   179   4e-52
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   178   5e-52
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   177   1e-51
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   177   1e-51
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   177   1e-51
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   177   2e-51
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   177   2e-51
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   176   3e-51
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   176   4e-51
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   175   7e-51
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   174   1e-50
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   174   2e-50
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   174   2e-50
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   172   6e-50
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   172   7e-50
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   172   9e-50
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   172   1e-49
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   171   2e-49
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   171   2e-49
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   171   2e-49
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   171   4e-49
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   168   4e-48
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   167   5e-48
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   167   7e-48
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            164   7e-47
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              162   6e-46
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   161   2e-45
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   156   6e-44
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   152   3e-42
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   152   5e-42
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   147   6e-40
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   143   8e-39
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   142   2e-38
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   144   3e-38
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   141   4e-38
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   140   8e-38
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             139   3e-37
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   137   1e-36
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   137   2e-36
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   136   4e-36
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   136   5e-36
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   135   1e-35
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   133   2e-35
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   133   7e-35
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   130   5e-34
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      129   1e-33
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   127   8e-33
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   125   3e-32
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   120   2e-30
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    60   2e-09
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    60   2e-09
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    60   3e-09
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    60   4e-09
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    59   5e-09
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    58   1e-08
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    58   2e-08
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    58   2e-08
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    58   2e-08
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    57   3e-08
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    57   4e-08
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    56   5e-08
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    56   5e-08
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    56   5e-08
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    56   6e-08
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    56   6e-08
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    56   6e-08
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    55   8e-08
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    55   8e-08
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    55   8e-08
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    55   9e-08
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    55   1e-07
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    55   2e-07
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    55   2e-07
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    54   2e-07
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    54   2e-07
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    54   3e-07
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     54   3e-07
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    54   4e-07
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    54   4e-07
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    53   4e-07
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    53   5e-07
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    53   5e-07
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    53   6e-07
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    53   7e-07
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    53   7e-07
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    52   8e-07
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    52   9e-07
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    52   1e-06
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    52   1e-06
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    52   1e-06
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    52   1e-06
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    52   1e-06
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    52   2e-06
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    51   2e-06
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    51   2e-06
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    51   2e-06
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    49   1e-05
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    46   7e-05
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    41   1e-04
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    32   3.9  
KNAG0D01230 Chr4 (207381..209348) [1968 bp, 655 aa] {ON} Anc_7.4...    31   5.3  
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...    31   7.1  
Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON} s...    30   8.6  

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/372 (100%), Positives = 372/372 (100%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR
Sbjct: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
           RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE
Sbjct: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST
Sbjct: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360

Query: 361 TQEVTEDVLARL 372
           TQEVTEDVLARL
Sbjct: 361 TQEVTEDVLARL 372

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/374 (91%), Positives = 357/374 (95%), Gaps = 3/374 (0%)

Query: 1   MLRTTASRLAT--CRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFD 58
           MLRT ASR AT  CR YATNA+RKNLTIGLIPGDGIGKEVIPAGKQVL+NLNSKHGL FD
Sbjct: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60

Query: 59  FIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 118
           FIDLQAGFQTFLDTGKALPDET+QVLK+QCQGALFGAVQSPTTKVEGYSSPIVALRKEMG
Sbjct: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120

Query: 119 LYANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIA 178
           L+ANVRPVKSV GT D+PVDMVIVRENT     IK+E+TYID+ATGTRVAEATKRISEIA
Sbjct: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLY-IKIEKTYIDKATGTRVAEATKRISEIA 179

Query: 179 TRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINY 238
           TRRIATIALDIALQRLK NGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG I Y
Sbjct: 180 TRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITY 239

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP 298
           NEQIVDSMVYRMFREPQCFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP
Sbjct: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP 299

Query: 299 CHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGK 358
           CHGSAPDIAGKGI+NPIATIRSTALMLEFLGHN+AAQDIHRAVEAN++ENK+KTPDLGG 
Sbjct: 300 CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGN 359

Query: 359 STTQEVTEDVLARL 372
           STTQ+VTEDVLARL
Sbjct: 360 STTQQVTEDVLARL 373

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/372 (85%), Positives = 354/372 (95%), Gaps = 1/372 (0%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           MLR+ A+RL+TCRG ATNA RK+LTIGLIPGDGIGKEVIPAGKQVL+NLNSKHGL+F+FI
Sbjct: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DL AGFQTF +TGKALPDET++VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+EMGL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           ANVRPVKSVEG  DKP+DMVIVRENT   + IK+E+TYID+ATGTRVA+ATKRISEIATR
Sbjct: 121 ANVRPVKSVEGGKDKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADATKRISEIATR 179

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
           RIATIA+DIAL+RL+T G+ATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYGQI YNE
Sbjct: 180 RIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNE 239

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREPQCFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGI+NPIATIRSTALMLEFLGHN AAQDI++AV+ANL+E  +KTPDLGGK++
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAS 359

Query: 361 TQEVTEDVLARL 372
           TQ+V EDVL+RL
Sbjct: 360 TQQVVEDVLSRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/372 (84%), Positives = 352/372 (94%), Gaps = 1/372 (0%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           M R+ A+RL+ CRG A+NA RK+LTIGLIPGDGIGKEVIPAGKQVL+NLNSKHGL+F+FI
Sbjct: 1   MFRSVATRLSACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DL AGFQTF +TGKALPDET++VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+EMGL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           ANVRPVKSVEG   KP+DMVIVRENT   + IK+E+TYID+ATGTRVA+ATKRISEIATR
Sbjct: 121 ANVRPVKSVEGEKGKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADATKRISEIATR 179

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
           RIATIALDIAL+RL+T G+ATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYGQI YNE
Sbjct: 180 RIATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNE 239

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREPQCFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGI+NPIATIRSTALMLEFLGHNEAAQDI++AV+ANL+E  +KTPDLGGK++
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKAS 359

Query: 361 TQEVTEDVLARL 372
           TQ+V +DVL+RL
Sbjct: 360 TQQVVDDVLSRL 371

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/372 (84%), Positives = 352/372 (94%), Gaps = 1/372 (0%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           M R+ A+R++ CRG A+NA RK+LTIGLIPGDGIGKEVIPAGKQ+L+NLNSKHGL+F+FI
Sbjct: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DL AGFQTF +TGKALPDETI+VLK+QCQGALFGAVQSPTTKVEGYSSPIVALR+EMGLY
Sbjct: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           ANVRPVKSVEGT DKP+DMVIVRENT   + IK+E+TYID+ATGTRVA+A KRISE+ATR
Sbjct: 121 ANVRPVKSVEGTKDKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADAIKRISEVATR 179

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
           RIA IALDIALQRL+T G+ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQI YNE
Sbjct: 180 RIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNE 239

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREPQCFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCH 299

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGI+NPIATIRSTALMLEFLGHN+AAQDI++AV+ANL+E  + TPDLGGK++
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAS 359

Query: 361 TQEVTEDVLARL 372
           TQ+V +DVL+RL
Sbjct: 360 TQQVVDDVLSRL 371

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/372 (84%), Positives = 348/372 (93%), Gaps = 1/372 (0%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           MLR+ A++LA CRG ATNA RK+LTIGLIPGDGIGKEVIPAGKQVLQ+LN KHGLNFDFI
Sbjct: 2   MLRSAANKLAGCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFI 61

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DLQAGFQTF DTGKALPDET+Q+LK +CQGALFGAVQSPTTKVEGYSSPIVALRK MGLY
Sbjct: 62  DLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLY 121

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           AN+RPVKSVEG+ ++PVDM+IVRENT     IK+E+TYID+ATGTRVAEATKRISEIAT+
Sbjct: 122 ANIRPVKSVEGSNERPVDMIIVRENTEDLY-IKIEKTYIDKATGTRVAEATKRISEIATQ 180

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
           RIATIALDIALQRL+ NGKATLTVTHKSNVLSQSDGLFRE+C+++YE+NKDKY  I YNE
Sbjct: 181 RIATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNE 240

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYRMFREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGI+NPIATIRSTALMLEFLGHNEAAQDIH+AV+ANL++  VKT DLGG +T
Sbjct: 301 GSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNAT 360

Query: 361 TQEVTEDVLARL 372
           TQ V +D+LARL
Sbjct: 361 TQNVVDDILARL 372

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/372 (85%), Positives = 347/372 (93%), Gaps = 3/372 (0%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           MLR+   RLAT R YA+    K++ IGLIPGDGIGKEVIPAGKQVL+NL+ KHGLNFDFI
Sbjct: 1   MLRSAIGRLATRRAYASAP--KSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFI 58

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DLQAG+ TF +TGKALP++T+QVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKE+GLY
Sbjct: 59  DLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLY 118

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           ANVRPVKSVEGT D+PVDMVIVRENT     IKLE+TY+D+ATGTRVAEATKRISE+ATR
Sbjct: 119 ANVRPVKSVEGTKDRPVDMVIVRENTEDLY-IKLEKTYVDKATGTRVAEATKRISEVATR 177

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
           RIATIALDIALQRLKTNG ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ+ YNE
Sbjct: 178 RIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNE 237

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYRMFREP+CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 238 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 297

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGISNPIATIRST LMLEFLGHN+ AQDI+RAV+ANL+E+KVKTPDLGG ST
Sbjct: 298 GSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNST 357

Query: 361 TQEVTEDVLARL 372
           TQ+V ED+L++L
Sbjct: 358 TQQVVEDILSKL 369

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/372 (84%), Positives = 351/372 (94%), Gaps = 1/372 (0%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           M R+ A+R++ CRG ATNA RK+LTIGLIPGDGIGKEVIPAGKQVL+NLNSKHGL+F+FI
Sbjct: 1   MFRSVATRVSACRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DL AGFQTF +TGKALPDET+ VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+EMGL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           ANVRPVKSVEG+ +KP+DMVIVRENT   + IK+E+TYID+ATGTRVA+ATKRISEIATR
Sbjct: 121 ANVRPVKSVEGSRNKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADATKRISEIATR 179

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
           RIATIALDIAL+RL+T G+ATLTVTHKSNVLSQ+DGLFREICK+VYESNKDKYGQI YNE
Sbjct: 180 RIATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNE 239

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREPQCFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGI+NPIATIRSTALMLEFLGHN AAQDI++AV+ANL+E  + TPDLGGK++
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKAS 359

Query: 361 TQEVTEDVLARL 372
           TQ+V +DVL+RL
Sbjct: 360 TQQVVDDVLSRL 371

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/373 (79%), Positives = 338/373 (90%), Gaps = 3/373 (0%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           MLR+  ++ AT R  +T  I K+LTIGLIPGDGIGKEVIPAGKQVLQNL+S+HGLNF+FI
Sbjct: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DL+AGFQTFLDTGKALPDET++VLK QCQG LFGAVQSPTT+V+ YSSPIVALRKE+ LY
Sbjct: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120

Query: 121 ANVRPVKSVEGT-TDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIAT 179
           AN+RPVKSV G  + KPVDMVIVRENT     IK+E++Y D+  G RVAEATKRI+E+AT
Sbjct: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLY-IKIEKSYKDQ-NGMRVAEATKRITEVAT 178

Query: 180 RRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYN 239
           R+IA IALD+ALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY++NKDKY  INYN
Sbjct: 179 RKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYN 238

Query: 240 EQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 299
           EQI+DSMVYRMFREP+ FDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPC
Sbjct: 239 EQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPC 298

Query: 300 HGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKS 359
           HGSAPDIAGKGI+NPIATIRSTALMLEFLGH EAAQDIH+AVE+N++ENK+KTPDLGG S
Sbjct: 299 HGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNS 358

Query: 360 TTQEVTEDVLARL 372
           +TQ V +DVL +L
Sbjct: 359 STQNVVDDVLEKL 371

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/373 (79%), Positives = 341/373 (91%), Gaps = 2/373 (0%)

Query: 1   MLRTTASRLATCRGYATNAI-RKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDF 59
           MLR +A+RL   RG+++  + +K LTIGLIPGDGIGKEVIPAGKQ+L+ +  K  L+F F
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60

Query: 60  IDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGL 119
           IDL AG++TF +TGKALPDET++VL+  CQGALFGAVQSPTTKVEGYSSPIVALRK MGL
Sbjct: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 120 YANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIAT 179
           +ANVRPVK+VEGT D+PVDMVIVRENT   + IK+E+TY D ATGTRVAEATKRISE+AT
Sbjct: 121 FANVRPVKAVEGTNDRPVDMVIVRENTED-LYIKIEKTYTDPATGTRVAEATKRISEVAT 179

Query: 180 RRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYN 239
           RRIATIALDIALQRL++ G ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG+I YN
Sbjct: 180 RRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYN 239

Query: 240 EQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 299
           EQIVDSMVYRMFREP+CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC
Sbjct: 240 EQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 299

Query: 300 HGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKS 359
           HGSAPDIAG+GI+NPIATIRSTALMLEFLG+ EAAQ I++AV++N++EN++KTPDLGGKS
Sbjct: 300 HGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKS 359

Query: 360 TTQEVTEDVLARL 372
           TTQ+V +D+L+++
Sbjct: 360 TTQQVVDDILSKI 372

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/372 (79%), Positives = 336/372 (90%), Gaps = 4/372 (1%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           MLR+T S+ A  R YA+ A  K LTIGLIPGDGIGKEVIPAGK VL+NL+SKH L F+FI
Sbjct: 1   MLRSTVSQFAR-RSYASAA--KPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFI 57

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DLQAG+QTFLDTGKALPDETI++LK+ CQGALFGAVQSPT KVEGYSSPIVALRK++GLY
Sbjct: 58  DLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           ANVRPVKSV+GT D+PVDM+IVRENT     IK E+TYID  TGTRVAEA KRISE AT 
Sbjct: 118 ANVRPVKSVQGTNDRPVDMIIVRENTEDLY-IKTEKTYIDEKTGTRVAEAIKRISETATT 176

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
            IA IAL+I+LQRLK NGKATLTVTHKSNVLSQSDGLFRE+CK+VYESNK++YG I YNE
Sbjct: 177 DIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNE 236

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCH
Sbjct: 237 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCH 296

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGISNPIATIRSTALMLEF+G+ EAAQDIH+AV+ N++EN++KTPDLGGKST
Sbjct: 297 GSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKST 356

Query: 361 TQEVTEDVLARL 372
           TQ+V +D+L+++
Sbjct: 357 TQQVVDDILSKM 368

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/372 (79%), Positives = 335/372 (90%), Gaps = 5/372 (1%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           MLR + ++LA  R YA+ +  K+LTIGLIPGDGIGKEVIPAG+QVL+NL+SKHGL FDFI
Sbjct: 1   MLRASFTQLAR-RSYASAS--KSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DLQAG+QTF +TGKALPDETI +L+NQCQGALFGAVQSPT KVEGYSSPIVALRK++GLY
Sbjct: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           ANVRPVKSV    ++PVDM+IVRENT   + IK E+TYID  TGTRVAEA KRISE AT+
Sbjct: 118 ANVRPVKSVL-PQERPVDMIIVRENTED-LYIKTEKTYIDEKTGTRVAEAIKRISETATK 175

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
            IA IAL+IALQR K NG+ATLTVTHKSNVLSQSDGLFRE+C+ VYESNKDK+G I YNE
Sbjct: 176 NIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNE 235

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYRMFREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCH
Sbjct: 236 QIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCH 295

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGISNP+ATIRSTALMLEF+GH EAAQDIH+AV+ANL++N +KTPDLGGKST
Sbjct: 296 GSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKST 355

Query: 361 TQEVTEDVLARL 372
           TQ+V EDVL+R+
Sbjct: 356 TQQVVEDVLSRM 367

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/372 (79%), Positives = 336/372 (90%), Gaps = 5/372 (1%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           MLRT+ ++LA  R Y +    K+LTIGLIPGDGIG+EVIPAGK VL+NL+SKHGL F+FI
Sbjct: 1   MLRTSFNQLAR-RSYTSAT--KSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFI 57

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DL+AG+QTFLDTGKALPDETI +LKN+CQGALFGAVQSPT KVEGYSSPIVALRK++GLY
Sbjct: 58  DLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           ANVRPVKSV  + +KP+DMVIVRENT   + IK E+TYID  TGTRVAEA KRISE+ATR
Sbjct: 118 ANVRPVKSVL-SQEKPIDMVIVRENTED-LYIKTEKTYIDEKTGTRVAEAIKRISEVATR 175

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
            IA IAL+IALQR K NG ATLTVTHKSNVLSQSDGLFREIC+ VYESN+DK+G INYNE
Sbjct: 176 NIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNE 235

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCH
Sbjct: 236 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCH 295

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGISNP+ATIRSTALMLEF+GH EAAQDIH+AV+ANL++N VKTPDLGGKST
Sbjct: 296 GSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKST 355

Query: 361 TQEVTEDVLARL 372
           TQ+V +DVL+R+
Sbjct: 356 TQQVVDDVLSRM 367

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/372 (78%), Positives = 330/372 (88%), Gaps = 4/372 (1%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           M R++ +++A  R Y+     K++ IGLIPGDGIGKEVIPAGKQVL+ L SKHGL FDFI
Sbjct: 1   MFRSSVAKVAARRAYSAP---KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFI 57

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DL+AG++ F   GKALPD+T++VLK QCQGALFGAVQSPTTKV GYSSPIVALRKE+GLY
Sbjct: 58  DLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLY 117

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           ANVRPVKSVE   D+ VDM+IVRENT   + IK E+TY+D ATGTRVAEA KRISE+ATR
Sbjct: 118 ANVRPVKSVEKGNDRNVDMIIVRENTED-LYIKTEKTYVDEATGTRVAEAIKRISEVATR 176

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
           +IATIALDI+LQRLK+ G ATLTVTHKSNVLSQSDGLFREICKDVYE NKDKYG++ YNE
Sbjct: 177 KIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNE 236

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYRMFREP+CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 237 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 296

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGISNPIATIRSTALMLEFLGH E AQDI++AV+ANL +  V TPDLGGK+T
Sbjct: 297 GSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKAT 356

Query: 361 TQEVTEDVLARL 372
           TQ+V +D+L+++
Sbjct: 357 TQQVVDDILSKI 368

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/372 (77%), Positives = 327/372 (87%), Gaps = 2/372 (0%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           MLR    R A  R    N  R NLTIGLIPGDGIGKEVIPAGK+VL+ +  K+ ++F FI
Sbjct: 1   MLRNGVYR-ACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFI 59

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DL AG+QTFLDTGKALPDET+ +LK QCQGALFGAVQSPTTKVEGYSSPIVALRK++GLY
Sbjct: 60  DLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLY 119

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           AN+RPVKSV GT D+PVDMVIVRENT     IK ERTYID ATGT+VAEATKRISE+ATR
Sbjct: 120 ANIRPVKSVSGTNDRPVDMVIVRENTEDLY-IKEERTYIDEATGTKVAEATKRISEVATR 178

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
           +IA IALDIALQRLK  GKATLTVTHKSNVLSQSDGLFRE+C+DVYE NKD YG ++YNE
Sbjct: 179 KIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNE 238

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREP+CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCH
Sbjct: 239 QIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCH 298

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDI+G+GISNP+ATIRS ALML+FLG+NEAA+DI  AV+ N++  K+KTPDLGG S+
Sbjct: 299 GSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSS 358

Query: 361 TQEVTEDVLARL 372
           T EVT+D+L++L
Sbjct: 359 TTEVTDDILSKL 370

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/372 (79%), Positives = 335/372 (90%), Gaps = 4/372 (1%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           M+RT   +L+  R YA+NA  KNLTIGLIPGDGIGKEVIPAGK++L++LN K+GL+F FI
Sbjct: 1   MMRTRFIQLSR-RAYASNA--KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFI 57

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DLQAG++TF +TGKALPDETI +LKNQC+GALFGAVQSPTTKVEGYSSPIVALRK +GL+
Sbjct: 58  DLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLF 117

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           ANVRPVKSV+GT D+ VD+VIVRENT     IKLE++YID ATGTRVA+ATKRI+EIAT+
Sbjct: 118 ANVRPVKSVDGTKDRKVDLVIVRENTEDLY-IKLEKSYIDEATGTRVADATKRITEIATK 176

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
            IATIAL IA QRL+ NG ATLTVTHKSNVLSQSDGLFRE+C++ YE+NKDKYG + YNE
Sbjct: 177 NIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNE 236

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYRMFREP+CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCH
Sbjct: 237 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCH 296

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGISNPIATIRSTALMLEFLG+ E A+DIH+AV+AN++E K  TPDLGG ST
Sbjct: 297 GSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNST 356

Query: 361 TQEVTEDVLARL 372
           TQ+V EDVL++L
Sbjct: 357 TQQVLEDVLSKL 368

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/372 (75%), Positives = 325/372 (87%), Gaps = 3/372 (0%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           MLRT+  + +     A++   K LTIGLIPGDGIGKEVIPAGKQVLQNLN KHGL F+FI
Sbjct: 1   MLRTSVRQFSVSARNASSL--KTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFI 58

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DLQAG+QTFLDTG ALP +T+ +LKN+CQGALFGAVQSPTTKVEGYSSPIV LRKE+GL+
Sbjct: 59  DLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLF 118

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           ANVRPVK+VEGT  KP+D+VIVRENT     IK+E+TY D   G+R+AEATKRI+E AT+
Sbjct: 119 ANVRPVKTVEGTDAKPIDLVIVRENTEDLY-IKIEKTYTDPKDGSRIAEATKRITETATK 177

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
           RIA  ALDIALQRLKT G ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK  Y  + YNE
Sbjct: 178 RIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNE 237

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCH
Sbjct: 238 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCH 297

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGI+NPIATIRSTA MLE+LG++  AQDI++AV+AN+++NK+KT DLGG ST
Sbjct: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357

Query: 361 TQEVTEDVLARL 372
           TQ+V +D+L +L
Sbjct: 358 TQQVIDDILGKL 369

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/372 (76%), Positives = 320/372 (86%), Gaps = 1/372 (0%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           MLR +       R     + + NLTIGLIPGDGIGKEVIP+G+QVL+ +  KHGL F+FI
Sbjct: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DLQAG+QTFLDTGKALP ET++ L+  C GALFGAVQSPTTKVEGYSSPIVALRKE+GLY
Sbjct: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           AN+RPVKSV+   +K VDMVIVRENT     IKLE+TYID  TGTRVA+ATKRISE+ATR
Sbjct: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLY-IKLEKTYIDEKTGTRVADATKRISEVATR 179

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
           RIA IALDIALQRLK NG   LTVTHKSNVLSQSDGLFRE+CK+V+ESNK  Y  I YNE
Sbjct: 180 RIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNE 239

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QI+DSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCH
Sbjct: 240 QIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCH 299

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAGKGISNPIATIRSTALMLEFLGH++AAQDI  AV++NL+E+K+KTPDLGGK++
Sbjct: 300 GSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNS 359

Query: 361 TQEVTEDVLARL 372
           T +V  DV+ RL
Sbjct: 360 TSDVVNDVIRRL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/372 (73%), Positives = 317/372 (85%), Gaps = 6/372 (1%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           MLR    +L+T R Y T+   K+ TIGLIPGDGIGKEVIP G++VL+ +  K+G++F +I
Sbjct: 1   MLRVGRGQLST-RTYVTS---KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYI 56

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
           DLQAG+QTFLDTGKALPD+T++ L+N CQGALFGAVQSPTTKV+GYSSPIVALRK +GLY
Sbjct: 57  DLQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLY 116

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           AN+RPVKSV+GT D+PVD+VI RENT     IK ERTYID+ TG RVAEA KRISE ATR
Sbjct: 117 ANIRPVKSVDGTGDRPVDLVIARENTEDLY-IKSERTYIDKETGGRVAEAIKRISEHATR 175

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
            IA IAL+IALQRLK  G ATLTVTHKSNVLSQSDGLFREICK VY+SNK K+  + YNE
Sbjct: 176 NIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNE 234

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+F+EPQCFDV+VAPNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCH
Sbjct: 235 QIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCH 294

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDI G+GI+NPIATIRS AL+LEFLG  EAA+ I + V+ N++ENK+KTPDLGG ST
Sbjct: 295 GSAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNST 354

Query: 361 TQEVTEDVLARL 372
            ++V  D+L+R+
Sbjct: 355 GEQVANDILSRI 366

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/372 (68%), Positives = 308/372 (82%), Gaps = 5/372 (1%)

Query: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60
           M R++A+ L     YAT+   K LTIGLIPGDGIGKEVIPAG++VL+ +  KH + F + 
Sbjct: 1   MHRSSATSLIHKATYATS---KTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYE 57

Query: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120
            L AG+QTFL+TG ALP  T++ L+ +CQGALFGAVQSPTTKVEGYSSPIVALR+++GLY
Sbjct: 58  HLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLY 117

Query: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180
           AN+RPVKSV GT  +PVD+VIVRENT     ++ ERTY+D ATG RVAEA KRISE AT 
Sbjct: 118 ANIRPVKSVSGT-GQPVDLVIVRENTEDLY-VQQERTYVDAATGKRVAEAIKRISEPATE 175

Query: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240
           RIA I+L +ALQR +  G+  LTVTHKSNVLSQ+DGLF+E+C++VYE+NK  YG I YNE
Sbjct: 176 RIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNE 235

Query: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+F+EP CFDVVVAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCH
Sbjct: 236 QIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCH 295

Query: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360
           GSAPDIAG+GI+NPIATIRS +LML+FLG  EAA DI +AV  NLK+ +V +PDLGGK+T
Sbjct: 296 GSAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNT 355

Query: 361 TQEVTEDVLARL 372
           TQEV +D+LAR+
Sbjct: 356 TQEVLDDILARI 367

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  193 bits (490), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 144/384 (37%), Positives = 202/384 (52%), Gaps = 37/384 (9%)

Query: 1   MLRTTASRLATCRGYATNAIRKNL---------TIGLIPGDGIGKEVIPAGKQVLQNLNS 51
           M R T S + T RGYA  A R+ L         T+ LIPGDGIGKEV  +  Q+ +  N 
Sbjct: 1   MFRNTLSHI-TKRGYA--AGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEAENV 57

Query: 52  KHGLNFDFIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIV 111
              ++++ ++L A     L+       + ++ LK    G L G   +P  +  G+ S  V
Sbjct: 58  P--VDWESVELSA-----LEENHEGVQKAVESLKRNKVG-LKGIWHTPADQT-GHGSLNV 108

Query: 112 ALRKEMGLYANVRPVKSVEGTTDK--PVDMVIVRENTRRFINIKLERTYIDRATGTRVAE 169
           A RK++ ++ANV   KS  G   K   VD+VI+RENT        E + ++  +   V E
Sbjct: 109 AFRKQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEG------EYSGLEHESVPGVVE 162

Query: 170 ATKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN 229
           + K +++  + RIA  A D AL   K N KA   V HK+N++   DGLFR     V E  
Sbjct: 163 SLKIMTKAKSERIARFAFDFAL---KNNRKAVCAV-HKANIMKLGDGLFRNT---VSEIG 215

Query: 230 KDKYGQINYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANV 289
             +Y ++N +  IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN 
Sbjct: 216 AKEYPEVNVSSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANF 275

Query: 290 GPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKEN 348
           G E  + EP C     DI G+ ++NP A I S+ LML  LG NE A  I RA    + E 
Sbjct: 276 GREYAVFEPGCRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEG 335

Query: 349 KVKTPDLGGKSTTQEVTEDVLARL 372
           K  T D+GG +TT E T  V+ +L
Sbjct: 336 KRTTKDIGGTATTTEFTNAVIDKL 359

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  188 bits (478), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 129/354 (36%), Positives = 195/354 (55%), Gaps = 28/354 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+  I GDGIG E+  + K +     +K  + +++ D+   F   L T   +PD  +Q +
Sbjct: 39  TVSFIEGDGIGPEISQSVKDIFSA--AKVPVEWEYCDVTPIFINGLTT---IPDPAVQSI 93

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+EG  TT + VD+V++
Sbjct: 94  -NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 150

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + I+      V ++ K I+  A+ R+   A + A    +  G+  +
Sbjct: 151 RENTEG------EYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKV 200

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VV 260
            V HKS +   +DGLF  + ++V      +Y  I    +++D+ V  +  +P+ +   V 
Sbjct: 201 VVVHKSTIQRLADGLFVNVAQEV----GKEYPDIELQPELIDNTVLNVVSKPEKYSDSVA 256

Query: 261 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319
           V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + 
Sbjct: 257 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLL 316

Query: 320 STALMLEFLGHNEAAQDIHRAVEANL-KENKVKTPDLGGKSTTQEVTEDVLARL 372
           S+ +ML  +G +E A  I  AV A +  + K +T DL G +TT   T+ V+ RL
Sbjct: 317 SSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  187 bits (476), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 130/355 (36%), Positives = 193/355 (54%), Gaps = 30/355 (8%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQ-V 83
           T+  I GDGIG E+  + K++    +    +N++F D+   F   L T   +PD  +Q +
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFSAADVP--INWEFCDVNPIFVNGLTT---IPDPAVQSI 92

Query: 84  LKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVI 141
            KN    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+EG  TT + VD+V+
Sbjct: 93  TKNLV--ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVL 148

Query: 142 VRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKAT 201
           +RENT        E + I+      V ++ K I+  A+ R+   A + A    +  G+  
Sbjct: 149 IRENTEG------EYSGIEHIVCPGVVQSIKLITREASERVIRYAFEYA----RAIGRPR 198

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--V 259
           + V HKS +   +DGLF  + K++      +Y  I +  +++D+ V  +   P  +   V
Sbjct: 199 IIVVHKSTIQRLADGLFVNVAKEL----SKEYPDITFETELIDNKVLNVVTNPSAYTNAV 254

Query: 260 VVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATI 318
            V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAGK  +NP A +
Sbjct: 255 SVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALL 314

Query: 319 RSTALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372
            S+ +ML  +G    A  I  AV + +    + +T DL G +TT   TE V+ RL
Sbjct: 315 LSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  187 bits (476), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 134/386 (34%), Positives = 204/386 (52%), Gaps = 36/386 (9%)

Query: 1   MLRTTASRLATCRGYAT--------NAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSK 52
           +LR T  R  + +   +        N      T+  I GDGIG E+  + KQ+     +K
Sbjct: 6   ILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDA--AK 63

Query: 53  HGLNFDFIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVA 112
             ++++  D+   F   L T   +P+  +Q + N+   AL G + +P  K  G+ S  + 
Sbjct: 64  VPIDWEPCDVSPLFINGLTT---IPEPAVQSI-NKNLVALKGPLATPIGK--GHRSLNLT 117

Query: 113 LRKEMGLYANVRPVKSVEG--TTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEA 170
           LRK  GL+ANVRP KS+EG  T    VD+VI+RENT        E + I+      V ++
Sbjct: 118 LRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEG------EYSGIEHVVTPGVVQS 171

Query: 171 TKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNK 230
            K I+  A+ R+   A + A    +  G+  + V HKS +   +DGLF ++ K++ +   
Sbjct: 172 IKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQ--- 224

Query: 231 DKYGQINYNEQIVDSMVYRMFREPQCFD--VVVAPNLYGDILSDGAAAL-VGSLGVVPSA 287
            +Y  I    +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSA
Sbjct: 225 -EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSA 283

Query: 288 NVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKE 347
           N+G E+ I E  HGSAPDIAG+  +NP A + S+ +ML  +G N  A  I +AV + +  
Sbjct: 284 NIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIAS 343

Query: 348 N-KVKTPDLGGKSTTQEVTEDVLARL 372
             + +T DL GK+TT   T+ V+ RL
Sbjct: 344 GPEGRTGDLAGKATTSSFTDAVIGRL 369

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  187 bits (476), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 133/386 (34%), Positives = 205/386 (53%), Gaps = 36/386 (9%)

Query: 1   MLRTTASRLATCRGYAT--------NAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSK 52
           +LRTT  RL + +   +        N      T+  I GDGIG E+  + KQ+     +K
Sbjct: 59  ILRTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSA--AK 116

Query: 53  HGLNFDFIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVA 112
             + ++  D+      F+D    +P+  +Q + N+   AL G + +P  K  G+ S  + 
Sbjct: 117 VPIEWETCDVTP---LFIDGLTTIPEPAVQSI-NKNLVALKGPLATPIGK--GHRSLNLT 170

Query: 113 LRKEMGLYANVRPVKSVEG--TTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEA 170
           LRK  GL+ANVRP +SV+G  TT   VD+V++RENT        E + I+      V ++
Sbjct: 171 LRKTFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEG------EYSGIEHVVTPGVVQS 224

Query: 171 TKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNK 230
            K I+  A+ R+    +  A +  +  G+  L V HKS +   SDGLF  + K++     
Sbjct: 225 IKLITREASERV----IRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKEL----S 276

Query: 231 DKYGQINYNEQIVDSMVYRMFREPQCFD--VVVAPNLYGDILSDGAAAL-VGSLGVVPSA 287
            +Y  I +  +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+ PS 
Sbjct: 277 KEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSG 336

Query: 288 NVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKE 347
           N+G EI I E  HGSAPDIAGK ++NP A + S+ +ML  +G ++ A  I  AV + +  
Sbjct: 337 NIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIAS 396

Query: 348 N-KVKTPDLGGKSTTQEVTEDVLARL 372
             + +T DL G +TT   T+ V+ +L
Sbjct: 397 GPESRTGDLAGTATTSTFTDAVIKKL 422

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  186 bits (472), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 140/392 (35%), Positives = 202/392 (51%), Gaps = 43/392 (10%)

Query: 1   MLRTTASRLATCRGYAT-------------NAIRKNLTIGLIPGDGIGKEVIPAGKQVLQ 47
           MLR T  R  + R  AT             N      T+  I GDGIG E+  + K++  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 48  NLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQ-VLKNQCQGALFGAVQSPTTKVEGY 106
             N    + ++F D+   F   L T   +PD  +Q + KN    AL G + +P  K  G+
Sbjct: 61  AANVP--IEWEFCDVNPIFVNGLTT---IPDPAVQSITKNLV--ALKGPLATPIGK--GH 111

Query: 107 SSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIVRENTRRFINIKLERTYIDRATG 164
            S  + LRK  GL+ANVRP KSVEG  TT + VD+V++RENT        E + I+    
Sbjct: 112 RSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEG------EYSGIEHIVC 165

Query: 165 TRVAEATKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKD 224
             V ++ K I+  A+ R+   A + A    +  G+  + V HKS +   +DGLF  + K+
Sbjct: 166 PGVVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKE 221

Query: 225 VYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VVVAPNLYGDILSDGAAAL-VGSL 281
           +      +Y  I    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSL
Sbjct: 222 L----SKEYPDITLETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSL 277

Query: 282 GVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAV 341
           G+ PSAN+G +I I E  HGSAPDIAG+  +NP A + S+ +ML  +G    A  I  AV
Sbjct: 278 GLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAV 337

Query: 342 EANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372
            + +    + +T DL G +TT   TE V+ RL
Sbjct: 338 LSTIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  186 bits (472), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 126/354 (35%), Positives = 196/354 (55%), Gaps = 28/354 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+  I GDG+G E+  + K +     +K  + ++  D+   F   L T   +PD  +  +
Sbjct: 37  TVSFIEGDGVGPEISKSVKAIFSA--AKVPIEWESCDVSPIFVNGLTT---IPDPAVASI 91

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+EG  TT + V++V++
Sbjct: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + I+      V ++ K I++ A+ R+   A + A    +   ++ +
Sbjct: 149 RENTEG------EYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYA----RAVDRSKV 198

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VV 260
            V HKS +   +DGLF ++ K +      +Y  I    +++D+ V +  + P+ +D  VV
Sbjct: 199 LVVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVV 254

Query: 261 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319
           V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + 
Sbjct: 255 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 320 STALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372
           S+ +ML  +G  E A  I +AV   +  + K +T DLGG ++T   T+ V+ RL
Sbjct: 315 SSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  185 bits (470), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 193/353 (54%), Gaps = 28/353 (7%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVLK 85
           +  I GDGIG E+  + K + +   ++  +N++F D+   F   L T   +PD  +  + 
Sbjct: 43  VSFIEGDGIGPEISQSVKDIFKA--AEVPINWEFCDVTPIFVNGLTT---IPDPAVASI- 96

Query: 86  NQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIVR 143
           N+   AL G + +P  K  G+ S  + LRK   L+ANVRP KS+EG  TT   VD+V++R
Sbjct: 97  NKNLIALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154

Query: 144 ENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATLT 203
           ENT        E + I+      V ++ K I+  A+ R+   A + A    K  G+  + 
Sbjct: 155 ENTEG------EYSGIEHVVAPGVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVV 204

Query: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VVV 261
           V HKS +   +DGLF  + K++ +    +Y +I    +++D+ V  +   P  +   V V
Sbjct: 205 VVHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSV 260

Query: 262 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRS 320
            PNLYGDILSD  + L  GSLG+ PSAN+G EI I E  HGSAPDIAG+  +NP A + S
Sbjct: 261 CPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLS 320

Query: 321 TALMLEFLGHNEAAQDIHRAVEANL-KENKVKTPDLGGKSTTQEVTEDVLARL 372
           + +ML  +G  + A  I RAV   +   +K +T DLGG +TT   T+ V+  L
Sbjct: 321 SVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  183 bits (464), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 129/354 (36%), Positives = 190/354 (53%), Gaps = 28/354 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+  I GDGIG E+  + K++    N    + ++  D+   F   L T   +PD  +Q +
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFNAANVP--IEWESCDVNPIFVNGLTT---IPDAAVQSI 92

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142
            N    AL G + +P  K  G+ S  + LRK  GL+ANVRP KSVEG  TT + VD+V++
Sbjct: 93  TNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + I+      V ++ K I+  A+ R+   A + A    +  G+  +
Sbjct: 150 RENTEG------EYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA----RAIGRPRV 199

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VV 260
            V HKS +   +DGLF  + K++      +Y  I    +++D+ V ++   P  +   V 
Sbjct: 200 IVVHKSTIQRLADGLFVNVAKEL----SKEYPDIILETELIDNSVLKVVTNPSAYTNAVS 255

Query: 261 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319
           V PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  +NP A + 
Sbjct: 256 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLL 315

Query: 320 STALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372
           S+ +ML  +G    A  I  AV + +    + +T DL G +TT   TE V+ RL
Sbjct: 316 SSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  182 bits (461), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 132/397 (33%), Positives = 210/397 (52%), Gaps = 49/397 (12%)

Query: 1   MLRTTASRLATCRGYATNAIRK-----------------NLTIGLIPGDGIGKEVIPAGK 43
           MLRT A++ +  R ++T++  +                   T+  I GDG+G E+  + K
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 44  QVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKV 103
            + +   ++  +++++ D+       L T   +P+  +Q + N+ + AL G + +P  K 
Sbjct: 61  DIFKA--AQVPVDWEYCDVSPLLINGLTT---IPEPAVQQI-NKHKIALKGPLATPIGK- 113

Query: 104 EGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIVRENTRRFINIKLERTYIDR 161
            G+ S  + LRK  GL+ANVRP +S+ G  TT K VD+V++RENT        E + I+ 
Sbjct: 114 -GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEG------EYSGIEH 166

Query: 162 ATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREI 221
                V ++ K I+  A+ R+   A + A    +  G+  L V HKS +   +DGLF  I
Sbjct: 167 VVAPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLFVNI 222

Query: 222 CKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VVVAPNLYGDILSDGAAAL-V 278
            K++      ++  I    +++D+ V  + R+P  +   V V PNLYGDILSD  + L  
Sbjct: 223 AKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSA 278

Query: 279 GSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIH 338
           GSLG+ PSAN+G E+ I E  HGSAPDIAG+  +NP A + S+ +ML ++G    +  I 
Sbjct: 279 GSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIE 338

Query: 339 RAVE---ANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
            A+    A+  EN  +T DL G +TT   TE V+  L
Sbjct: 339 NAILNTIASGSEN--RTGDLAGTATTSSFTESVIKNL 373

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  181 bits (459), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 137/392 (34%), Positives = 201/392 (51%), Gaps = 43/392 (10%)

Query: 1   MLRTTASRLATCRGYAT-------------NAIRKNLTIGLIPGDGIGKEVIPAGKQVLQ 47
           MLR T  R  + R  AT             N      T+  I GDGIG E+  + K++  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 48  NLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQ-VLKNQCQGALFGAVQSPTTKVEGY 106
             N    + ++  D+   F   L T   +PD  +Q + KN    AL G + +P  K  G+
Sbjct: 61  AANVP--IEWESCDVSPIFVNGLTT---IPDPAVQSITKNLV--ALKGPLATPIGK--GH 111

Query: 107 SSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIVRENTRRFINIKLERTYIDRATG 164
            S  + LRK  GL+ANVRP KS+EG  TT + VD+V++RENT        E + I+    
Sbjct: 112 RSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEG------EYSGIEHIVC 165

Query: 165 TRVAEATKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKD 224
             V ++ K I+  A+ R+   A + A    +  G+  + V HKS +   +DGLF  + K+
Sbjct: 166 PGVVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKE 221

Query: 225 VYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VVVAPNLYGDILSDGAAAL-VGSL 281
           +      +Y  +    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSL
Sbjct: 222 L----SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSL 277

Query: 282 GVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAV 341
           G+ PSAN+G +I I E  HGSAPDIAG+  +NP A + S+ +ML  +G    A  I  AV
Sbjct: 278 GLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAV 337

Query: 342 EANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372
            + +    + +T DL G +TT   TE V+ RL
Sbjct: 338 LSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  181 bits (458), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 127/354 (35%), Positives = 188/354 (53%), Gaps = 26/354 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+  I GDGIG E+  + K + Q  +    + ++  D+       +D    +PDE ++ +
Sbjct: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSP---ILVDGLTTIPDEAVKSI 99

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142
                G L G + +P  K  G+ S  + LRK   L+ANVRP KSV G  TT   VD+V++
Sbjct: 100 NKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLI 156

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + I+      V ++ K I+  A+ R+   A + A    K  G+  +
Sbjct: 157 RENTEG------EYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYA----KAIGRPKV 206

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VV 260
            V HKS +   SDGLF  + K++ +  +  +  I  + +++D+ V  +   P  +   V 
Sbjct: 207 IVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKYSDAVF 264

Query: 261 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319
           V PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  +NP A + 
Sbjct: 265 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKANPTALLL 324

Query: 320 STALMLEFLGHNEAAQDIHRAVEANL-KENKVKTPDLGGKSTTQEVTEDVLARL 372
           S+ +ML  +G NE    I  AV   +   +K +T DLGG +TT   TE V+  L
Sbjct: 325 SSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  179 bits (455), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 189/353 (53%), Gaps = 30/353 (8%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDF--IDLQAGFQTFLDTGKALPDETIQ 82
           T+ LIPGDGIGKEV  +  ++     +  GL  D+  ID+  G     +  KA     ++
Sbjct: 30  TVTLIPGDGIGKEVTDSVVKIF----ASQGLPIDWERIDV-PGMSNENEVKKA-----VE 79

Query: 83  VLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDK--PVDMV 140
            LK    G     +   +    GY S  VALRK++ ++ANV   KS++G   K   VD+V
Sbjct: 80  SLKRNKIG--LKGIWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLV 137

Query: 141 IVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKA 200
           ++RENT        E + ++  +   V E+ K I++  T RIA  A D AL+    N ++
Sbjct: 138 VIRENTEG------EYSGLEHESVPGVVESLKIITKPKTERIARFAFDFALE----NNRS 187

Query: 201 TLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVV 260
           T+T  HK+N++  SDGLF+    +V E    +Y  I  N  IVD+   +   +P  FDV+
Sbjct: 188 TVTAVHKANIMKLSDGLFKNTVAEVGEK---EYPDIKVNTIIVDNASMQAVAKPHQFDVM 244

Query: 261 VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIR 319
           V P++YG IL +  AAL+G  G++P AN G E  + EP       DI  + I+NP A I 
Sbjct: 245 VTPSMYGTILGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMIL 304

Query: 320 STALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
           S  LML  LG  E ++ I  AV A ++E K  T D+GG ++T E T+ V+ +L
Sbjct: 305 SATLMLNQLGLREESKRISNAVYAVIEEGKTTTKDIGGNASTTEFTDAVIDKL 357

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  179 bits (453), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 124/355 (34%), Positives = 192/355 (54%), Gaps = 28/355 (7%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQV 83
            T+  I GDGIG E+  + K++ Q  +    + ++  D+   F   L T   +PD  +Q 
Sbjct: 36  FTVSFIEGDGIGPEISSSVKRIFQAADVP--VEWETCDVTPIFVNGLTT---IPDPAVQS 90

Query: 84  LKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVI 141
           + N+   AL G + +P  K  G+ S  + LRK   L+ANVRP KS+EG  TT + VD+V+
Sbjct: 91  I-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYENVDLVL 147

Query: 142 VRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKAT 201
           +RENT        E + I+      V ++ K I+  A+ R+   A + A    +  G+  
Sbjct: 148 IRENTEG------EYSGIEHLVSPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPR 197

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--V 259
           L V HKS +   +DGLF  + K++      +Y  I    +++D+    +   P  +   V
Sbjct: 198 LIVVHKSTIQRLADGLFVNVAKEL----AAEYPDIQLETELIDNTCLNVVSNPSSYTDAV 253

Query: 260 VVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATI 318
            V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP A +
Sbjct: 254 SVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALL 313

Query: 319 RSTALMLEFLGHNEAAQDIHRAVEANLK-ENKVKTPDLGGKSTTQEVTEDVLARL 372
            S+ +ML  +G  E A  I +AV   +   ++ +T DLGG ++T   T+ ++ +L
Sbjct: 314 LSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAIIKKL 368

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  178 bits (451), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 120/351 (34%), Positives = 190/351 (54%), Gaps = 26/351 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+ LIPGDG+GKEV  +  ++ +N N    ++++ ID+ +G +   +  +A     ++ L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVKIFENENIP--IDWETIDI-SGLENTENVQRA-----VESL 82

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDK--PVDMVIV 142
           K    G L G   +P  +  G+ S  VALRK++ ++ANV   KS+ G   +   +DMVI+
Sbjct: 83  KRNKVG-LKGIWHTPADQT-GHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVII 140

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + ++  +   V E+ K ++   + RIA  A D AL+    N + ++
Sbjct: 141 RENTEG------EYSGLEHESVPGVVESLKIMTRAKSERIARFAFDFALK----NNRKSV 190

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVVA 262
              HK+N++   DGLFR    ++     ++Y +++    IVD+   +   +P  FDV+V 
Sbjct: 191 CAVHKANIMKLGDGLFRNTVNEI---GANEYPELDVKNIIVDNASMQAVAKPHQFDVLVT 247

Query: 263 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRST 321
           PNLYG IL +  +AL+G  G+VP AN G E  + EP       DI G+ ++NP A I S+
Sbjct: 248 PNLYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSS 307

Query: 322 ALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
            LML  LG N  A  I +A    + E K  T D+GG ++T E T  V+ +L
Sbjct: 308 TLMLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKL 358

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  177 bits (450), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 130/390 (33%), Positives = 202/390 (51%), Gaps = 40/390 (10%)

Query: 1   MLRTTASRLATCRGYAT------------NAIRKNLTIGLIPGDGIGKEVIPAGKQVLQN 48
           MLR T  R +  R   T            N +    T+  I GDG+G E+  + K +   
Sbjct: 1   MLRNTIYRGSFARMMTTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFAA 60

Query: 49  LNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSS 108
             +K  + ++  D+   F   L T   +PD  +Q + N+   AL G + +P  K  G+ S
Sbjct: 61  --AKVPIEWEPCDVGPIFVNGLTT---IPDAAVQSI-NKHLVALKGPLATPIGK--GHRS 112

Query: 109 PIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIVRENTRRFINIKLERTYIDRATGTR 166
             + LRK   L+ANVRP +SV    TT + VD+V++RENT        E + I+      
Sbjct: 113 LNLTLRKTFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEG------EYSGIEHVISPG 166

Query: 167 VAEATKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY 226
           V ++ K I++ A+ R+    +  A +  +  G+  L V HKS +   +DGLF  + K++ 
Sbjct: 167 VIQSIKLITKDASERV----IRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKEL- 221

Query: 227 ESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VVVAPNLYGDILSDGAAAL-VGSLGV 283
                +Y  I    +++D+ +  +   P+ +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 222 ---ASEYPDIELQTELIDNTILNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGL 278

Query: 284 VPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEA 343
            PSAN+G ++ I E  HGSAPDIAG+  +NP A + S+ +ML  +G NE A  I  A+ +
Sbjct: 279 TPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILS 338

Query: 344 NLKE-NKVKTPDLGGKSTTQEVTEDVLARL 372
            +   ++ +T DL G +TT   TE V+ +L
Sbjct: 339 TIASGSENRTGDLAGTATTSSFTEAVINKL 368

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  177 bits (449), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 194/354 (54%), Gaps = 28/354 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+  I GDG+G E+  + K +    +    + +++ D+       L T   +P+  +  +
Sbjct: 36  TVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTPLLVNGLTT---IPEPAVASI 90

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+EG  TT   VD+V++
Sbjct: 91  -NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLI 147

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + I+      V ++ K I+  A+ R+   A + A    +T G+  +
Sbjct: 148 RENTEG------EYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYA----RTVGRPKV 197

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVVA 262
            V HKS +   +DGLF  + +++      +Y  I    +++D+ V  +  +P+ +  VVA
Sbjct: 198 VVVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVTKPEAYKDVVA 253

Query: 263 --PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319
             PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP A + 
Sbjct: 254 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPDIAGQNRANPTALLL 313

Query: 320 STALMLEFLGHNEAAQDIHRAVEANLKENKV-KTPDLGGKSTTQEVTEDVLARL 372
           S+ +ML  +G +E A  I +AV + +  ++  +T DL G ++T   T  V+ RL
Sbjct: 314 SSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  177 bits (448), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 184/354 (51%), Gaps = 32/354 (9%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLN---SKHGLNFDFIDLQAGFQTFLDTGKALPDETI 81
           T+ LIPGDG+GKEV  +   + +  N       +N   +D + G Q           + +
Sbjct: 31  TVTLIPGDGVGKEVTDSVVSIFEAENVPIDWETINITGVDSEEGVQ-----------KAV 79

Query: 82  QVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDK--PVDM 139
           + LK    G L G   +P  +  G+ S  VA RK++ ++ANV   K+V G   K   +D+
Sbjct: 80  ESLKRNKIG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKNVPGVKTKLSNIDL 137

Query: 140 VIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGK 199
           V++RENT        E + ++  +   V E+ K I++  + RIA  A D AL+    N +
Sbjct: 138 VVIRENTEG------EYSGLEHESVPGVVESLKIITKAKSERIARFAFDFALK----NNR 187

Query: 200 ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDV 259
            ++   HK+N++   DGLFR    +V  S   +Y +I+    IVD+   +   +P  FDV
Sbjct: 188 KSVCAVHKANIMKLGDGLFRNTVNEVGAS---EYPEIDVKNIIVDNASMQAVAKPHQFDV 244

Query: 260 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATI 318
           +V PNLYG IL +  AAL+G  G+VP AN G E  + EP       DI GK ++NP A I
Sbjct: 245 LVTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAMI 304

Query: 319 RSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
            S+ LML  LG N  A  I +A    + E K  T D+GG S+T E T+ V+ +L
Sbjct: 305 LSSTLMLRHLGLNGYADRISKATYDVIAEGKHTTKDIGGSSSTTEFTKSVIDKL 358

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 186/354 (52%), Gaps = 32/354 (9%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLN---SKHGLNFDFIDLQAGFQTFLDTGKALPDETI 81
           T+ LIPGDG+GKEV  +   + ++ N       +    +D Q G Q           + +
Sbjct: 31  TVTLIPGDGVGKEVTDSVVSIFESENIPIDWETVEISGLDNQEGVQ-----------KAV 79

Query: 82  QVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDKP--VDM 139
           + LK    G L G   +P+ +  G+ S  VALRK++ ++ANV   KSV G   +   VDM
Sbjct: 80  ESLKRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVDM 137

Query: 140 VIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGK 199
           V++RENT        E + ++  +   V E+ K +++  + RI   A D A++    N +
Sbjct: 138 VVIRENTEG------EYSGLEHESVPGVVESLKIMTKAKSERIGRFAFDFAVK----NNR 187

Query: 200 ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDV 259
            ++   HK+N++   DGLFR    +V      +Y +I+    IVD+   +   +P  FDV
Sbjct: 188 KSVCAVHKANIMKLGDGLFRNCINEV---GAKEYPEIDVKNIIVDNASMQAVAKPHQFDV 244

Query: 260 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATI 318
           +V PNLYG IL +  AAL+G  G+VP AN G E  + EP       DI G+ ++NP A I
Sbjct: 245 LVTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMI 304

Query: 319 RSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
            S++LML  LG N  A  I +A    + E K  T D+GG ++T E TE ++++L
Sbjct: 305 LSSSLMLRHLGLNAYADRISKATYDVIAEAKTTTQDIGGSASTTEFTEAIISKL 358

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 125/354 (35%), Positives = 191/354 (53%), Gaps = 28/354 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+  I GDG+G E+  + K +     ++  + ++  D+   F   L T   +P   +  +
Sbjct: 38  TVSFIEGDGVGPEISKSVKDIFAA--AEVPVEWESCDVTPLFINGLTT---IPQPAVDSI 92

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSVEG  TT + VD+V++
Sbjct: 93  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + I+      V ++ K I+  A+ R+   A + A    +  G+  +
Sbjct: 150 RENTEG------EYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKV 199

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCF--DVV 260
            V HKS +   +DGLF ++ K++      +Y  I    Q++D+ V  +   P  +   V 
Sbjct: 200 MVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVS 255

Query: 261 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319
           V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP A + 
Sbjct: 256 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLL 315

Query: 320 STALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372
           S+ +ML  +G  E A  I +AV + +    + +T DL G ++T   TE V+ RL
Sbjct: 316 SSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  176 bits (446), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 189/354 (53%), Gaps = 28/354 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+  I GDG+G E+  A K +     +K  + ++  D+   F   L T      ++I   
Sbjct: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWESCDVSPLFINGLTTIPQPAQDSI--- 91

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV+G  T    VD+V++
Sbjct: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLI 148

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + I+      V ++ K I++ A+ R+   A + A    +   +  +
Sbjct: 149 RENTEG------EYSGIEHVVSPGVVQSIKLITQDASERVIRYAFEYA----RAVERPKV 198

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VV 260
            V HKS +   +DGLF  + + + +    +Y  I    +++D+ V    R+P  +   VV
Sbjct: 199 VVVHKSTIQRLADGLFVSVAEQLSK----EYPDIELQTELIDNTVLHTVRDPTKYSDVVV 254

Query: 261 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319
           V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP A + 
Sbjct: 255 VCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 320 STALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372
           S+ +ML  +G  E A  I +AV   +    + +T DLGG ++T    E V++RL
Sbjct: 315 SSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  176 bits (445), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 125/377 (33%), Positives = 198/377 (52%), Gaps = 30/377 (7%)

Query: 3   RTTASRLATCRGYATNAIRKN----LTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFD 58
           RT A R       A  A+ K      T+ LIPGDG+GKE+  + K + +    K  ++++
Sbjct: 4   RTIAKRTLATAAQAERALPKKYGGRFTVTLIPGDGVGKEITDSVKTIFEA--EKIPVDWE 61

Query: 59  FIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 118
            ++++   QT    G     E ++ LK    G L G   +P  +  G+ S  VALRK++ 
Sbjct: 62  TVNIK---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLD 113

Query: 119 LYANVRPVKSVEGTTDK--PVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISE 176
           +YANV   KS++G   +   +D++++RENT        E + ++  +   V E+ K ++ 
Sbjct: 114 IYANVALFKSLKGVKTRIPDIDLIVIRENTEG------EFSGLEHESVPGVVESLKIMTR 167

Query: 177 IATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQI 236
             T RIA  A D A    K   +  +T  HK+N++   DGLFR I  ++    + +Y  I
Sbjct: 168 PKTERIARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNIITEI---GQKEYPDI 220

Query: 237 NYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIG 296
           + +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +  + 
Sbjct: 221 DVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVF 280

Query: 297 EP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDL 355
           EP       DI G+ ++NP A I S+ LML  LG NE A  I +AV   + E K  T D+
Sbjct: 281 EPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIAEGKHTTKDI 340

Query: 356 GGKSTTQEVTEDVLARL 372
           GG S+T + T +++ +L
Sbjct: 341 GGSSSTTDFTNEIINKL 357

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  175 bits (443), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 120/352 (34%), Positives = 191/352 (54%), Gaps = 27/352 (7%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQV 83
           +T+ L+PGDG+GKE+  +   + Q  N    ++++ +D+       LD    + +  ++ 
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQAENVP--IDWETVDISQ-----LDHEDGV-NAAVES 80

Query: 84  LKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDK--PVDMVI 141
           LK    G L G   +   +V G+ S  VA RK++ +YANV   KS+ G   K   VD+VI
Sbjct: 81  LKRNKIG-LKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLVI 138

Query: 142 VRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKAT 201
           +RENT        E + ++  +   V E+ K ++++ + RIA  A D A++    + +  
Sbjct: 139 IRENTEG------EYSGLEHESVPGVVESLKIVTKVNSERIAKFAFDFAMR----HDRKM 188

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVV 261
           +T  HK+N++  SDGLFR     V E+    Y QI  +  IVD+   +   +P  FDV+V
Sbjct: 189 VTAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDVMV 244

Query: 262 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRS 320
            P++YG IL +  AAL+G  G+VP  N G E  + EP       DI G+ ++NP A I S
Sbjct: 245 TPSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILS 304

Query: 321 TALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
           + L+L+ LG N+ A  I +AV   +KE    T D+GG ++T E T+ V+ +L
Sbjct: 305 STLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  174 bits (441), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 124/377 (32%), Positives = 198/377 (52%), Gaps = 30/377 (7%)

Query: 3   RTTASRLATCRGYATNAIRKN----LTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFD 58
           RT A R       A   + K      T+ LIPGDG+GKE+  + + + +  N    ++++
Sbjct: 4   RTIAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIP--IDWE 61

Query: 59  FIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 118
            I+++   QT    G     E ++ LK    G L G   +P  +  G+ S  VALRK++ 
Sbjct: 62  TINIK---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLD 113

Query: 119 LYANVRPVKSVEGTTDK--PVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISE 176
           +YANV   KS++G   +   +D++++RENT        E + ++  +   V E+ K ++ 
Sbjct: 114 IYANVALFKSLKGVKTRIPDIDLIVIRENTEG------EFSGLEHESVPGVVESLKVMTR 167

Query: 177 IATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQI 236
             T RIA  A D A    K   + ++T  HK+N++   DGLFR I  ++    + +Y  I
Sbjct: 168 PKTERIARFAFDFA----KKYNRKSVTAVHKANIMKLGDGLFRNIITEI---GQKEYPDI 220

Query: 237 NYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIG 296
           + +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +  + 
Sbjct: 221 DVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVF 280

Query: 297 EP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDL 355
           EP       DI G+ ++NP A I S+ LML  LG NE A  I +AV   + E K  T D+
Sbjct: 281 EPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTRDI 340

Query: 356 GGKSTTQEVTEDVLARL 372
           GG S+T + T +++ +L
Sbjct: 341 GGSSSTTDFTNEIINKL 357

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  174 bits (441), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 123/354 (34%), Positives = 189/354 (53%), Gaps = 28/354 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+  I GDG+G E+  A K +     +K  + ++  D+   F   L T      ++I   
Sbjct: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWETCDVTPLFINGLTTIPQPAQDSI--- 91

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS++G  T    VD+V++
Sbjct: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLI 148

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + I+      V ++ K I++ A+ R+   A + A    +   +  +
Sbjct: 149 RENTEG------EYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYA----RAVERPKV 198

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VV 260
            V HKS +   +DGLF  + + + +    +Y  I    +++D+ V    R+P  +   VV
Sbjct: 199 LVVHKSTIQRLADGLFVSVAEKLAK----EYPDIELQTELIDNTVLHTVRDPLKYSDVVV 254

Query: 261 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319
           V PNLYGDILSD  + L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  +NP A + 
Sbjct: 255 VCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 320 STALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372
           S+ +ML  +G  E A  I +AV + +    + +T DL G ++T    E V++RL
Sbjct: 315 SSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  174 bits (440), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 190/352 (53%), Gaps = 26/352 (7%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQV 83
            T+ L+PGDG+GKE+  +   + ++ N    ++++ +D+       LD  + +      +
Sbjct: 28  FTVTLLPGDGVGKEITDSVVSIFKSENVP--IDWETVDISG-----LDHTEGVKAAVDSL 80

Query: 84  LKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDK--PVDMVI 141
            +N+    L G   +P  +V G+ S  VA RK++ +YANV   KS+EG   K   VD+V+
Sbjct: 81  KRNKI--GLKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVV 137

Query: 142 VRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKAT 201
           +RENT        E + ++  +   V E+ K I++  + RIA  A D A    K N + +
Sbjct: 138 IRENTEG------EYSGLEHESVPGVVESLKIITKSKSERIARFAFDFA----KRNNRKS 187

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVV 261
           +T  HK+N++  SDGLFR     + E   ++Y +I  +  IVD+   +   +P  FDV+V
Sbjct: 188 VTAVHKANIMKLSDGLFRNTVSKIGE---EEYPEIQTSSIIVDNASMQAVAKPHQFDVMV 244

Query: 262 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRS 320
            P++YG I+ +  AAL+G  G+VP  N G +  + EP       DI G+ ++NP A + S
Sbjct: 245 TPSMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLS 304

Query: 321 TALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
             L+L+ LG  ++A  I  AV   + E K  T D+GG ++T E T+ V+ +L
Sbjct: 305 ATLLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  172 bits (437), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 127/377 (33%), Positives = 201/377 (53%), Gaps = 30/377 (7%)

Query: 3   RTTASRLATCRGYATNAIRKN----LTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFD 58
           RT A R       A   + K      T+ LIPGDG+GKE+  + + + +    +  ++++
Sbjct: 4   RTIAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEA--ERIPVDWE 61

Query: 59  FIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 118
            I+++   QT    G     E ++ LK    G L G   +P  +  G+ S  VALRK++ 
Sbjct: 62  TINIK---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLD 113

Query: 119 LYANVRPVKSVEGTTDK--PVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISE 176
           +YANV   KS++G   +   +D++++RENT        E + ++  +   V E+ K +++
Sbjct: 114 IYANVALFKSLKGVKTRIPDIDLIVIRENTEG------EFSGLEHESVPGVVESLKVMTK 167

Query: 177 IATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQI 236
             T RIA  A D A    K N KA +T  HK+N++   DGLFR I  ++ ++   +Y  I
Sbjct: 168 PKTERIARFAFDFAK---KYNRKA-VTAVHKANIMKLGDGLFRNIITEIGQT---EYPDI 220

Query: 237 NYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIG 296
           + +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +  + 
Sbjct: 221 DVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVF 280

Query: 297 EP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDL 355
           EP       DI G+ ++NP A I S+ LML  LG NE A  I +AV   + E K  T D+
Sbjct: 281 EPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEGKHTTRDI 340

Query: 356 GGKSTTQEVTEDVLARL 372
           GG S+T + T +V+ +L
Sbjct: 341 GGSSSTTDFTNEVINKL 357

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  172 bits (437), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 122/352 (34%), Positives = 180/352 (51%), Gaps = 25/352 (7%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQV 83
             + LIPGDG+GKEV  +   + +  N    +++D +D+       LD  + +      +
Sbjct: 29  FVVTLIPGDGVGKEVTDSVVSIFEAENLP--IDWDRVDISG-----LDHEEGVQAAVDSL 81

Query: 84  LKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDK--PVDMVI 141
            +N+    L G   +      G  S  VALRKE+ +YANV   KSV G   K   VD+V+
Sbjct: 82  KRNKI--GLKGIWHTSAADQAGKGSLNVALRKELDIYANVALFKSVPGVKTKIPNVDLVV 139

Query: 142 VRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKAT 201
           +RENT        E + ++  +   V E+ K ++E  T RIA  A D A    K   +  
Sbjct: 140 IRENTEG------EYSGLEHESVPGVVESLKIMTEDKTERIARFAFDFA----KKYNRHA 189

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVV 261
           +T  HK+N++   DGLFR +   V E    +Y  +     IVD+   +   +P  FDV+V
Sbjct: 190 VTAVHKANIMKLGDGLFRNVVTRVGEQ---EYPDVKVGSIIVDNASMQTVAKPHQFDVLV 246

Query: 262 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRS 320
            P++YG IL +  AAL+G  G+V  AN G E  + EP       DI  K I+NP A I S
Sbjct: 247 TPSMYGTILGNIGAALIGGPGLVAGANYGREYAVFEPGSRHVGLDIKDKNIANPTAMILS 306

Query: 321 TALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
            +LML+ LG + +A  I  AV   + E K  TPD+GG ++T E T+ V+ +L
Sbjct: 307 ASLMLDHLGLSTSATKISNAVHQVIAEGKSTTPDIGGSASTTEFTQAVIEKL 358

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  172 bits (437), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 117/355 (32%), Positives = 194/355 (54%), Gaps = 28/355 (7%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQV 83
            T+  I GDG+G E+  + K++     S   +  +++    G   F++    +P+  +++
Sbjct: 36  FTVPFIEGDGVGPEISESVKKIF----SAAKVPIEWVPCDVG-PIFVNGQTTIPEPAVEL 90

Query: 84  LKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVI 141
           + N+   AL G + +P  K  G+ S  + LRK   L+ANVRP +S+    +T + VD+V+
Sbjct: 91  I-NKHLIALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSIPNYKSTYENVDLVL 147

Query: 142 VRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKAT 201
           +RENT        E + I+      V ++ K I+  AT R+    +  A +  +  G+  
Sbjct: 148 IRENTEG------EYSGIEHVITPGVIQSIKLITREATERV----VRYAFEYTQAIGRPR 197

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--V 259
           L V HKS +   +DGLF ++ +++      +Y  I    +I+D  +  +  +P+ +   V
Sbjct: 198 LLVIHKSTIQRMADGLFVKVAEEL----ASEYPDIKLETEIIDKSILNVVSKPELYSDAV 253

Query: 260 VVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATI 318
            V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP A +
Sbjct: 254 SVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALL 313

Query: 319 RSTALMLEFLGHNEAAQDIHRAVEANLKE-NKVKTPDLGGKSTTQEVTEDVLARL 372
            S+ +ML+ +G +E A  I  AV   +   ++ +T DL G ++T   TE+V+ RL
Sbjct: 314 LSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  172 bits (435), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 119/351 (33%), Positives = 186/351 (52%), Gaps = 25/351 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+ LIPGDG+GKEV  +   + +  N    ++++ ++L    +      KA     ++ L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVNIFEAENVP--IDWESVELSGLEENMEGVQKA-----VESL 83

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142
           K    G L G   +P  +  G+ S  VA RK++ ++ANV   KS  G  T  K VD+VI+
Sbjct: 84  KRNKVG-LKGIWSTPADQT-GHGSLNVAFRKQLDIFANVALFKSFPGVKTKLKDVDLVII 141

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + ++  +   V E+ K +++  + RIA  A D AL+    N + ++
Sbjct: 142 RENTEG------EYSGLEHESVPGVVESLKIMTKAKSERIARFAFDFALK----NNRRSV 191

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVVA 262
              HK+N++   DGLFR    ++      +Y ++     IVD+   +   +P  FDV+V 
Sbjct: 192 CAVHKANIMKLGDGLFRNTVNEI---GAKEYPELEVKSIIVDNASMQAVAKPHQFDVLVT 248

Query: 263 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRST 321
           PNLYG IL +  AAL+GS G+VP AN G E  + EP       DI G+ ++NP A I S+
Sbjct: 249 PNLYGSILGNVGAALIGSPGLVPGANFGREYAVFEPGSRHVGLDIKGQDVANPTAMILSS 308

Query: 322 ALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
            LML  LG N+ A  I +A    + E K  T D+GG ++T + T+ ++ +L
Sbjct: 309 TLMLRHLGLNDYADRISKATYEVIAEGKHTTKDIGGHASTTQFTKAIVDKL 359

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  171 bits (434), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 122/376 (32%), Positives = 194/376 (51%), Gaps = 36/376 (9%)

Query: 9   LATCRGYATNAIRKNL---------TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDF 59
           L + R + + A R+N+         T+ L+PGDG+G+E+  +   + +  N    ++++ 
Sbjct: 5   LISKRAFTSIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENLP--IDWER 62

Query: 60  IDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGL 119
           ++L    Q  + T        ++ LK    G     +   +   +G++S  VALRKE+ +
Sbjct: 63  VELSGLEQEDVHTA-------VESLKRNKIG--LKGIWHTSADHDGHTSWNVALRKELDI 113

Query: 120 YANVRPVKSVEGTTDK--PVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEI 177
           YANV   KS +G   +   VD+VI+RENT        E + ++  +   V E+ K ++  
Sbjct: 114 YANVAIFKSFKGVDTRIPDVDLVIIRENTEG------EYSGLEHESVPGVVESLKIMTAQ 167

Query: 178 ATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIN 237
            T RIA  A D A++      + ++T  HK+N++   DGLFR +   V E    +Y ++ 
Sbjct: 168 KTERIARFAFDYAMKY----NRKSVTAVHKANIMKLGDGLFRNL---VTEIGAKEYPEVG 220

Query: 238 YNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGE 297
            +  IVD+   +   +P  FDV+VAP++YG IL +  AAL+G  G+VP AN G +  + E
Sbjct: 221 VSSIIVDNASMQAVAKPHQFDVMVAPSMYGTILGNIGAALIGGPGLVPGANYGRDYAVFE 280

Query: 298 P-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLG 356
           P       DI  + I+NP A I S  LML  LG    A  I +AV   + E K  T D+G
Sbjct: 281 PGSRHVGLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIG 340

Query: 357 GKSTTQEVTEDVLARL 372
           G +TT E T  V+A+L
Sbjct: 341 GSATTTEFTNAVIAKL 356

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  171 bits (433), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 121/351 (34%), Positives = 186/351 (52%), Gaps = 25/351 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+ LIPGDG+GKEV  +   + +  N    +++D +D+ +G     D   A     ++ L
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSIFKAENVP--VDWDRVDI-SGVDRAEDVKSA-----VESL 81

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDK--PVDMVIV 142
           K    G L G   +      G+ S  VALRKE+ +YANV   KS+ G   K   VD+V++
Sbjct: 82  KRNRIG-LKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSIPGVQVKIPDVDLVVI 140

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + ++  +   V E+ K +++    RIA  A D A    K N +  +
Sbjct: 141 RENTEG------EFSGLEHESVPGVVESLKIMTQDNIERIARFAFDYA----KKNDRKQV 190

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVVA 262
              HK+N++   DGLF+ + ++V E    +Y ++     IVD+   +    P  FDV+V 
Sbjct: 191 VAVHKANIMKMGDGLFKNLVQEVGEK---EYPELQVGNIIVDNASMQTVANPHQFDVLVT 247

Query: 263 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRST 321
           P++YG IL +  AAL+G  G+V  AN G ++ + EP       DI G+ ++NP A I S+
Sbjct: 248 PSMYGTILGNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKGQNVANPTAMILSS 307

Query: 322 ALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
            L+L  LG N +A  I +AV A + E K  T D+GG ++T E TE V+ +L
Sbjct: 308 VLLLNHLGLNTSADRISKAVHAVIAEGKSVTRDIGGTASTTEFTEAVINKL 358

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  171 bits (433), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 118/351 (33%), Positives = 185/351 (52%), Gaps = 26/351 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+ LIPGDG+GKEV  +   + ++ N         ID +    + LD  + +      + 
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSIFESENVP-------IDWETVEISGLDNEEGVQKAVDSLK 82

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDKP--VDMVIV 142
           +N+    L G   +P+ +  G+ S  VALRK++ ++ANV   K+V G   +   VD+V++
Sbjct: 83  RNKV--GLKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDLVVI 139

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + ++  +   V E+ K +++  + RI   A D AL+    N + ++
Sbjct: 140 RENTEG------EYSGLEHESVPGVVESLKIMTKAKSDRIGRFAFDFALK----NNRKSV 189

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVVA 262
              HK+N++   DGLFR  C  + E    +Y +I     IVD+   +   +P  FDV+V 
Sbjct: 190 CAVHKANIMKLGDGLFRN-C--INEIGAKEYPEIEVKNIIVDNASMQAVAKPHQFDVLVT 246

Query: 263 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRST 321
           PNLYG IL +  AAL+G  G+VP AN G E  + EP       DI G+ ++NP A I S+
Sbjct: 247 PNLYGSILGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILSS 306

Query: 322 ALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
           ALML  LG N  A  I +A    + E K  T D+GG ++T + T+ ++ +L
Sbjct: 307 ALMLRHLGLNSYADRISKATYDVIAEAKNTTKDIGGSASTTDFTQAIIEKL 357

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  171 bits (432), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 186/354 (52%), Gaps = 28/354 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+  I GDG+G E+  + K +    N    + +   D+   F   L T   +P+  ++ +
Sbjct: 45  TVPFIEGDGVGPEISKSVKDIFSAANVP--IQWQPCDVGPIFVNGLTT---IPEPAVKAI 99

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142
           K     AL G + +P  K  G+ S  + LRK   L+ANVRP KSV    +T + VD+V++
Sbjct: 100 KESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFANVRPAKSVPNYKSTYENVDLVLI 156

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + I+      V ++ K I+  A+ ++   A + A+      G+  L
Sbjct: 157 RENTEG------EYSGIEHIVTPGVVQSIKLITREASEKVIRYAYEYAIAV----GRPRL 206

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VV 260
            V HKS +    DGLF +I  ++    + +Y  I    QI+D+ V  +   P  +   V 
Sbjct: 207 IVVHKSTIQRLGDGLFVQIANEL----QSEYPSIKLETQILDNTVLNVVSNPTLYKDAVS 262

Query: 261 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319
           V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP A + 
Sbjct: 263 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLL 322

Query: 320 STALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372
           S+ +ML  +G  E A  I  AV + +    + +T DLGG +TT   TE V+ +L
Sbjct: 323 SSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  168 bits (425), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 125/354 (35%), Positives = 180/354 (50%), Gaps = 28/354 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+  I GDG+G E+  + K +              +         L  G     E  Q  
Sbjct: 40  TVSFIEGDGVGPEISKSVKDIFA------AAKVPIVWESCPVTPLLVNGVTTIPEQAQES 93

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSVEG  TT + VD+V++
Sbjct: 94  INRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLI 151

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E   I+      V ++ K I+  A+ R+   A + A    +  G+  L
Sbjct: 152 RENTEG------EYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYA----RAVGRPKL 201

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCF-DVV- 260
            V HKS +   +DGLF  + K++     D    I    +++D+ V  +   P  + DVV 
Sbjct: 202 VVVHKSTIQRLADGLFVTVAKELAHEFPD----IQLQTELIDNTVLNVVSNPSKYSDVVY 257

Query: 261 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319
           V PNLYGDILSD  + L  GSLG+ PS N+G ++ I E  HGSAPDIAG+  +NP A + 
Sbjct: 258 VCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPTALLL 317

Query: 320 STALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372
           S+ +ML  +G  E A  I +AV   +    + +T DL G ++T   TE V++RL
Sbjct: 318 SSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  167 bits (424), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 121/356 (33%), Positives = 191/356 (53%), Gaps = 28/356 (7%)

Query: 23  NLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQ 82
           N  +  I GDGIG E+  + K +     +K  ++F+ + ++      ++   ++P+E  +
Sbjct: 35  NYKVSFIEGDGIGPEISKSVKDIFAA--AKVPVDFESVVVKP---ILVNGVTSIPEEAQK 89

Query: 83  VLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMV 140
            + N    AL G + +P  K  G+ S  + LRK  GL+AN+RP KSVEG  T    V++V
Sbjct: 90  SI-NTNLVALKGPLATPVGK--GHRSMNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLV 146

Query: 141 IVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKA 200
           ++RENT        E   I+ A    V ++ K I+  A+ R+   A + A    +   + 
Sbjct: 147 LIRENTEG------EYAGIEHAIVPGVVQSIKLITREASERVIRFAYEYA----RAAERP 196

Query: 201 TLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD-- 258
            L V HKS +   SDGLF ++ K++    + ++  I    +++D+ V     +P  +   
Sbjct: 197 RLIVVHKSTIQRLSDGLFVDVAKEL----QSEFPDIKLETELIDNAVLNTVTDPTKYSDA 252

Query: 259 VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIAT 317
           V V PNLYGDILSD  + L  GSLG+ PS N+G ++ I E  HGSAPDIAGK  +NP A 
Sbjct: 253 VSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTAL 312

Query: 318 IRSTALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372
           + S+ +ML  +G +E A  I +AV   +    + +T DL G ++T   TE V+ +L
Sbjct: 313 LLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  167 bits (424), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 116/356 (32%), Positives = 189/356 (53%), Gaps = 29/356 (8%)

Query: 23  NLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQ 82
           N T+  I GDG+G E+  + + + +       +  D+++   G    ++    +P   + 
Sbjct: 44  NYTVPFIEGDGVGPEISKSVRTIFK----AAKVPIDWVNCDIG-PLLINGETTIPQTAVD 98

Query: 83  VLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVE--GTTDKPVDMV 140
            + N    AL G + +P    +G+ S  + LRK  GL+ANVRP KS+    +T + VD++
Sbjct: 99  QINNSLI-ALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKSIPNLASTYENVDLI 155

Query: 141 IVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKA 200
           ++RENT        E + I+      V ++ K I+  A+ ++    +  A +  ++ G++
Sbjct: 156 VIRENTEG------EYSGIEHEIVPGVVQSIKLITRKASEKV----IKYAFEYTRSIGRS 205

Query: 201 TLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCF--D 258
            L V HK+ +  + DGLF +  +++     DKY  +N   +++D+ V      P+ +   
Sbjct: 206 NLIVVHKATIQRRGDGLFVQTAQEM----ADKYPDVNLKLELIDNTVLNCIMNPEKYADS 261

Query: 259 VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIAT 317
           V V PNLYGDILSD  + L  GSLG+ PSAN+G E V+ E  HGSAPDIAG+  +NP A 
Sbjct: 262 VSVCPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKANPTAL 320

Query: 318 IRSTALMLEFLGHNEAAQDIHRAVEANLKENK-VKTPDLGGKSTTQEVTEDVLARL 372
           + S+ +ML  +G  + A  I  AV   +   K  +T DLGG +TT   T+ V+  L
Sbjct: 321 LLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  164 bits (416), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 187/352 (53%), Gaps = 28/352 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKH-GLNFDFIDLQAGFQTFLDTGKALPDETIQV 83
           T+ LIPGDG+GKEV  +   V+   N+++  ++++ +D+       LD  + + +  +  
Sbjct: 35  TVTLIPGDGVGKEVTDS---VVSIFNAENLPIDWERVDISG-----LDHEEGV-EAAVNS 85

Query: 84  LKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDK--PVDMVI 141
           LK    G     +   +     + S  VALRK++ +YANV   K++ G   +   VD+VI
Sbjct: 86  LKRNKIG--LKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLVI 143

Query: 142 VRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKAT 201
           +RENT        E + ++  +   V E+ K I++  + RIA  A D A    K   +  
Sbjct: 144 IRENTEG------EYSGLEHESVPGVVESLKIITKEKSERIARFAFDFA----KRFDRKL 193

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVV 261
           +T  HK+N++   DGLFR     + E+   +Y  I  +  IVD+   +   +P  FDV+V
Sbjct: 194 VTAVHKANIMKLGDGLFRNSVTSIGET---EYPDIKVSSIIVDNASMQSVAKPHQFDVLV 250

Query: 262 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRS 320
            P++YG IL +  AAL+G  G+VP AN G E  + EP       DI G+ ++NP A I S
Sbjct: 251 TPSMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILS 310

Query: 321 TALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
           + L+L+ LG N  A+ I  AV   + E KV T D+GG ++T E T +++ +L
Sbjct: 311 STLLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  162 bits (410), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 122/382 (31%), Positives = 190/382 (49%), Gaps = 36/382 (9%)

Query: 1   MLRTTASRLATCRGYAT-------NAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKH 53
           MLR    RL + R  AT       N      T+ L+PGDG+GKE   +   V    N   
Sbjct: 1   MLR----RLVSKRSLATLPETLFPNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIP- 55

Query: 54  GLNFDFIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVAL 113
            ++++ +++       LD  + +      + +N+    L G   +      G+ S  VA 
Sbjct: 56  -IDWEIVNISG-----LDHKEGVAAAVQSLRRNKI--GLKGLWHTSNADQSGHGSLNVAF 107

Query: 114 RKEMGLYANVRPVKSVEG--TTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEAT 171
           RK++ +YANV   KS++G  T    VD+V++RENT        E + ++  +   V E+ 
Sbjct: 108 RKQLDIYANVAVFKSLKGVKTMIPDVDLVVIRENTEG------EFSGLEHESVEGVVESL 161

Query: 172 KRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKD 231
           K  +   T RIA  A + A    + NG+  +   HK+N++   DGLFR     + E    
Sbjct: 162 KVTTLPKTERIARFAFNYA----QKNGRKAVCAVHKANIMKLGDGLFRNTVTSIGEK--- 214

Query: 232 KYGQINYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 291
           +Y  I  +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  AN G 
Sbjct: 215 EYPDIETSSIIVDNASMQAVAKPHQFDVLVTPSMYGTIIGNIGAALIGGPGLVAGANFGR 274

Query: 292 EIVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKV 350
           E  + EP       DI G+ I+NP A + S+ALML  LG  ++ + I  AV   + E  V
Sbjct: 275 EYAVFEPGSRHVGLDIKGQNIANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEGDV 334

Query: 351 KTPDLGGKSTTQEVTEDVLARL 372
           +T D+GG +TT E T+ V+ +L
Sbjct: 335 RTKDIGGDATTTEFTQAVIEKL 356

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  161 bits (407), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 113/351 (32%), Positives = 183/351 (52%), Gaps = 26/351 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           T+ LIPGDG+GKE+  +   + +  N    ++++ +D+        D  +A     ++ L
Sbjct: 28  TVTLIPGDGVGKEITDSVVSIFEAENIP--VDWERVDISTS-DNIQDVSQA-----VESL 79

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDK--PVDMVIV 142
           K    G     +   +  +  + S  VALRK++ ++A+V   KSV G   K   VD+V++
Sbjct: 80  KRNKIG--LKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTKIPNVDLVVI 137

Query: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202
           RENT        E + ++  +   V E+ K I++  + RIA  A D A    K   + ++
Sbjct: 138 RENTEG------EYSGLEHESVPGVVESLKIITKAKSERIARFAFDFA----KKYNRKSV 187

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVVA 262
              HK+N++   DGLFR     V E   ++Y  I  +  IVD+   +   +P  FDV+V 
Sbjct: 188 CAVHKANIMKMGDGLFRNT---VTEIGANEYPDIQTSSIIVDNASMQAVAKPHQFDVMVT 244

Query: 263 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRST 321
           P++YG I+ +  AAL+G  G+V  A+ G E  + EP       DI GK ++NP A I S+
Sbjct: 245 PSMYGTIIGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILSS 304

Query: 322 ALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
            LML+ LG  E+A+ I +A    +   +V T D+GG ++T E TE ++ RL
Sbjct: 305 TLMLQHLGLTESAKRIAKATHDVISLGQVTTKDIGGSASTTEFTEAIIKRL 355

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  156 bits (395), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 124/381 (32%), Positives = 198/381 (51%), Gaps = 44/381 (11%)

Query: 1   MLRTTASRLATCRGYATNAIRK---NLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNF 57
           MLR T  R    R  +T + +K      I LIPG+GIGKEV  + + + Q  N    +++
Sbjct: 1   MLRNTLLR----RSISTISPKKYGGRFQITLIPGNGIGKEVTDSVRSIFQAENLP--IDW 54

Query: 58  DFIDLQA---GFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALR 114
           + +++++   G +T +D+ K          +N+   AL G   S    ++G  S  VALR
Sbjct: 55  EIVNIESHRDGIKTAVDSIK----------RNKI--ALKGIWSS--DPIDG--SLNVALR 98

Query: 115 KEMGLYANVRPVKSVEGTTDK--PVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATK 172
           K++ ++ANV   KS +    +   VD+V++RENT    +  LE   +D      V E+ K
Sbjct: 99  KQLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFS-GLEHESVDG-----VVESLK 152

Query: 173 RISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDK 232
            +++  T RIA  A D A    K + +  +T  HK+N++   DGLF+ I   +     ++
Sbjct: 153 IVTKPKTERIARFAFDFA----KKHNRNHVTAVHKANIMKLGDGLFKNIVAHI---GNNE 205

Query: 233 YGQINYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE 292
           Y +I  +  IVD+   +   +P  FDV+V+P++YG IL +  AAL+G  G+VP AN G +
Sbjct: 206 YPEIKNSSIIVDNASMQAVAKPHQFDVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRD 265

Query: 293 IVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVK 351
             + EP       DI G+ ++NP A I S   ML  LG    A+ I  AV+  + +    
Sbjct: 266 YAVFEPGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTTV 325

Query: 352 TPDLGGKSTTQEVTEDVLARL 372
           T D+GG ++T E T+ V+  L
Sbjct: 326 TKDIGGTASTTEFTDAVINEL 346

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  152 bits (385), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 117/371 (31%), Positives = 193/371 (52%), Gaps = 37/371 (9%)

Query: 22  KNLTIGLIPGDGIGKEVIPAGKQVLQNLNSK-HGLNFDFIDLQAGFQTFLDTGKALPDET 80
           KN+ +  +PGD +G+E++    +VL+ +  K HG+ F+F     G      TG  LPDET
Sbjct: 5   KNIVV--LPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDET 62

Query: 81  IQVLKNQCQGALFGAVQSP---TTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDKPV 137
           ++  K Q    L GAV  P   T KV      ++ +RKE+GLY N+RP K +   +DK +
Sbjct: 63  LEAAK-QSDAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFI---SDKLI 117

Query: 138 DMVIVRENTRRFINIKLERTYI--------DRATGTRVAEATKRISEIATRRIATIALDI 189
            +  ++E   +  +  + R  +            G+ VA  +++ S    +RI  +A   
Sbjct: 118 GLSPLKEEVCKGTDFVVVRELVGGIYFGERQEDDGSGVAWDSEKYSIEEVKRITKMA--- 174

Query: 190 ALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYR 249
           A   L+ +    +    K+NVL+ S      + +   +    ++  +    Q++DS    
Sbjct: 175 AFLSLQNDPPLPIWSLDKANVLASS-----RLWRAAVDETIAEFPNLKVQHQLIDSAAMM 229

Query: 250 MFREP-QCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGS 302
           + + P Q   +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGS
Sbjct: 230 LVKNPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGS 289

Query: 303 APDIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTT 361
           APD+A +G  NP+ATI S A+ML+  L   +  + I RAV   L +  ++T DLGG STT
Sbjct: 290 APDLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVL-DRGIRTADLGGNSTT 347

Query: 362 QEVTEDVLARL 372
            E+ + V   L
Sbjct: 348 SELGDAVAQEL 358

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  152 bits (383), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 191/363 (52%), Gaps = 38/363 (10%)

Query: 28  LIPGDGIGKEVIPAGKQVLQNLN-SKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVLKN 86
           ++PGD IG+EVI    +VL  +  ++  +NF+F     G      TG  L D+TI+  K 
Sbjct: 9   VLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLSDKTIEAAK- 67

Query: 87  QCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRPV----KSVEGTTD-KP-- 136
                L GAV  P     G   P   ++A+RKE+GLYAN+RP     KS+ G +  KP  
Sbjct: 68  AADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLKPEI 126

Query: 137 ---VDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQR 193
               D VI+RE       I       D   G         +SE+   RI  +   +ALQ 
Sbjct: 127 AQGTDFVILRELVG---GIYFGERKEDDGDGVAWDSEKYTVSEV--ERITRMGAFLALQH 181

Query: 194 LKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFRE 253
              +    L    K+NVL+ S  L+R   + V E+ K ++ Q++   Q++DS    M + 
Sbjct: 182 ---DPPLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDSAAMIMIKN 234

Query: 254 PQCFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE------IVIGEPCHGSAPDI 306
           P+ F+ +V+  N++GDI+SD A+ + GSLG++PSA++  E        + EPCHGSAPD+
Sbjct: 235 PRKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAPDL 294

Query: 307 AGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVT 365
             KG +NPIA I S A+ML+  L   +  + I  AV+  + E+ ++T DLGG +TT EV 
Sbjct: 295 E-KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVK-QVIESGIRTGDLGGNNTTTEVG 352

Query: 366 EDV 368
           + V
Sbjct: 353 DAV 355

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  147 bits (370), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 195/367 (53%), Gaps = 42/367 (11%)

Query: 26  IGLIPGDGIGKEVIPAGKQVL----QNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETI 81
           I ++PGD IG+EV+    +VL    Q+L+  H   FDF     G      TG ALPDE +
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVH---FDFQYHLVGGAAIDATGSALPDEAL 63

Query: 82  QVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRPVKSVEGTTDKPVD 138
              K +    L GAV  P  +  G   P   ++ LR+E+G+YAN+RP        D  ++
Sbjct: 64  GAAK-EADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNF---AADSLLE 118

Query: 139 MVIVRENTRRFINIKLERTYIDRA--------TGTRVAEATKRISEIATRRIATIALDIA 190
           +  +R    R  +I + R  +  +         G  VA  T + +    +RIA +A  +A
Sbjct: 119 LSPLRPEIARDTDIMVVRELLGGSYFGERHEDEGDGVAWDTDKYTVKEVQRIARMAGFLA 178

Query: 191 LQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRM 250
           LQ    +    +    K+NVL+ S  L+R+  ++ ++S   ++  +    Q++DS    +
Sbjct: 179 LQH---DPPLPVWSLDKANVLASSR-LWRKTVEETFQS---EFPNVQLQHQLIDSAAMIL 231

Query: 251 FREPQCFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSA 303
            + P+ F+ VVV  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSA
Sbjct: 232 VKNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSA 291

Query: 304 PDI-AGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTT 361
           PD+ AGK  +NPI  I S A+ML+  L    A + + +AV+  L ++ V+T DL G S+T
Sbjct: 292 PDLPAGK--ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVL-DSGVRTGDLLGSSST 348

Query: 362 QEVTEDV 368
            EV + +
Sbjct: 349 SEVGDAI 355

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  143 bits (361), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 123/365 (33%), Positives = 191/365 (52%), Gaps = 38/365 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLNS-KHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           I ++PGD +G+E+     +VL+ +    + +NFDF     G      TG  LPDE ++  
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEAS 65

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRPV----KSVEGTTD--- 134
           KN     L GAV  P     G   P   ++ +RKE+GLYAN+RP     +S+ G +    
Sbjct: 66  KN-SDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 135 ---KPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIAL 191
              K  D ++VRE       I   +   D   G  VA  +++ S    +RI  +A  +AL
Sbjct: 124 EIAKGTDFMVVRELVG---GIYFGKRKEDEGDG--VAWDSEQYSVPEVQRITRMAAFLAL 178

Query: 192 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMF 251
           Q    N    +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + 
Sbjct: 179 QH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAMILV 231

Query: 252 REP-QCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 304
           + P Q   +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 232 KNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 291

Query: 305 DIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQE 363
           D+  KG  NPIATI S A+ML+  L   +    I  AV+  L +  ++T DLGG ++T E
Sbjct: 292 DLP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVL-DAGIRTGDLGGSNSTTE 349

Query: 364 VTEDV 368
           V + +
Sbjct: 350 VGDAI 354

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  142 bits (359), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 123/371 (33%), Positives = 190/371 (51%), Gaps = 40/371 (10%)

Query: 20  IRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNS-KHGLNFDFIDLQAGFQTFLDTGKALPD 78
           + KN+ +  +PGD +GKEV     +VL  +   +  + F+F     G      TG  LPD
Sbjct: 1   MSKNIVV--LPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPD 58

Query: 79  ETIQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRP---------- 125
           E ++  K +    L GAV  P     G   P   ++ +RKE+GLYAN+RP          
Sbjct: 59  EALEASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLD 116

Query: 126 VKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATI 185
           +  ++    K  D V+VRE       I       D   G  VA  +++ S    +RI  +
Sbjct: 117 LSPLKPEYAKGTDFVVVRELVG---GIYFGERKEDEGDG--VAWDSEKYSVPEVQRITRM 171

Query: 186 ALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDS 245
           A  +ALQ+   N    +    K+NVL+ S  L+R   K V E+ K ++ Q+    Q++DS
Sbjct: 172 AAFLALQQ---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDS 224

Query: 246 MVYRMFREPQCFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEP 298
               + + P   + VV+  N++GDI+SD A+ + GSLG++PSA++   P+      + EP
Sbjct: 225 AAMILVKSPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEP 284

Query: 299 CHGSAPDIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGG 357
           CHGSAPD+    + NPIATI S A+ML+  L   E  + +  AV  N+ +  V+T DLGG
Sbjct: 285 CHGSAPDLPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAVR-NVLDAGVRTGDLGG 342

Query: 358 KSTTQEVTEDV 368
            ++T EV + +
Sbjct: 343 SNSTTEVGDAI 353

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  144 bits (362), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 118/363 (32%), Positives = 191/363 (52%), Gaps = 34/363 (9%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLNS-KHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           I ++PGD +G+E+     +VL  ++S +  +NFDF     G      TG  LPDE ++  
Sbjct: 90  IVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDEALEAS 149

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRPVKSVEGTTDKPVDMVI 141
           K +    L GAV  P     G   P   ++ +RKE+ LYAN+RP       +D  +D+  
Sbjct: 150 K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNF---ASDSLLDLSP 204

Query: 142 VRENTRRFINIKLERTYI--------DRATGTRVAEATKRISEIATRRIATIALDIALQR 193
           ++    +  +I + R  +            G  VA  +++ S    +RI  +A  +ALQ 
Sbjct: 205 LKPEIVKGTDICIVRELVGGIYFGERKEDEGDGVAWDSEKYSVSEVQRITRMAGFLALQH 264

Query: 194 LKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFRE 253
              N    +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + + 
Sbjct: 265 ---NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVKN 317

Query: 254 PQCFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPDI 306
           P   + VV+A N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD+
Sbjct: 318 PTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDL 377

Query: 307 AGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVT 365
             KG  NP+ATI S A+ML+  L   E    + +AV+  L ++ V+T DL G ++T EV 
Sbjct: 378 P-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVL-DSGVRTADLRGSNSTSEVG 435

Query: 366 EDV 368
           + +
Sbjct: 436 DAI 438

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  141 bits (356), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 120/371 (32%), Positives = 194/371 (52%), Gaps = 40/371 (10%)

Query: 20  IRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNS-KHGLNFDFIDLQAGFQTFLDTGKALPD 78
           + KN+ +  +PGD +G+E+     +VL+ ++  +    F+F     G      TG  LPD
Sbjct: 1   MSKNIVV--LPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPD 58

Query: 79  ETIQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRP---------- 125
           E ++  K +    L GAV  P     G   P   ++ +RKE+ LYAN+RP          
Sbjct: 59  EALEASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLE 116

Query: 126 VKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATI 185
           +  ++    +  D V+VRE       I       D   G  VA  +++ S    +RI  +
Sbjct: 117 LSPLKAQYAQGTDFVVVRELVG---GIYFGERKEDEGDG--VAWDSEQYSVPEVQRITRM 171

Query: 186 ALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDS 245
           A  +ALQ    N    +    K+NVL+ S  L+R   K V ++ K+++  ++ N Q++DS
Sbjct: 172 AAFLALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEKTIKEEFPTLSVNHQLIDS 224

Query: 246 MVYRMFREP-QCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEP 298
               + + P Q   +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EP
Sbjct: 225 AAMILVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEP 284

Query: 299 CHGSAPDIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGG 357
           CHGSAPD+A KG  NP+ATI S A+ML+  L   E    I +AV+  L ++ ++T DLGG
Sbjct: 285 CHGSAPDLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVL-DDGIRTGDLGG 342

Query: 358 KSTTQEVTEDV 368
            ++T EV + V
Sbjct: 343 SNSTSEVGDAV 353

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  140 bits (354), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 120/365 (32%), Positives = 188/365 (51%), Gaps = 38/365 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLNS-KHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           I ++PGD +G+E+     +VL+ ++  +  + F+F     G      TG+ LPD +++  
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAA 66

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRP----------VKSVEG 131
           K +    L GAV  P     G   P   ++ +RKE+ LYAN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKA 124

Query: 132 TTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIAL 191
              +  D V+VRE       I       D   G  VA  +++ S    +RI  +A  +AL
Sbjct: 125 EHARGTDFVVVRELVG---GIYFGERKEDEGDG--VAWDSEKYSVPEVQRITRMAAFLAL 179

Query: 192 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMF 251
           Q    N    +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    M 
Sbjct: 180 QH---NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMIMV 232

Query: 252 REP-QCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 304
           + P Q   V++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 292

Query: 305 DIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQE 363
           D+  KG  NPIATI S A+MLE  L   E    +  AV   L ++ ++T DL G ++TQE
Sbjct: 293 DLE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVRRVL-DSGIRTGDLRGSNSTQE 350

Query: 364 VTEDV 368
           V + V
Sbjct: 351 VGDAV 355

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  139 bits (350), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 116/365 (31%), Positives = 188/365 (51%), Gaps = 35/365 (9%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNS--KHGLNFDFIDLQAGFQTFLDTGKALPDETIQ 82
           TI ++PGD +G+E+     +VL  +       +NF F     G      TG  LPDE ++
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 83  VLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRPVKSVEGTTDKPVDM 139
             K +    L GAV  P     G   P   ++ +RKE+ LYAN+RP       +D  +D+
Sbjct: 66  ASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNF---ASDSLLDL 120

Query: 140 VIVRENTRRFINIKLERTYI--------DRATGTRVAEATKRISEIATRRIATIALDIAL 191
             ++    R  +  + R  +            G  VA  +++ S    +RI  +A  +AL
Sbjct: 121 SPLKPEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFMAL 180

Query: 192 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMF 251
           Q    N    +    K+NVL+ S  L+R   K V E+ K+++ Q+    Q++DS    + 
Sbjct: 181 QH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAMILV 233

Query: 252 REPQCFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 304
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 234 KNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAP 293

Query: 305 DIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQE 363
           D+  KG  NP+ATI S A+ML+  L   E  + I +AV+  L ++ ++T DL G ++T E
Sbjct: 294 DLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVL-DSGIRTADLKGTNSTTE 351

Query: 364 VTEDV 368
           V + V
Sbjct: 352 VGDAV 356

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  137 bits (346), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 126/369 (34%), Positives = 190/369 (51%), Gaps = 38/369 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLNS-KHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           I ++PGD +G+E+     +VL+ ++  +    F+F     G      TG+ LPD +++  
Sbjct: 7   IVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEAA 66

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRPVK-SVEGTTD----KP 136
           K +    L GAV  P     G   P   ++ +RKE+ LYAN+RP   + E   D    KP
Sbjct: 67  K-KSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKP 124

Query: 137 -----VDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIAL 191
                 D V+VRE       I       D  TG  VA  +++ S    +RI  +A  +AL
Sbjct: 125 ECARGTDFVVVRELVG---GIYFGERKED--TGDGVAWDSEQYSVPEVQRITRMAAFLAL 179

Query: 192 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMF 251
           Q    +    +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + 
Sbjct: 180 QH---SPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILV 232

Query: 252 REP-QCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 304
           + P Q   V++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAP 292

Query: 305 DIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQE 363
           D+  KG  NPIATI S A+ML+  L   E    +  AV   L ++ V+T DL G STT E
Sbjct: 293 DLP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVL-DSGVRTADLKGTSTTSE 350

Query: 364 VTEDVLARL 372
           V E V+  L
Sbjct: 351 VGEAVVKAL 359

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  137 bits (345), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 189/365 (51%), Gaps = 38/365 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLNS-KHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           I ++PGD +G+E+     +VL+ ++  +  +NFDF +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRP----------VKSVEG 131
           K +    L GAV  P     G   P   ++ +RKE+ LYAN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 132 TTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIAL 191
              K  D V+VRE       I   +   D   G  VA  +++ +    +RI  +A  +AL
Sbjct: 125 QFAKGTDFVVVRELVG---GIYFGKRKEDDGDG--VAWDSEQYTVPEVQRITRMAAFMAL 179

Query: 192 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMF 251
           Q         +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + 
Sbjct: 180 QH---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILV 232

Query: 252 REPQCFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 304
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAP 292

Query: 305 DIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQE 363
           D+  K   NPIATI S A+ML+  L   E  + I  AV+  L +  ++T DLGG ++T E
Sbjct: 293 DLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL-DAGIRTGDLGGSNSTTE 350

Query: 364 VTEDV 368
           V + V
Sbjct: 351 VGDAV 355

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  136 bits (343), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 124/369 (33%), Positives = 186/369 (50%), Gaps = 48/369 (13%)

Query: 22  KNLTIGLIPGDGIGKEVIPAGKQVLQNL-----NSKHGLNFDFIDLQAGFQTFLDTGKAL 76
           KN+T+   PGD IG E++    +VL  +     N     N+  I    G      TG+ L
Sbjct: 5   KNITV--FPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLI----GGAAIDATGEPL 58

Query: 77  PDETIQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRPVKSVEGT- 132
            DE +QV KN     L GAV  P     G   P   ++ +RKE+G+YAN+RP + V  T 
Sbjct: 59  TDEALQVAKNS-DAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETL 116

Query: 133 ---------TDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIA 183
                      +  D VIVRE        + +    D   G    + +  + EI  +RI 
Sbjct: 117 LDLSPLKREIVQGTDFVIVRELVGGIYFGERQEAGDD---GVAWDKESYSVPEI--QRIT 171

Query: 184 TIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIV 243
            +A  +ALQ    N    +    K+NVL+ S  L+R   K V E+ K+++  +  N  ++
Sbjct: 172 RMAAFLALQH---NPPLPVWSLDKANVLATSR-LWR---KTVEETIKNEFPTLTINHHLI 224

Query: 244 DSMVYRMFREPQCFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIG 296
           DS    + + P   + VV+  N++GDI+SD A+ + GSLG++PSA++   P+    + + 
Sbjct: 225 DSAAMTLVQNPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLY 284

Query: 297 EPCHGSAPDIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDL 355
           EPCHGSAPD+     +NPIATI S A+M +  L   +    I  AV+  + +  +KT DL
Sbjct: 285 EPCHGSAPDLPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTI-DAGIKTGDL 342

Query: 356 GGKSTTQEV 364
           GGK+TT EV
Sbjct: 343 GGKNTTTEV 351

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  136 bits (342), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 190/364 (52%), Gaps = 35/364 (9%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNL--NSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQV 83
           I ++PGD +G+E++    +VL+ +  +S  G+ F+F     G  +   TG  LPDE +  
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDA 65

Query: 84  LKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRPVKSVEGTTDKPVDMV 140
            KN     L GAV  P     G   P   ++ +RKE+ LYAN+RP   V   +D  + + 
Sbjct: 66  AKNS-DAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFV---SDSLLGLS 120

Query: 141 IVRENTRRFINIKLERTYI------DRAT--GTRVAEATKRISEIATRRIATIALDIALQ 192
            ++E   +  +  + R  +      DR    G   A   ++ +    +RI  +A  +ALQ
Sbjct: 121 PLKEEIAKGTDFTVVRELVGGIYFGDRKEDDGDGSAWDCEKYTIPEVQRITRMAAFLALQ 180

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFR 252
               +    +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + +
Sbjct: 181 H---DPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAAMILVK 233

Query: 253 EP-QCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 305
            P Q   +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 SPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 306 IAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEV 364
           +  KG  NPIATI S A+ML+  L   +    I +AV+  L +  ++T DL G ++T EV
Sbjct: 294 LP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVL-DAGIRTADLKGSNSTSEV 351

Query: 365 TEDV 368
            + V
Sbjct: 352 GDAV 355

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  135 bits (339), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 188/365 (51%), Gaps = 38/365 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLNS-KHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           I ++PGD +G+E+     +VL+ ++  +  + FDF +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRP----------VKSVEG 131
           K +    L GAV  P     G   P   ++ +RKE+ LYAN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 132 TTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIAL 191
              K  D V+VRE       I   +   D   G  VA  +++ +    +RI  +A  +AL
Sbjct: 125 QFAKGTDFVVVRELVG---GIYFGKRKEDDGDG--VAWDSEQYTVPEVQRITRMAAFMAL 179

Query: 192 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMF 251
           Q         +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + 
Sbjct: 180 QH---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILV 232

Query: 252 REPQCFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 304
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAP 292

Query: 305 DIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQE 363
           D+  K   NPIATI S A+ML+  L   E  + I  AV+  L +  ++T DLGG ++T E
Sbjct: 293 DLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL-DAGIRTGDLGGSNSTTE 350

Query: 364 VTEDV 368
           V + V
Sbjct: 351 VGDAV 355

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  133 bits (334), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/294 (32%), Positives = 158/294 (53%), Gaps = 26/294 (8%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQV 83
            T+ LIPGDG+GKEV  + K + +  N    ++++ I+++   QT    G    +E ++ 
Sbjct: 29  FTVTLIPGDGVGKEVTDSVKTIFEAENIP--IDWETINIK---QTDHKEGV---NEAVES 80

Query: 84  LKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDK--PVDMVI 141
           L+    G L G   +P  +  G+ S  VALRK++ +YANV   KS++G   +   +D+++
Sbjct: 81  LRRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 142 VRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKAT 201
           +RENT        E + ++  +   V E+ K +++  T RIA  A D A    K   +  
Sbjct: 139 IRENTEG------EFSGLEHESVPGVVESLKIMTKPKTERIARFAFDFA----KKYNRKA 188

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVV 261
           +T  HK+N++   DGLFR I   + E  + +Y  I+ +  IVD+   +   +P  FDV+V
Sbjct: 189 VTAVHKANIMKLGDGLFRNI---ITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLV 245

Query: 262 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNP 314
            P++YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ ++NP
Sbjct: 246 TPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANP 299

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  133 bits (334), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 188/366 (51%), Gaps = 40/366 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLNS-KHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           I ++PGD +G+E+     +VL+ ++  +  + FDF +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRP----------VKSVEG 131
           K +    L GAV  P     G   P   ++ +RKE+ LYAN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 132 TTDKPVDMVIVRENTRRFINIKL-ERTYIDRATGTRVAEATKRISEIATRRIATIALDIA 190
              K  D V+VRE       I   ER   D   G  VA   ++ +    +RI  +A  +A
Sbjct: 125 QFAKGTDFVVVRELVG---GIYFGERKEDD---GDGVAWDCEQYTVPEVQRITRMAAFMA 178

Query: 191 LQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRM 250
           LQ         +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    +
Sbjct: 179 LQH---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMIL 231

Query: 251 FREPQCFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSA 303
            + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSA
Sbjct: 232 VKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 291

Query: 304 PDIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQ 362
           PD+  K   NP+ATI S A+ML+  L   E  + I  AV+  L +  ++T DLGG ++T 
Sbjct: 292 PDLP-KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVKRVL-DAGIRTGDLGGSNSTT 349

Query: 363 EVTEDV 368
           EV + V
Sbjct: 350 EVGDAV 355

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  130 bits (328), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 121/371 (32%), Positives = 191/371 (51%), Gaps = 40/371 (10%)

Query: 20  IRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNS-KHGLNFDFIDLQAGFQTFLDTGKALPD 78
           + KN+ +  +PGD  G+E+     +VL+ ++       F+F     G      TG  LPD
Sbjct: 1   MSKNIVV--LPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIGGAAIDATGSPLPD 58

Query: 79  ETIQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRPVK-SVEGTTD 134
           + +   K      L GAV  P     G   P   ++ +RKE+ LYAN+RP   + E   D
Sbjct: 59  DALAAAKKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLD 116

Query: 135 ---------KPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATI 185
                    K  D V+VRE       I       D   G  VA  +++ ++   +R+  +
Sbjct: 117 LSPLKPQHAKGTDFVVVRELVG---GIYFGERKEDEGDG--VAWDSEKYTKPEVQRLTRM 171

Query: 186 ALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDS 245
           A  +ALQ    N    +    K+NVL+ S  L+R   K V E+ K+++ Q+  N Q++DS
Sbjct: 172 AAFLALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDS 224

Query: 246 MVYRMFREP-QCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEP 298
               + + P Q   +V+  NL+GDI+SD A+ + GSLG++PSA++   P+      + EP
Sbjct: 225 AAMILVKSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEP 284

Query: 299 CHGSAPDIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGG 357
           CHGSAPD+  KG  NPIA I S A+ML+  L  ++  + + +AV+  L ++ V+T DLGG
Sbjct: 285 CHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQVL-DSGVRTGDLGG 342

Query: 358 KSTTQEVTEDV 368
            ++T EV + +
Sbjct: 343 SNSTSEVGDAI 353

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  129 bits (325), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 119/365 (32%), Positives = 186/365 (50%), Gaps = 38/365 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLNS-KHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           I ++PGD +G+E+     +VL+ ++  +  + FDF     G      TG  L DE ++  
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLTDEALEAS 66

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRPVKS-----VEGTTDKP 136
           K +    L GAV  P     G   P   ++ +RKE+ LYAN+RP        +E +  KP
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLELSPIKP 124

Query: 137 -----VDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIAL 191
                 D V+VRE       I   +   D   G  VA  +++ +    +RI  +A  +AL
Sbjct: 125 QFARGTDFVVVRELVG---GIYFGKRKEDDGDG--VAWDSEQYTVPEVQRITRMAAFMAL 179

Query: 192 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMF 251
           Q         +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + 
Sbjct: 180 QH---QPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILV 232

Query: 252 REP-QCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 304
           + P Q   +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KNPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAP 292

Query: 305 DIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQE 363
           D+  K   NPIATI S A+ML+  L      Q I  AV+  L +  ++T DLGG ++T E
Sbjct: 293 DLP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVL-DAGIRTGDLGGSNSTIE 350

Query: 364 VTEDV 368
           V + V
Sbjct: 351 VGDAV 355

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  127 bits (319), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 117/367 (31%), Positives = 182/367 (49%), Gaps = 41/367 (11%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLN--SKHGLNFDFIDLQAGFQTFLDTGKALPDETIQV 83
           I ++PGD +G E+     +VL+ +       + FDF     G       G  L DE ++ 
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTDEALEA 66

Query: 84  LKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRP----------VKSVE 130
            K +    L GAV  P     G   P   ++ +RKE+GLYAN+RP          +  + 
Sbjct: 67  SK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPLLGLSPLR 124

Query: 131 GTTDKPVDMVIVRENTRRFINIKL-ERTYIDRATGTRVAEATKRISEIATRRIATIALDI 189
               K  D ++VRE       I   ER   D   G  VA  +++ S     RI  +A  +
Sbjct: 125 PEIAKGTDFMVVRELVG---GIYFGERKEDD---GDGVAWDSEKYSVPEVERITRMAAFL 178

Query: 190 ALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYR 249
           ALQ    N    +    K+NVL+ S  L+R   K V  + K+++  +    Q++DS    
Sbjct: 179 ALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQLIDSAAMI 231

Query: 250 MFREP-QCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGS 302
           + + P Q   +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGS
Sbjct: 232 LVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGS 291

Query: 303 APDIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTT 361
           APD+  K   NP+ATI S A+ML+  L   +  + +  AV   L +  V+T DLGG ++T
Sbjct: 292 APDLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVL-DAGVRTGDLGGSNST 349

Query: 362 QEVTEDV 368
           QEV + +
Sbjct: 350 QEVGDAI 356

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  125 bits (315), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 117/366 (31%), Positives = 184/366 (50%), Gaps = 38/366 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLNS-KHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84
           I ++PGD +G+E+     +VL  ++  +  + FD+     G      TG  LPDE +   
Sbjct: 7   IVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLPDEALDAA 66

Query: 85  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRP----------VKSVEG 131
           K      L GAV  P     G   P   ++ +RKE+ LYAN+RP          +  ++ 
Sbjct: 67  KKADA-VLLGAVGGPKWGT-GQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 124

Query: 132 TTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIAL 191
              K  D V+VRE       I       D   G  VA  +++ S    +RI  +A  +AL
Sbjct: 125 EYAKGTDFVVVRELVG---GIYFGERKEDEGDG--VAWDSEKYSVPEVQRITRMAAFLAL 179

Query: 192 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMF 251
           Q+   N    +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + 
Sbjct: 180 QQ---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILV 232

Query: 252 REPQCFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 304
           + P   + +V+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KSPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAP 292

Query: 305 DIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQE 363
           D+  K   NPIATI S A+ML+  L   E    +  AV   L +  ++T DL G+++T E
Sbjct: 293 DLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRRVL-DAGIRTADLRGENSTSE 350

Query: 364 VTEDVL 369
           V + V+
Sbjct: 351 VGDAVV 356

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  120 bits (302), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 111/372 (29%), Positives = 185/372 (49%), Gaps = 45/372 (12%)

Query: 22  KNLTIGLIPGDGIGKEVIPAGKQVLQNL----NSKHGLNFDFIDLQAGFQTFLDTGKALP 77
           KN+ +  +PGD +G EV     ++L+ +    N+K   NF++  +  G      TG  LP
Sbjct: 5   KNIVV--LPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLI--GGAAIDATGNPLP 60

Query: 78  DETIQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLYANVRPVKSVEGTTD 134
           DE+++  K +    L GAV  P     G   P   ++ +RKE+ LYAN+RP       +D
Sbjct: 61  DESLEASK-RADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNF---ASD 115

Query: 135 KPVDMVIVRENTRRFINIKLERTYI--------DRATGTRVAEATKRISEIATRRIATIA 186
             +D+  ++E   +  +  + R  +            G  VA  +++ S    +RI  +A
Sbjct: 116 SLLDLSPLKEKYAKGTDFTVVRELVGGIYFGKRKEDDGDGVAWDSEQYSVPEVQRITRMA 175

Query: 187 LDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSM 246
             +A+Q    N    +    K+NVL+ S  L+R   K V E+ ++++  +  + Q++DS 
Sbjct: 176 AFLAMQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIQNEFPSLKVSHQLIDSA 228

Query: 247 VYRMFREP-QCFDVVVAPNLYGDILSDGAAALVG--------SLGVVPSANVGPEIVIGE 297
              + + P Q   +++  N++GDI+SD A+ + G        SL  +P  N      + E
Sbjct: 229 AMILVKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSA--FGLYE 286

Query: 298 PCHGSAPDIAGKGISNPIATIRSTALMLEF-LGHNEAAQDIHRAVEANLKENKVKTPDLG 356
           PCHGSAPD+  KG  NPI TI S A+ML+  L   E    +  AV   L +N ++T DLG
Sbjct: 287 PCHGSAPDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVRRVL-DNNIRTADLG 344

Query: 357 GKSTTQEVTEDV 368
           G ++T ++ + V
Sbjct: 345 GSNSTSDIGDAV 356

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 64/115 (55%), Gaps = 6/115 (5%)

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INYNEQIVDSMVYR 249
           +L  + K  L ++ K+ +L + DG F++I + +YE++ K K+ Q  INY  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQSIYETHYKAKFQQLNINYEHRLIDDMVAQ 274

Query: 250 MFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 70/130 (53%), Gaps = 11/130 (8%)

Query: 178 ATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQI 236
           + R  A  +  +ALQ+     K  L ++ K+ +L + DG F++I ++VY+S  K K+ ++
Sbjct: 200 SIRGFAHSSFKLALQK-----KLNLFLSTKNTILKKYDGRFKDIFQEVYDSEYKQKFAEL 254

Query: 237 N--YNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE-- 292
           N  Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+  
Sbjct: 255 NITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILITPDGK 313

Query: 293 IVIGEPCHGS 302
               E  HG+
Sbjct: 314 TFESEAAHGT 323

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 68/127 (53%), Gaps = 11/127 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQIN--Y 238
            A  + ++AL+R     K  L  T K+ VL + DG F++I +++YES+ K ++ +I   Y
Sbjct: 195 FARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQFDEIGILY 249

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 250 EHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAPDGKTFES 308

Query: 297 EPCHGSA 303
           E  HG+ 
Sbjct: 309 EAAHGTV 315

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 64/115 (55%), Gaps = 6/115 (5%)

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INYNEQIVDSMVYR 249
           +L  + K  L ++ K+ +L + DG F++I ++VYE+  K K+ Q  I+Y  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQ 274

Query: 250 MFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 64/115 (55%), Gaps = 6/115 (5%)

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INYNEQIVDSMVYR 249
           +L  N K  L ++ K+ +L + DG F++I +++YES+ K ++    I+Y  +++D MV +
Sbjct: 209 KLAINKKLNLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGISYEHRLIDDMVAQ 268

Query: 250 MFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 269 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 322

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 90/182 (49%), Gaps = 19/182 (10%)

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQIN--YNEQIVDSMVYR 249
           +L  + K  L ++ K+ +L + DG F+++ ++V++S  KDK+  +N  Y  +++D MV +
Sbjct: 220 KLAIDKKLDLFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKYEHRLIDDMVAQ 279

Query: 250 MFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSA---- 303
           M +    + ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 280 MIKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHY 338

Query: 304 -PDIAGKGIS-NPIATIRSTALMLEFLGH-------NEAAQDIHRAVEANLKENKVKTPD 354
                GK  S N IA+I + +  L   G         + AQ + +A    ++E+ + T D
Sbjct: 339 RQHQQGKQTSTNSIASIFAWSRGLAKRGELDNTPDVMKFAQTLEKATLDTVQEDGIMTKD 398

Query: 355 LG 356
           L 
Sbjct: 399 LA 400

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 64/115 (55%), Gaps = 6/115 (5%)

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INYNEQIVDSMVYR 249
           +L  + K  L ++ K+ +L + DG F++I ++VYE+  K K+ +  I+Y  +++D MV +
Sbjct: 216 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAEYKSKFEKLGIHYEHRLIDDMVAQ 275

Query: 250 MFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 276 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--INY 238
            A  + ++A++R     K  L  T K+ +L + DG F++I + +Y E  K K+ +  I+Y
Sbjct: 193 FARASFELAIKR-----KLPLFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKFKELGISY 247

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+  I   
Sbjct: 248 EHRLIDDMVAQMIKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTPDGKIFES 306

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 307 EAAHGT 312

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 96/206 (46%), Gaps = 19/206 (9%)

Query: 103 VEGYSSPIVALRKEMG-LYANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDR 161
           V G++ PI+  R   G  Y     V   EGT    + +V   ++  +  N+ LE     +
Sbjct: 121 VPGWNEPIIVGRHAFGDQYKATDVVIPGEGT----LKLVFESKDGDKSKNLDLEVFEYPK 176

Query: 162 ATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREI 221
             G  VA      ++  T   A  + ++ALQR     K  L  T K+ +L + DG F++I
Sbjct: 177 DGG--VAMTMYNTTDSITG-FAKSSFELALQR-----KMPLYSTTKNTILKKYDGKFKDI 228

Query: 222 CKDVYESN-KDKY--GQINYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALV 278
            + +Y +  K+K+    I Y  +++D MV +M +    F ++   N  GD+ SD  A   
Sbjct: 229 FEGMYAAEYKEKFEAAGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGF 287

Query: 279 GSLGVVPSANVGPE--IVIGEPCHGS 302
           GSLG++ S  V P+      E  HG+
Sbjct: 288 GSLGLMTSVLVSPDGKTFESEAAHGT 313

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 108/240 (45%), Gaps = 35/240 (14%)

Query: 161 RATGTR-VAEATKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFR 219
           + TG R VA A     E + R  A  +  +AL +     +  L ++ K+ +L Q DG F+
Sbjct: 181 KGTGARGVALAMYNTDE-SIRGFAHASFKLALSK-----RLNLFMSTKNTILKQYDGRFK 234

Query: 220 EICKDVYESNKDKYGQ---INYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAA 276
           +I ++VY        +   I+Y  +++D MV +M +    F V+   N  GD+LSD  A 
Sbjct: 235 DIFQEVYAQEYQTQFRDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQ 293

Query: 277 LVGSLGVVPSANVGPE--IVIGEPCHGSA-----PDIAGKGIS-NPIATIRSTALMLEFL 328
             GSLG++ S  V P+      E  HG+          GK  S N IA+I + +  L   
Sbjct: 294 GFGSLGLMTSMLVTPDGKTFESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWSRGLGKR 353

Query: 329 GHNEAAQDI---HRAVEA----NLKENKVKTPDLG---------GKSTTQEVTEDVLARL 372
           G  +   D+    R +EA     ++++ + T DL             TT E  + V ARL
Sbjct: 354 GELDGTPDVVEFARKLEAATIETVQQHGIMTKDLALACGNANRDAYVTTNEFLDAVEARL 413

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQIN--Y 238
            A  + + AL+R     K  L  T K+ +L Q DG F++I +++Y +  +DK+  +N  Y
Sbjct: 198 FAKASFEFALER-----KIPLYSTTKNTILKQYDGKFKDIFEEMYAKEYEDKFKVLNIWY 252

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 253 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGSLGLMTSVLLTPDGSSFES 311

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 312 EAAHGT 317

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INY 238
            A  + ++AL+R     K  L  T K+ +L + DG F++I + +YE   K K+    I Y
Sbjct: 194 FAKSSFELALER-----KMPLYSTTKNTILKKYDGQFKDIFEGMYEREYKQKFEAVGIWY 248

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 308 EAAHGT 313

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 93/194 (47%), Gaps = 24/194 (12%)

Query: 180 RRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--I 236
           R  A  + ++ALQR     K  L  T K+ +L + DG F++  + +YE+  ++++ +  I
Sbjct: 192 RGFARASFELALQR-----KMPLYSTTKNTILKRYDGRFKDEFEAMYEAEYRERFERAGI 246

Query: 237 NYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IV 294
            Y  +++D MV +M +    F V+   N  GD+ SD  A   GSLG++ S  V P+    
Sbjct: 247 WYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGRAF 305

Query: 295 IGEPCHGSAP-----DIAGKGIS-NPIATIRSTALMLEFLGHNEAAQDIH---RAVE--- 342
             E  HG+          GK  S N IA+I +    L   G  +   ++    RA+E   
Sbjct: 306 ESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLLQRGRLDGTPEVEGFARALETAT 365

Query: 343 -ANLKENKVKTPDL 355
            A + E+ + T DL
Sbjct: 366 VATVNEDGIMTKDL 379

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 93/203 (45%), Gaps = 28/203 (13%)

Query: 197 NGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INYNEQIVDSMVYRMFRE 253
           N K  L +  K+ +L + DG F++I + +Y    K K+ Q  I Y  +++D MV +M + 
Sbjct: 214 NKKLNLFLATKNTILKKYDGRFKDIFQQIYNGQYKAKFEQLGITYEHRLIDDMVAQMIKS 273

Query: 254 PQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP------D 305
              F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+         
Sbjct: 274 KGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSPDGKTFESEAAHGTVTRHFRRHQ 332

Query: 306 IAGKGISNPIATIRSTALMLEFLGHNEAAQDI-------HRAVEANLKENKVKTPDLG-- 356
           +  +  +N IA+I + +  L   G  +  +D+         A   +++E+ + T DL   
Sbjct: 333 MGEETSTNSIASIFAWSRGLAKRGELDGTKDVIAFANKLEAATLDSVQEDGIMTKDLALA 392

Query: 357 -GKS------TTQEVTEDVLARL 372
            GK+       T E  + V ARL
Sbjct: 393 SGKNNRSDYVNTDEFIDAVEARL 415

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INYNEQIVDSMVYR 249
           +L  + K  L ++ K+ +L + DG F++I + VYE+  K K+    I+Y  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQKVYEAQYKSKFEALGIHYEHRLIDDMVAQ 274

Query: 250 MFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 64/115 (55%), Gaps = 6/115 (5%)

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INYNEQIVDSMVYR 249
           ++  + K  L ++ K+ +L + DG F++I +++YE+  K K+ +  I+Y  +++D MV +
Sbjct: 216 KMAIDKKLNLFLSTKNTILKKYDGRFKDIFQNIYEAQYKPKFEELGIHYEHRLIDDMVAQ 275

Query: 250 MFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 276 MVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 96/205 (46%), Gaps = 20/205 (9%)

Query: 103 VEGYSSPIVALRKEMGLYANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRA 162
           V G+  PI+     +G +A+    K+ +     P  + +V +        KLE   +   
Sbjct: 134 VPGWEKPII-----IGRHAHADQYKATDAIIPGPGKLELVYKPEDGSEPTKLE---VYDY 185

Query: 163 TGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREIC 222
            G  VA A     E + R  A  +  +AL     N K  L ++ K+ +L + DG F++I 
Sbjct: 186 KGAGVALAMYNTDE-SIRGFAHASFKLAL-----NKKLNLFLSTKNTILKKYDGRFKDIF 239

Query: 223 KDVYESN-KDKY--GQINYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVG 279
           ++++++  K ++    I+Y  +++D MV +M +    F ++   N  GD+ SD  A   G
Sbjct: 240 QEIFDAEYKTQFEAANISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFG 298

Query: 280 SLGVVPSANVGPE--IVIGEPCHGS 302
           SLG++ S  V P+      E  HG+
Sbjct: 299 SLGLMTSVLVTPDGKTFESEAAHGT 323

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQIN--Y 238
            A  + ++AL+R     K  L  T K+ +L + DG F++I + +Y S+ +DK+  I   Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKRYDGKFKDIFESMYASDYQDKFEVIGIWY 246

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMSSVLVTPDGKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INY 238
            A  +  +A++R     K  L  T K+ +L + DG+F++I + +YE   K+K+ +  I Y
Sbjct: 195 FAKASFQLAVER-----KMPLYSTTKNTILKKYDGMFKDIFEGMYEREYKEKFEELGIWY 249

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 250 EHRLIDDMVAQMLKSSGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFES 308

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 309 EAAHGT 314

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INY 238
            A  + ++AL+R     K  L    K+ +L + DGLF++I + +Y+ + K K+ +  I +
Sbjct: 195 FAKSSFELALKR-----KLPLFFATKNTILKEYDGLFKDIFEKLYKDHYKTKFEELGITF 249

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+  +   
Sbjct: 250 EHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSVFES 308

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 309 EAAHGT 314

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYE----SNKDKYGQIN 237
            A  + ++AL+R     K  L  T K+ +L + DG F++I + +YE    S  +K G I 
Sbjct: 193 FAKASFELALER-----KQPLYSTTKNTILKKYDGKFKDIFEAMYEKEYRSQFEKLG-IW 246

Query: 238 YNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 295
           Y  +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 247 YEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFE 305

Query: 296 GEPCHGS 302
            E  HG+
Sbjct: 306 SEAAHGT 312

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 96/207 (46%), Gaps = 25/207 (12%)

Query: 103 VEGYSSPIVALRKEMGLYANVRPVKSVEGTTDKP--VDMVIVRENTRRFINIKLERTYID 160
           V G+  PI+     +G +A+    K+ +     P  +++V   EN       K+   Y  
Sbjct: 133 VPGWEKPII-----IGRHAHGDQYKATDAVIPGPGKLELVYKPENGPE----KVMEVYDY 183

Query: 161 RATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFRE 220
           +  G  +A      +E + R  A  +  +AL +     K  L ++ K+ +L + DG F++
Sbjct: 184 KGPGVALAMYN---TEESIRGFAHASFKLALTK-----KLNLYLSTKNTILKKYDGRFKD 235

Query: 221 ICKDVYESNKDKYGQ---INYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAAL 277
           I +++Y++   K  +   I Y  +++D MV +M +    F ++   N  GD+ SD  A  
Sbjct: 236 IFQELYDAEYKKQFEAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQG 294

Query: 278 VGSLGVVPSANVGPE--IVIGEPCHGS 302
            GSLG++ S  V P+      E  HG+
Sbjct: 295 FGSLGLMTSVLVTPDGKTFESEAAHGT 321

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INY 238
            A  +  +A++R     K  L  T K+ +L Q DG F++I K VYE+  K+ + +  I Y
Sbjct: 190 FARASFTMAIER-----KLPLYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIWY 244

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  +  +      
Sbjct: 245 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFES 303

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 304 EAAHGT 309

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 63/130 (48%), Gaps = 11/130 (8%)

Query: 178 ATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ-- 235
           A    A  +  +AL+R     +  L  T K+ +L + DG F+ + +D+YE    +  +  
Sbjct: 190 AIEGFARSSFQLALER-----QLPLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQFEDL 244

Query: 236 -INYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE-- 292
            I Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+  
Sbjct: 245 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPDGK 303

Query: 293 IVIGEPCHGS 302
               E  HG+
Sbjct: 304 TFESEAAHGT 313

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICK----DVYESNKDKYGQIN 237
            A  + ++AL+R     K  L  T K+ +L + DG F+++ +    D Y+S  ++ G I 
Sbjct: 191 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEQMYADQYQSRFEELG-IW 244

Query: 238 YNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 295
           Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 245 YEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLVTPDGKTFE 303

Query: 296 GEPCHGS 302
            E  HG+
Sbjct: 304 SEAAHGT 310

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--INY 238
            A  + ++A++R     K  L  T K+ +L + DG F+++ + +Y ES K+K+    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWY 246

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INYNEQIVDSMVYR 249
           +L    K  L ++ K+ +L + DG F++I +++Y+S  K ++ +  I Y  +++D MV +
Sbjct: 216 KLAITKKLNLYLSTKNTILKKYDGRFKDIFQEIYDSEYKSEFEKLGIWYEHRLIDDMVAQ 275

Query: 250 MFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 276 MIKSKGGF-ILAFKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKAFESEAAHGT 329

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 67/130 (51%), Gaps = 11/130 (8%)

Query: 178 ATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQI 236
           + +  A  +  +AL+R     K  L +  K+ +L + DG F+ I  D+Y++  K+K+ ++
Sbjct: 191 SIKGFAKASFIMALKR-----KLPLFLATKNTILKKYDGRFKSIFDDMYQNEFKEKFEKL 245

Query: 237 --NYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE-- 292
              Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+  
Sbjct: 246 GLTYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSQLITPDGK 304

Query: 293 IVIGEPCHGS 302
               E  HG+
Sbjct: 305 TFQSEAAHGT 314

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 91/198 (45%), Gaps = 28/198 (14%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---INYNEQIVDSMVYRMFREPQCFD 258
           L  T K+ +L + DG F+++ + +YES      +   I Y  +++D MV +M +    + 
Sbjct: 210 LYSTTKNTILKKYDGKFKDVFESLYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY- 268

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSA-----PDIAGKGI 311
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+          GK  
Sbjct: 269 IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKET 328

Query: 312 S-NPIATIRSTALMLEFLGHNEAAQDIHRAVEA-------NLKENKVKTPDLG---GKS- 359
           S N IA+I +    L   G  ++  D+ +  E         ++E+++ T DL    GK+ 
Sbjct: 329 STNSIASIFAWTRGLIQRGKLDSTPDVVKFAELVESATVNTVQEDEIMTKDLALILGKTD 388

Query: 360 -----TTQEVTEDVLARL 372
                TT+E  E V  RL
Sbjct: 389 RSSYVTTEEFIEAVHKRL 406

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INYNEQIVDSMVYRMFREPQCFD 258
           L  T K+ +L + DG +++I  D+YE + KDK+    I Y  +++D MV +M +    F 
Sbjct: 212 LYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF- 270

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           V+   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 271 VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISDDGKTFESEAAHGT 316

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 66/131 (50%), Gaps = 12/131 (9%)

Query: 199 KATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--INYNEQIVDSMVYRMFREPQ 255
           K  L  T K+ +L + DG F++I  ++Y    KD++ +  I Y  +++D MV +M +   
Sbjct: 208 KIPLYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFYEHRLIDDMVAQMLKSKG 267

Query: 256 CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP-----DIAG 308
            F ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+         AG
Sbjct: 268 GF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQSEAAHGTVTRHYRLHQAG 326

Query: 309 KGIS-NPIATI 318
           K  S N IA+I
Sbjct: 327 KPTSTNSIASI 337

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYG--QINY 238
            A  + ++AL+R     K  L  T K+ +L   D  F++I  ++++   K+K+   +I Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQALKITY 246

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQIN--Y 238
            A  + + AL+R     K  L  T K+ +L + DG F++I + +Y E  ++K+  +N  Y
Sbjct: 203 FARSSFEFALER-----KLPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWY 257

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  +  +      
Sbjct: 258 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFES 316

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 317 EAAHGT 322

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 73/144 (50%), Gaps = 12/144 (8%)

Query: 164 GTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICK 223
           G+ VA A     E + R  A  +  +AL +     K  L ++ K+ +L + DG F++I +
Sbjct: 190 GSGVALAMYNTDE-SIRGFAHSSFKLALTK-----KLNLFLSTKNTILKKYDGRFKDIFQ 243

Query: 224 DVYESN-KDKYGQ--INYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGS 280
           ++++   K K+    I+Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 244 EIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 302

Query: 281 LGVVPSANVGPE--IVIGEPCHGS 302
           LG++ S  V P+      E  HG+
Sbjct: 303 LGLMTSILVTPDGKTFESEAAHGT 326

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY----ESNKDKYGQIN 237
            A  + ++ALQR     +  L  T K+ +L + DG F+++ + +Y    +S  ++ G I 
Sbjct: 192 FARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFEAMYAAEYQSRFEELG-IW 245

Query: 238 YNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 295
           Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 246 YEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFE 304

Query: 296 GEPCHGS 302
            E  HG+
Sbjct: 305 SEAAHGT 311

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 83/167 (49%), Gaps = 14/167 (8%)

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INYNEQIVDSMVYR 249
           +L  + K  L ++ K+ +L + DG F+++ ++++++  K ++ +  I Y  +++D MV +
Sbjct: 215 KLALSKKLDLFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQFEESGIQYQHRLIDDMVAQ 274

Query: 250 MFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAPDIA 307
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHY 333

Query: 308 GK------GISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKEN 348
            K        +NPIA+I +    +   G  +   D+ R   AN+ E+
Sbjct: 334 RKYQRGEETSTNPIASIFAWTRGIAKRGELDGTPDVVRF--ANILES 378

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INY 238
            A  + ++A++R     K  L  T K+ +L + DG F+++ + +Y  N K+K+    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWY 246

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 71/137 (51%), Gaps = 12/137 (8%)

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INYNEQIVDSMVYR 249
           RL    +  L ++ K+ +L Q DG F+++ +++Y++  K ++ +  I Y  +++D MV +
Sbjct: 215 RLALAKQLNLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEFERLGIYYEHRLIDDMVAQ 274

Query: 250 MFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSA---- 303
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 275 MVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHF 333

Query: 304 -PDIAGKGIS-NPIATI 318
               AGK  S N IA+I
Sbjct: 334 RQHQAGKETSTNSIASI 350

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--INY 238
            A  + ++AL+R     +  L  T K+ +L   D  F+EI   ++++  K+K+    I Y
Sbjct: 192 FAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F +V   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 60/114 (52%), Gaps = 6/114 (5%)

Query: 194 LKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQIN--YNEQIVDSMVYRM 250
           L  N    L +  K+ +L + DG F++I +++YE+  K ++ ++N  Y  +++D MV +M
Sbjct: 214 LAVNKNMNLFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQM 273

Query: 251 FREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
            +    + ++   N  GD+ SD  A   GSLG++ S    P+      E  HG+
Sbjct: 274 IKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILASPDGKTFESEAAHGT 326

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--INY 238
            A  + ++AL+R     K  L  T K+ +L + DG F+++ + +Y E  K+K+    I Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEALGIWY 246

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 60/115 (52%), Gaps = 6/115 (5%)

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---INYNEQIVDSMVYR 249
           RL  + +  L +  K+ +L Q DG F+++ + +Y++   +  +   I+Y  +++D MV +
Sbjct: 207 RLALSKQLNLFLATKNTILKQYDGRFKDLFQQLYDAEYREAFERAGISYEHRLIDDMVAQ 266

Query: 250 MFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           M +    F V+   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 267 MIKSRGGF-VLALKNYDGDVQSDIVAQGFGSLGLMSSVLITPDGNAFESEAAHGT 320

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--INY 238
            A  + ++A++R     K  L  T K+ +L + DG F+++ + +Y  S K+K+    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESLGIWY 246

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 62/116 (53%), Gaps = 8/116 (6%)

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNK----DKYGQINYNEQIVDSMVY 248
           +L  + K  L ++ K+ +L + DG F++I +++Y++      +K G I Y  +++D MV 
Sbjct: 209 KLALDKKLNLYLSTKNTILKKYDGRFKDIFQELYDTQYKAEFEKAG-IFYEHRLIDDMVA 267

Query: 249 RMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 268 QMVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 322

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 66/130 (50%), Gaps = 11/130 (8%)

Query: 178 ATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ- 235
           + R  A  + ++AL+      +  L  T K+ +L + DG F++  + +YE+  K+++   
Sbjct: 188 SIRGFARASFNMALEH-----EMPLYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAK 242

Query: 236 -INYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE-- 292
            I Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGK 301

Query: 293 IVIGEPCHGS 302
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---INY 238
            A  + ++AL+R     K  L  T K+ +L   D  F++I   ++++   +  Q   I Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQFQALGITY 246

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--INY 238
            A  + ++AL+R     K  L  T K+ +L   D  F++I   ++ E  ++K+    I Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKFQALGIKY 246

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 59/116 (50%), Gaps = 8/116 (6%)

Query: 193 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNK----DKYGQINYNEQIVDSMVY 248
           +L    K  L ++ K+ +L   DG F++I +++Y++      + +G I Y  +++D MV 
Sbjct: 211 KLALTKKLNLFLSTKNTILKTYDGRFKDIFQELYDTQYKTEFENHG-IYYEHRLIDDMVA 269

Query: 249 RMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           +M +    F ++   N  GD+ SD  A   GSLG++ S    P+      E  HG+
Sbjct: 270 QMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILATPDGKTFESEAAHGT 324

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (48%), Gaps = 11/127 (8%)

Query: 182 IATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---INY 238
            A  +  +AL+R     K  L  T K+ +L + DG F++I +++YE    +  +   I Y
Sbjct: 200 FALSSFKLALER-----KMPLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWY 254

Query: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  +  +      
Sbjct: 255 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKSFES 313

Query: 297 EPCHGSA 303
           E  HG+ 
Sbjct: 314 EAAHGTV 320

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 31/50 (62%)

Query: 323 LMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372
           LML  LG NE+A  I +AV   + E K  T D+GG S+T + T +++ +L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 56/130 (43%), Gaps = 23/130 (17%)

Query: 258  DVVVAPNLYGDILSDGAAALVGS------LGVVPSANVGPEIVIGEPCHGSAPDIAGKGI 311
            +V+V    +  ++  G+AA V S      +G +  A   PE++ GEP  G   DI   GI
Sbjct: 1116 NVIVDSKGFVKLIDFGSAAYVKSGPFDVFVGTIDYA--APEVLGGEPYEGKPQDIWAVGI 1173

Query: 312  --------SNPIATIRSTAL-MLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQ 362
                     NP   I       L+F   +E +++    ++  L +N  K P      T Q
Sbjct: 1174 LLYTIVFKENPFYNIDEIMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRP------TIQ 1227

Query: 363  EVTEDVLARL 372
            ++ +DV  R+
Sbjct: 1228 DIYDDVWLRI 1237

>KNAG0D01230 Chr4 (207381..209348) [1968 bp, 655 aa] {ON} Anc_7.491
           YJR110W
          Length = 655

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 194 LKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMF 251
            KTN K TLT   K   L  +  +F++    VY+ +     Q  +NE+ +  +VY ++
Sbjct: 485 FKTNNK-TLTFATKDRTLKFASPIFQQFLDCVYQLHTQNPTQFEFNERFLRRLVYHVY 541

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
           YHL035C (REAL)
          Length = 1599

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 87/228 (38%), Gaps = 29/228 (12%)

Query: 122 NVRPVKSVEGTTDKPVDMVIVRENTRRFIN----IKLERTYIDRATGTRVAEATKRISEI 177
           N+R VK      +   D+  +R+N  RF+     +    +++   T T V   T  I   
Sbjct: 538 NIRIVKYFAWENNISKDIKSIRQNELRFLFQKALVWALSSFLWFVTPTLVTGVTFAIYIF 597

Query: 178 ATRRIATIALDIALQRLKTNGKATLTVTHKSNVLS---QSDGLFREICKDVYESNKDKYG 234
              +     L      L T  K  L     SN+LS   QS      I K + E + +KY 
Sbjct: 598 VQHQELNAPLAFTTLSLFTLLKTPLD--QLSNMLSFMNQSIVSLDRIVKFINEDDTEKYN 655

Query: 235 QIN----------------YNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALV 278
           Q+                 +NE   DS ++++      F +     + G   S  +A L+
Sbjct: 656 QLTVSPDENKIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLNLILGSTGSGKSALLM 715

Query: 279 GSLGVVPSANVGPEIVIG-EPCHGSAPDIAGKGISNPIATIRSTALML 325
           G LG +   + G   V G EP H   PD    G++N  A    +A +L
Sbjct: 716 GLLGELHLIS-GSITVPGLEPRHDLIPD--HNGLTNSFAYCSQSAWLL 760

>Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON}
           similar to Ashbya gossypii ADR400W
          Length = 790

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 60/142 (42%), Gaps = 10/142 (7%)

Query: 49  LNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVLKN-QCQGALFGAVQSPTTKVEGYS 107
           L+  H L     +L+    T +     L  +   + K+    G   GA  S  T +    
Sbjct: 588 LDENHMLQQKICELEEQHGTLIKDNYRLAQQASAITKDFDSIGEFEGAYSSLKTHL---- 643

Query: 108 SPIVALRKEMGLYANVRPVKSVEGTTDKPVDMVIVRE-NTRRFINIKLER--TYIDRATG 164
             +V LRK   ++ N+    SV     K  ++  ++  N  R   +KLE   T+I+ ATG
Sbjct: 644 --VVHLRKMFKIFENILQQDSVNQAVKKLDNINRLQSLNNCRKAQLKLESIYTFIENATG 701

Query: 165 TRVAEATKRISEIATRRIATIA 186
           + V E  K + +   RRI  ++
Sbjct: 702 SIVDEHVKLLLKEKDRRIKRLS 723

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,360,104
Number of extensions: 1459738
Number of successful extensions: 4425
Number of sequences better than 10.0: 147
Number of HSP's gapped: 4205
Number of HSP's successfully gapped: 147
Length of query: 372
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 261
Effective length of database: 40,753,473
Effective search space: 10636656453
Effective search space used: 10636656453
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)