Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B035402.290ON26126113850.0
NCAS0B062402.290ON2602618751e-119
SAKL0E07590g2.290ON2602388241e-111
Suva_9.1062.290ON2642538051e-108
ZYRO0A01958g2.290ON2632568031e-108
KLLA0E08273g2.290ON2612588001e-107
YIL093C (RSM25)2.290ON2642427991e-107
Smik_9.862.290ON2642427921e-106
KAFR0J013502.290ON2642477881e-105
Skud_9.802.290ON2642537821e-104
TDEL0G022002.290ON2612577811e-104
KLTH0G10450g2.290ON2612477611e-101
TBLA0B059602.290ON2662567591e-101
Kpol_1003.402.290ON2612587394e-98
KNAG0A054102.290ON2662437352e-97
Ecym_33292.290ON2582477212e-95
Kwal_27.115092.290ON2612367178e-95
TPHA0C034202.290ON2682597083e-93
CAGL0D04158g2.290ON2722707022e-92
ADL211C2.290ON2252015723e-73
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B03540
         (261 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   538   0.0  
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   341   e-119
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   322   e-111
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   314   e-108
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   313   e-108
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   312   e-107
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   312   e-107
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   309   e-106
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   308   e-105
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   305   e-104
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   305   e-104
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   297   e-101
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   296   e-101
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   289   4e-98
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   287   2e-97
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   282   2e-95
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   280   8e-95
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   277   3e-93
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   275   2e-92
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   224   3e-73

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/261 (100%), Positives = 261/261 (100%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  KDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKIL 120
           KDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKIL
Sbjct: 61  KDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKIL 120

Query: 121 IENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQQ 180
           IENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQQ
Sbjct: 121 IENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQQ 180

Query: 181 DISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSWA 240
           DISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSWA
Sbjct: 181 DISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSWA 240

Query: 241 APEEQDLEEDFTEGEPEILDI 261
           APEEQDLEEDFTEGEPEILDI
Sbjct: 241 APEEQDLEEDFTEGEPEILDI 261

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  341 bits (875), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 173/261 (66%), Positives = 215/261 (82%), Gaps = 1/261 (0%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           M++QTNA+N+VERTSAYL SGLL+NTPAWY+VVA IPPTKKFTREP++ NP+T  +    
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  KDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKIL 120
           +D+R  VN KG YKTR N++DRK ++N LYKPPKL Y+ED+LR+LFF+QHPWELSRPKIL
Sbjct: 61  RDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKIL 120

Query: 121 IENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQQ 180
           +ENSLEE FDWSHIQQ  K LDGESVVQRT+YLLK +  ++M+ AYN+ARFEFYR RIQQ
Sbjct: 121 VENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTD-KMDMITAYNQARFEFYRFRIQQ 179

Query: 181 DISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSWA 240
           ++ +QVAQEEAEMFGS+F Q+  + GIEKEQKVI+QWKKKA QET+L+  R +NPSDSW 
Sbjct: 180 EVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSWI 239

Query: 241 APEEQDLEEDFTEGEPEILDI 261
           + E    EE+  E   E+L++
Sbjct: 240 SAEAGATEENLDEQGSELLEL 260

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  322 bits (824), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 154/238 (64%), Positives = 190/238 (79%), Gaps = 3/238 (1%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MK+QTNAVNL+ERTSAYL +GLL   PAWY+VVAS+PP+K F REPKITNP+  +N    
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  KD--DRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPK 118
            +  + + + N G YKTR +  DRK S N LYK PKL Y ED+LR LF++QHPWELSRPK
Sbjct: 61  SEYSETVGIKN-GTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPK 119

Query: 119 ILIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRI 178
           +LIEN+ EE++DWS IQQ  K LDGESVVQRTLYLLK +  + ++ AY++ARFEFYR+R+
Sbjct: 120 VLIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRV 179

Query: 179 QQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPS 236
           QQ+I +QVAQEEAEMFGS+F  +S E+G+EKEQKVIE WKKKAIQ+T+LM  RSS PS
Sbjct: 180 QQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPS 237

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  314 bits (805), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 152/253 (60%), Positives = 195/253 (77%), Gaps = 3/253 (1%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGR--NKT 58
           MKIQTNAVN+++RTSAYL SGLL++TPAWY+VVASIPP+ KFTREP+  NP+ GR   K 
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 59  FFKDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPK 118
               +R + N  GLYKTR N  DR+     LYKPPKL Y+EDRLR LF++QHPWELSRPK
Sbjct: 61  VDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRPK 120

Query: 119 ILIENSL-EENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLR 177
           IL+EN + +EN+DWSH+ Q  K LDGESV+QRT++LLK +   +M++AY+ AR+EFY LR
Sbjct: 121 ILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYALR 180

Query: 178 IQQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSD 237
           ++++  QQVA EEAEMFGSIF  +S EHGI+KEQ+V++ W+KK I+ET+LM  RSSNP+ 
Sbjct: 181 MEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSNPAG 240

Query: 238 SWAAPEEQDLEED 250
           SW      D  +D
Sbjct: 241 SWKDDATLDTAQD 253

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  313 bits (803), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 145/256 (56%), Positives = 198/256 (77%), Gaps = 8/256 (3%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MK+QTNAVN++ERTSAYL SGLL+ TPAWY VVAS+PPT KFTRE +  NP+TG+    +
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  KDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKIL 120
           K+    +N KG YKTR +  DRK   + LYK PKL +LED+LR +F++QHPWE SRPK+L
Sbjct: 61  KEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKML 120

Query: 121 IENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQQ 180
           +EN + ENFDWS++ Q  K LDGESVVQRT+YLL+ +P + ++ AY++ RFEFYRLR+Q+
Sbjct: 121 VENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMQE 180

Query: 181 DISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSWA 240
           +I QQVAQEEAEMFGS+F  ++ ++G+E+EQ+VI+ WK+KAI+ET+L+  R ++P++SW 
Sbjct: 181 EIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESWG 240

Query: 241 APEEQDLEEDFTEGEP 256
             ++        EGEP
Sbjct: 241 QEKQ--------EGEP 248

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  312 bits (800), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 202/258 (78%), Gaps = 9/258 (3%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MK+Q  AVN++ERTSAYL SG+L+ TPAWY+V+A +PPTKKF R P++T+P  G+++T  
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  KD-DRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKI 119
            D    + N+ GLYKTR N +++KD A+ LY+ PKL+Y+ED+LR LFF+QHPWELSRPKI
Sbjct: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120

Query: 120 LIENSLE-ENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRI 178
           L+EN+LE + +DWSHIQQ  K LDGESVVQRTL+LLK+     ++ AY++ARFEFYRLRI
Sbjct: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180

Query: 179 QQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDS 238
           QQ+I  QVAQEEAEMFGS+F  TS E+GI KEQKVI+ WK+KA+Q+ +LM  R+S+PS S
Sbjct: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240

Query: 239 WA-------APEEQDLEE 249
           W         P +QD+EE
Sbjct: 241 WTNETEEEQKPIDQDVEE 258

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  312 bits (799), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 145/242 (59%), Positives = 192/242 (79%), Gaps = 3/242 (1%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGR--NKT 58
           MKIQTNAVN+++RTSAYL SGLL+ TPAWY+VVASIPP+ KFTREP+  NP+ G    K 
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 59  FFKDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPK 118
               ++   NNKGLYKTR N  D++     LY+PPKL Y+EDRLRSLF++QHPWELSRPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 119 ILIENSL-EENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLR 177
           IL+EN + +EN+DWSH+ Q  + LDGESV+QRT+YL+K +   +M++AY+ AR+EFY LR
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 178 IQQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSD 237
           +Q++  QQVA EEAEMFGS+F  ++ EHGI+KEQ+V++ W+KK ++ET+LM  R+SNP+ 
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNPAG 240

Query: 238 SW 239
           SW
Sbjct: 241 SW 242

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  309 bits (792), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 147/242 (60%), Positives = 189/242 (78%), Gaps = 3/242 (1%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MKIQTNAVN+++RTSAYL SGLL++TPAWY+VVASIPP+ KFTREP   NP+ G      
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  KD--DRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPK 118
            D  +    N+ GLYKTR N  D++     LYKPPKL Y+EDRLR+LF++QHPWELSRPK
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 119 ILIENSL-EENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLR 177
           IL+EN + +E++DWSH+ Q  K LDGESV+QRT+YLLK +   N ++AY+ AR+EFY LR
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 178 IQQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSD 237
           +Q++  QQVA EEAEMFGSIF +++ EHGI+KEQ+V+  W+KK I+ET+LM  RSSNP+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNPAG 240

Query: 238 SW 239
           SW
Sbjct: 241 SW 242

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  308 bits (788), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 143/247 (57%), Positives = 196/247 (79%), Gaps = 1/247 (0%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MKIQTNA N++ERTSAYL +GLL+N PA+YDV+A +PP+ KFTREPK+ NP+TG+++T F
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  KDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKIL 120
           ++   +VN +GLYKTR    DR  S + LYK  +L YLED LR LF++QHPWELSRPKI+
Sbjct: 61  RELTDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKIV 120

Query: 121 IENSLE-ENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQ 179
           IEN+++  + DWS+IQQ  K +DGESVVQRTL+L+KN+   N+   Y++ARFEFY++R+Q
Sbjct: 121 IENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQ 180

Query: 180 QDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSW 239
           +D  +Q+A EEA MFGSIF  T+ E+GI++EQ VI +WK++AI+ET+L++ + +NPSDSW
Sbjct: 181 RDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDSW 240

Query: 240 AAPEEQD 246
           A  E  D
Sbjct: 241 AQEESSD 247

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  305 bits (782), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 191/253 (75%), Gaps = 3/253 (1%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MKIQTNAVN+++RTSAYL SGLL+ TPAWY+VVASIPP+ KFTREP+  NP+ G      
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  KD--DRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPK 118
            D   R   N  GLYKTR N  D++ S   LYKPPKL Y+EDRLR+LF++QHPWELSRPK
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 119 ILIENSL-EENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLR 177
           IL+EN + +E++DW  + Q  K LDGESVVQRT++LLK +   +M++AY+ AR+EFY LR
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 178 IQQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSD 237
           +Q++  QQVA EEAEMFGSIF  ++ EHGI+KEQ+V++ W+KK I+ET+LM  +SSNP+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240

Query: 238 SWAAPEEQDLEED 250
           SW      D  +D
Sbjct: 241 SWKDDTTLDTAQD 253

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  305 bits (781), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 153/257 (59%), Positives = 203/257 (78%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MKIQTNAVN++ERTSAYL SGLL+NTPAWYDVVASIPP  KFTREP++ NP+  +     
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  KDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKIL 120
           KD     N KG +KTR + +D+K +   LY+ PKL ++ED+LR +F++QHPWELSRPK+L
Sbjct: 61  KDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKVL 120

Query: 121 IENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQQ 180
           +EN  EE FDWSHIQQ EK LDGESV+QRTL+LLKN  G ++ +AY++ARFEFYRLR+QQ
Sbjct: 121 VENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMQQ 180

Query: 181 DISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSWA 240
           ++ QQVAQEE+EMFGSI+  ++ + G+++EQK I+ WK+KAI+ET L+  R +NPS++WA
Sbjct: 181 EVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAWA 240

Query: 241 APEEQDLEEDFTEGEPE 257
           A EEQ  ++D  + + E
Sbjct: 241 AGEEQPDKKDLEDQDIE 257

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  297 bits (761), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 191/247 (77%), Gaps = 3/247 (1%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MK+Q NAVN++ERTS+YL +GLL+ TPAWYDVVA +PP+K+F REP++ NP+T +     
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  KD--DRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPK 118
            +  ++  V N+  YKTR ++ +R+ S + L+  PKL Y ED+LR +F+EQHPWELSRPK
Sbjct: 61  SEFAEQYSVENRS-YKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPK 119

Query: 119 ILIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRI 178
           +L+ENS   ++DWS IQQ  K LDGESVVQRTLYLL+ +    +L AY++ARFEFYRLRI
Sbjct: 120 MLVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRI 179

Query: 179 QQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDS 238
           Q+++  QVAQEEAEMFGS+F  ++ + G+EKEQK+I+ WK+KAI +T++M  R+ NPS+S
Sbjct: 180 QEEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSES 239

Query: 239 WAAPEEQ 245
           W+A E Q
Sbjct: 240 WSAQESQ 246

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  296 bits (759), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 192/256 (75%), Gaps = 1/256 (0%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MKIQ NAVN++ERTSAYL +G+++  P WYDVVA+ PP+KKFTREPK  NP+T +    F
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  KDDRIRVN-NKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKI 119
           K  +  +N   GLYKTR N +D+K++ ++LYK PKL Y+ED+LR LF+EQHPWEL+RPKI
Sbjct: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120

Query: 120 LIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQ 179
           ++EN  E  +DWS + Q  K LDGESVVQRTL+LLK +    ++ AYN+ARFEFYRLR+ 
Sbjct: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180

Query: 180 QDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSW 239
           ++I +QVAQEE+EMFG++F  T+ E GIEKEQ++I+ WK +AI+ET++ E + S  S SW
Sbjct: 181 EEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240

Query: 240 AAPEEQDLEEDFTEGE 255
                +  E++F  G+
Sbjct: 241 KTDSLEGKEDEFNTGD 256

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  289 bits (739), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 191/258 (74%), Gaps = 5/258 (1%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MKIQ NAVN++ERTSAYL +GLL   PAWY+VVAS+PP KKF R PK+TNP+  R     
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  KDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKIL 120
                   N G++KTR    DR +++  LY   KL Y+ED+LR +F++QHPWELSRPKIL
Sbjct: 61  HSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL 120

Query: 121 IENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQQ 180
           IEN+ +E +DWSH+QQ  K LDGESVVQRTLYL+KN+   +++ AY+ AR+EFYRLR+QQ
Sbjct: 121 IENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQQ 180

Query: 181 DISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSWA 240
            I +QVAQEEAEMFGS+F  ++ E+GI+KEQKVI+ WK+KAI +T++M  R  NPS+SWA
Sbjct: 181 HIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESWA 240

Query: 241 APEE-----QDLEEDFTE 253
             E+      D+EED  E
Sbjct: 241 TDEKDPKKNDDIEEDVEE 258

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  287 bits (735), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 136/243 (55%), Positives = 184/243 (75%), Gaps = 7/243 (2%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRN---- 56
           MKIQTNAVN++ERTSA+L SG++Q  PAWY+VVA+ PP KKF R+P   NP+TG+     
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 57  KTFFKDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSR 116
           K+F    R   N   +YKTR +  D++ S N LY+PPKL+YLED+LR LF++QHPWE SR
Sbjct: 61  KSFLDSKR---NAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSR 117

Query: 117 PKILIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRL 176
           P ILIEN++   FDWS IQQ  K+LDGESVVQR L+LL+     ++  AY+KARFEFYR+
Sbjct: 118 PMILIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRI 177

Query: 177 RIQQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPS 236
           R+QQ++ +Q++QEEA M+GS++ Q++ E G+EKE KVIE WK++ I+ET+ M  R ++PS
Sbjct: 178 RMQQELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237

Query: 237 DSW 239
           +SW
Sbjct: 238 ESW 240

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  282 bits (721), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 181/247 (73%), Gaps = 5/247 (2%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTF- 59
           MKIQTNA N++ERTS++L  GLL  TP WYDV+   PP+ KF R+PK+ NP+TG      
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 60  --FKDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRP 117
             F D+R   ++ G YKTR N+ +++ S + +Y+ PKL Y ED+LRSLF++QHPWELSRP
Sbjct: 61  REFSDNR--NSSSGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRP 118

Query: 118 KILIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLR 177
           KIL+EN  +E  DWS IQQ  K LDGESVVQRTLYLL +    N++ AY++ARFEFYRLR
Sbjct: 119 KILVENQGDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLR 178

Query: 178 IQQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSD 237
           +QQ++ +QVAQEEA M GS+F  ++ E G+ KEQ+VI+ WKKKA+++ +LM  + S+ S 
Sbjct: 179 MQQELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRSDQSA 238

Query: 238 SWAAPEE 244
           +W   E+
Sbjct: 239 NWGTRED 245

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  280 bits (717), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 134/236 (56%), Positives = 183/236 (77%), Gaps = 3/236 (1%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MK+Q NAVN++ERTS+YL +G+L+ TPAWY+VVA IPP+K+F REP++ NP+T       
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  KDDRIRVN--NKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPK 118
            + R   N  N+  YKTR ++ D++ S N LYK PKL Y ED+LR LFFEQHPWELSRPK
Sbjct: 61  SEFRESYNFENRS-YKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPK 119

Query: 119 ILIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRI 178
           +L+ENS  +++DWS +QQ  K LDGESVVQRTLYLLK++    +L AY++ARFEFYRLRI
Sbjct: 120 MLVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRI 179

Query: 179 QQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSN 234
           Q+++  QVAQEEAEM GS+F  ++ + G++KEQK+I+ WK+KAI +++L+  R++N
Sbjct: 180 QEEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTN 235

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  277 bits (708), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 142/259 (54%), Positives = 199/259 (76%), Gaps = 6/259 (2%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGR--NKT 58
           MKIQ NAVN++ERTS+YL SGLL   PAWY+VVA IPP+KKF R PK TNP+  +  N+ 
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 59  FFKDDRIRVNNKG--LYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSR 116
              D+R+  +  G  L+K+R N++D+K S+ N+YKP KL Y+ED+LR +F+ QHPWELSR
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 117 PKILIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRL 176
           PKI++EN+ +E +DWSHIQQ  K LDGE+VVQR +YL+K +  +   +   KAR+EFYR+
Sbjct: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180

Query: 177 RIQQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPS 236
           R+Q +I +QVAQEEAEMFGS+F  ++ E G+++EQKVI+ WK+KAI ET+LME + +NPS
Sbjct: 181 RMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240

Query: 237 DSWAAPEEQDLEEDFTEGE 255
           ++WA  +E+D+  ++ +GE
Sbjct: 241 ETWAQEKEEDV--NYPDGE 257

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  275 bits (702), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 143/270 (52%), Positives = 197/270 (72%), Gaps = 11/270 (4%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MKIQTNAVN++ERTSAYL +G+++ TPAWY+VVASIPP  KFTREP   NP+T +  +  
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  KD-DRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKI 119
           KD D   VN  GLYKTR N ++RK +   +YKPPKL+YLED++R+LF++QHPWEL+RPKI
Sbjct: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120

Query: 120 LIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQ 179
           + EN +  N DW ++ Q  + LDGE+VVQRTLYLLK +   N+  AY++AR EFYRLR+Q
Sbjct: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMQ 180

Query: 180 QDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPS--- 236
           Q++ +QVA EEAEMFGS+F  ++ EHG+ KEQ+VIE+WK+ A  +++L+  +  N S   
Sbjct: 181 QELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKAA 240

Query: 237 -DSWAAPEEQDLEEDF------TEGEPEIL 259
            D+ A   E+ +E+D       T+ + E+L
Sbjct: 241 GDASAVSSEKQVEDDVVNFDESTDADQEVL 270

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  224 bits (572), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 144/201 (71%), Gaps = 3/201 (1%)

Query: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60
           MKIQTNAVN+++RTS YL +GLL+ TPAWY+VVA IPP  KF REPK+ +P +G+ K   
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  KDDRIRVN-NKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKI 119
                R+N N   YKTR    DR+ +A  ++KP KL ++ED+LRSLFF+QHPWELSRPK+
Sbjct: 61  DIMTDRLNRNTETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118

Query: 120 LIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQ 179
           L+EN   E +DWS + Q  K LDGESVVQRTLYLLK+     ML AY++ARFEFYRLR+Q
Sbjct: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQ 178

Query: 180 QDISQQVAQEEAEMFGSIFRQ 200
           Q++ +Q+A E         RQ
Sbjct: 179 QELEEQIAYERPRWLALCSRQ 199

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,754,463
Number of extensions: 1354699
Number of successful extensions: 4356
Number of sequences better than 10.0: 59
Number of HSP's gapped: 4438
Number of HSP's successfully gapped: 59
Length of query: 261
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 154
Effective length of database: 41,212,137
Effective search space: 6346669098
Effective search space used: 6346669098
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)