Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B035302.292ON73973932880.0
NCAS0B062302.292ON72372224930.0
Suva_9.1082.292ON72271724580.0
YIL091C (UTP25)2.292ON72171824530.0
Smik_9.882.292ON72471824110.0
Skud_9.822.292ON72271823950.0
KAFR0J013402.292ON72872523380.0
KNAG0A054002.292ON72172322970.0
TBLA0B059702.292ON71965522420.0
SAKL0E07546g2.292ON71872322020.0
TDEL0G022202.292ON71071421630.0
CAGL0D04180g2.292ON70057721380.0
KLLA0E08229g2.292ON70471421220.0
Kpol_1039.462.292ON70457021110.0
KLTH0G10494g2.292ON74757121080.0
Kwal_27.115032.292ON72772020580.0
Ecym_33312.292ON70865620520.0
ZYRO0A02002g2.292ON70971820500.0
ADL209C2.292ON70457319920.0
TPHA0D015202.292ON716831092e-04
Kpol_1053.373.106ON744100771.2
Ecym_13651.455ON140043761.9
ZYRO0E03322g1.455ON152644716.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B03530
         (739 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...  1271   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   964   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   951   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   949   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   933   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   927   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   905   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   889   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   868   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   852   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   837   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   828   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   822   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   817   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   816   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   797   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   795   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   794   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   771   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...    47   2e-04
Kpol_1053.37 s1053 (57362..59596) [2235 bp, 744 aa] {ON} (57362....    34   1.2  
Ecym_1365 Chr1 complement(748590..752792) [4203 bp, 1400 aa] {ON...    34   1.9  
ZYRO0E03322g Chr5 (260990..265570) [4581 bp, 1526 aa] {ON} simil...    32   6.6  

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score = 1271 bits (3288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/739 (85%), Positives = 633/739 (85%)

Query: 1   MAAKDSTERNQXXXXXXXXXXDHHRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTXXXXX 60
           MAAKDSTERNQ          DHHRKRGRQELRTIRRSAAKKSRYDSNVTEHNDT     
Sbjct: 1   MAAKDSTERNQKKSYKSNNSNDHHRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTEELLQ 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXRKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVS 120
                                   RKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVS
Sbjct: 61  EESEEGEEDEEDDQSEQEEVDEDERKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVS 120

Query: 121 DSNLNNTGDRXXXXXXXXXXXXXXXXNGLXXXXXXXXXXXXXXXXXXVESDDEQDPFESH 180
           DSNLNNTGDR                NGL                  VESDDEQDPFESH
Sbjct: 121 DSNLNNTGDRETEDSIIEEDETEQIENGLLDRDDEQSDDDQLNDSNDVESDDEQDPFESH 180

Query: 181 FNKPTEQFVDKLHAAFESREIKYKATKXXXXXXXXXXXXKPTIFGEELETNRLSSSKHGQ 240
           FNKPTEQFVDKLHAAFESREIKYKATK            KPTIFGEELETNRLSSSKHGQ
Sbjct: 181 FNKPTEQFVDKLHAAFESREIKYKATKIVIDDSHSVISSKPTIFGEELETNRLSSSKHGQ 240

Query: 241 SIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLY 300
           SIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLY
Sbjct: 241 SIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLY 300

Query: 301 ALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKK 360
           ALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKK
Sbjct: 301 ALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKK 360

Query: 361 SGLDQVDKKGKFYDQFXXXXXXXXXXXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFY 420
           SGLDQVDKKGKFYDQF             FQQIFKGNTNDFFVLGLKFTRKAIKLYSNFY
Sbjct: 361 SGLDQVDKKGKFYDQFKDDSLPPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFY 420

Query: 421 QSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNK 480
           QSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNK
Sbjct: 421 QSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNK 480

Query: 481 IPTEQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIV 540
           IPTEQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSP        RCRNWEGRWKNHKIV
Sbjct: 481 IPTEQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIV 540

Query: 541 APEVSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIY 600
           APEVSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIY
Sbjct: 541 APEVSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIY 600

Query: 601 IPDYTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRR 660
           IPDYTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRR
Sbjct: 601 IPDYTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRR 660

Query: 661 YEIKGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIV 720
           YEIKGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIV
Sbjct: 661 YEIKGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIV 720

Query: 721 GTKRAGILCHAQNEVYEFK 739
           GTKRAGILCHAQNEVYEFK
Sbjct: 721 GTKRAGILCHAQNEVYEFK 739

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  964 bits (2493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/722 (66%), Positives = 547/722 (75%), Gaps = 20/722 (2%)

Query: 25  RKRGRQELRTIRRSAAKKSR----YDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXXXXXX 80
           +KRGRQELRTIRRSA  K      ++S++ +  +                          
Sbjct: 15  KKRGRQELRTIRRSAGAKVSSQEVFNSSIVDDEE-----------QELNESNESEQEEDI 63

Query: 81  XXXXRKGKVYGALLTILETEHPE---PKHKRQPKEKLLKEQVSDSNLNNTGDRXXXXXXX 137
               +K KVYGALLTIL++EHPE    K KR    K  +++ S+   ++  D        
Sbjct: 64  DEEEKKNKVYGALLTILKSEHPELKKKKKKRVDDSKSGEDKGSELASDDGKDDEIDEAQQ 123

Query: 138 XXXXXXXXXNGLXXXXXXXXXXXXXXXXXXVESDDEQDPFESHFNKPTEQFVDKLHAAFE 197
                    +G                   ++S+DEQDPFESHFN+ +E+  D L+ AF 
Sbjct: 124 IEDGLARGSDG--QPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFN 181

Query: 198 SREIKYKATKXXXXXXXXXXXXKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNL 257
           +  +KYK+TK             PTI G+E       S+    SI SYF+KQRL++ N++
Sbjct: 182 TGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDM 241

Query: 258 LNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILK 317
           L+ K DPL PLQKEL+DPMFQY+DIL EY SY KDEDEYRDLYALHALNHVYKTRDRILK
Sbjct: 242 LDSKKDPLGPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTRDRILK 301

Query: 318 NNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFX 377
           +N RLQDN+DTEY DQGFTRPKVLIVVPTRDTAYEV  KII KSGLDQVDKKGKF DQF 
Sbjct: 302 DNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFH 361

Query: 378 XXXXXXXXXXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVE 437
                       FQ IFKGNTNDFFVLG+KFTRKAIKLYSNFYQSDIIVCSPLGMQMIVE
Sbjct: 362 DETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVE 421

Query: 438 NTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWY 497
           NTDKK RQDDFLSSIE+LI+DQLHS+EYQNLAH+FTIFDHLNKIP +QH+ADFSRIRMWY
Sbjct: 422 NTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWY 481

Query: 498 INDQAKLFRQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQI 557
           INDQA+LFRQTM+FTKYV+P        RCRNW GRWKNH+I+ PE S+I +LGLK+KQ 
Sbjct: 482 INDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQT 541

Query: 558 FQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEK 617
           FQRFD+MGGS++DEPDYRFKHF+SVIIPSIVKSTSY DGILIYIPDYTDYVRIRNYLKEK
Sbjct: 542 FQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEK 601

Query: 618 TRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTN 677
           T +LFGDINEYSEQRELNSNRSL QQGRVKVLLYTERLHHYRRYE+KGVKSVVFYKPPTN
Sbjct: 602 TTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTN 661

Query: 678 PEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYE 737
           PEFYNEVVR+IGK+AFLGN DLNISTVRT+YCKLDGLSLERIVG+KRAGILCHAQNEVYE
Sbjct: 662 PEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYE 721

Query: 738 FK 739
           F+
Sbjct: 722 FQ 723

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  951 bits (2458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/717 (65%), Positives = 542/717 (75%), Gaps = 11/717 (1%)

Query: 24  HRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 83
           HRKRGRQE+R I+R+ A+++  D +  E +                              
Sbjct: 16  HRKRGRQEMRKIKRTTARRTE-DVDTNEVDHVAEESVETKAEDAISDAGSESDLDIGDEE 74

Query: 84  XRKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRXXXXXXXXXXXXX 143
            ++ KVY ALLTIL++EHPEPK K+        E V  + +N   D              
Sbjct: 75  EKQEKVYDALLTILKSEHPEPKRKKTKATGENNEAVDQTGVNENTD------SEPVDDQL 128

Query: 144 XXXNGL-XXXXXXXXXXXXXXXXXXVESDDEQDPFESHFNKPTEQFVDKLHAAFESREIK 202
              NGL                   V+S+DEQDPFESHFN+ +E++VD +  AF++  IK
Sbjct: 129 EIENGLLSDQEDDSDDDGDENEQDEVDSEDEQDPFESHFNQVSEKYVDDVSNAFKANNIK 188

Query: 203 YKATKXXXXXXXXXXXXKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKV 262
           YK+ K            KP + G+E    R   S    SI+SYF+KQRLKIQN LL+ K+
Sbjct: 189 YKSVKSPLGDDESCIYSKPVVNGDETPVERPYKS---SSIYSYFLKQRLKIQNGLLDKKI 245

Query: 263 DPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQRL 322
           DPLT LQK+L+DPMFQYKDILYEYDSY KDEDEYRDLY LHALNH+YKTRDRILKNNQRL
Sbjct: 246 DPLTSLQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHALNHIYKTRDRILKNNQRL 305

Query: 323 QDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFXXXXXX 382
           QDN DTE+LDQGFTRPKVLIVVPTRD AY V DKIIKKSG+DQVDKKGKFYDQF      
Sbjct: 306 QDNPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDKIIKKSGIDQVDKKGKFYDQFRDDSLP 365

Query: 383 XXXXXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKK 442
                  FQ IF+GNT+DFFV+GLKFTRKAIKLYSNFYQSDIIVCSPLG+QMI+ENTDKK
Sbjct: 366 PSSKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKK 425

Query: 443 KRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQA 502
           KRQDDFLSSIEL+++DQLHS+EYQN++HIFTIFDH+NKIP +QH+ADFSRIRMWYIN+QA
Sbjct: 426 KRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQA 485

Query: 503 KLFRQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFD 562
           KL RQTMVFTKY+SP        RCRN  GRWKNHK++  E SSIG+LGLKI+QIFQRFD
Sbjct: 486 KLLRQTMVFTKYISPAANSLINGRCRNLAGRWKNHKVIESETSSIGQLGLKIRQIFQRFD 545

Query: 563 IMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILF 622
           I+G SI++EPDYRFK FTSVIIPSIVKST Y+DGILIYIPDYTD++RIRNY+KEKT ILF
Sbjct: 546 IIGNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILF 605

Query: 623 GDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYN 682
           GDINEYS Q++LN+NRSL QQGRVKVLLYTERLHHYRRYEIKGVK+V+FYKPP NPEFYN
Sbjct: 606 GDINEYSSQKQLNANRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVIFYKPPNNPEFYN 665

Query: 683 EVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
           E VR+IGKNAFLGNTDLNISTVR VY KLDGLSLERIVGTKRAG+L HAQ EVYEFK
Sbjct: 666 ETVRYIGKNAFLGNTDLNISTVRCVYSKLDGLSLERIVGTKRAGVLSHAQKEVYEFK 722

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  949 bits (2453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/718 (65%), Positives = 541/718 (75%), Gaps = 14/718 (1%)

Query: 24  HRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 83
           +RKRGRQELR I+RS+A+     +   E  D                             
Sbjct: 16  YRKRGRQELRKIKRSSARTEGGSTETLE--DVAEDIDHRSDEDEVSDVDSGDDFDIEDEE 73

Query: 84  XRKGKVYGALLTILETEHPEPKHKRQPKEKLLKE--QVSDSNLNNTGDRXXXXXXXXXXX 141
            +K KVY ALLTIL++EHPEPK +R+  ++  K   +V +    NT              
Sbjct: 74  GKKEKVYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENT-------EHGPVDD 126

Query: 142 XXXXXNGLXXXXXXXXXXXXXXXXXXVESDDEQDPFESHFNKPTEQFVDKLHAAFESREI 201
                NGL                  ++S+DEQDPFESHFN+  E+FVDKL  AF+++ +
Sbjct: 127 QLEIENGLLGNHEDDNDDDSSGDEKDIDSEDEQDPFESHFNQVPEKFVDKLSNAFKTKSV 186

Query: 202 KYKATKXXXXXXXXXXXXKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPK 261
           KYK+ K            KP + GEE     + S     SI+SYF+KQRLK+QN LL+ K
Sbjct: 187 KYKSVKGSLSDSESYIYAKPVVIGEEA---LVESPYRSSSIYSYFLKQRLKVQNGLLDKK 243

Query: 262 VDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQR 321
            DPLT LQK+L+DPMFQYKDILYEYDSY KDEDEYRDLYALH LNH+YKTRDRILKNNQR
Sbjct: 244 TDPLTALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRILKNNQR 303

Query: 322 LQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFXXXXX 381
           LQDN DTE+LDQGFTRPKVLIVVPTR+ AY V DKII KSG+DQVDKKGKFYDQF     
Sbjct: 304 LQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSL 363

Query: 382 XXXXXXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDK 441
                   FQ IF+GNTNDFFV+GLKFTRKAIKLYSNFYQSDIIVCSPLG+QMI+ENTDK
Sbjct: 364 PPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDK 423

Query: 442 KKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQ 501
           KKRQDDFLSSIEL+++DQLHS+EYQN++HIFTIFDHLNKIP +QH+ADFSRIRMWYIN+Q
Sbjct: 424 KKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQ 483

Query: 502 AKLFRQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRF 561
           AKLFRQTMVFTKY+SP        RCRN  GRWKNHK++  E SSIG+ GLKI+QIFQRF
Sbjct: 484 AKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRF 543

Query: 562 DIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRIL 621
           DI+G SI++EPDYRFK FTSVIIP IVKST Y+DGILIYIPDYTD++RIRNY+KEKT IL
Sbjct: 544 DIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTIL 603

Query: 622 FGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFY 681
           FGDINEYS QR+LN+NRSL QQGR+KV+LYTERLHHYRRYEIKGVKSVVFYKPP NPEFY
Sbjct: 604 FGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFY 663

Query: 682 NEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
           NEVVRFIGKNAFLGNTDLNISTVR +Y KLDGLSLERIVGTKRA +L HAQ E+YEFK
Sbjct: 664 NEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  933 bits (2411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/718 (64%), Positives = 541/718 (75%), Gaps = 11/718 (1%)

Query: 24  HRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 83
           +RKRGRQELR I+RS+ ++++ D +V E +                              
Sbjct: 16  YRKRGRQELRKIKRSSVRRTK-DESVNEVDHVADEIVHSTGEDKISDIGSEEDNLDVEDE 74

Query: 84  X-RKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRXXXXXXXXXXXX 142
             +K KVY ALLTIL++EHPEPK +     K   ++ + +     G+             
Sbjct: 75  EGKKEKVYDALLTILKSEHPEPKRR-----KTQADEDNKAAAKPAGNENVNVEYEPVDEQ 129

Query: 143 XXXXNGLX-XXXXXXXXXXXXXXXXXVESDDEQDPFESHFNKPTEQFVDKLHAAFESREI 201
               NGL                   ++S+DEQDPFESHFN+ +E++VD L  AF+S+ I
Sbjct: 130 LEIENGLLGDREDDNDDDSNENEKDDMDSEDEQDPFESHFNQVSEKYVDDLSNAFKSKSI 189

Query: 202 KYKATKXXXXXXXXXXXXKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPK 261
           KYK+ K            KP + GEE     + S     SI+SYF+KQRLK+QN LL+ K
Sbjct: 190 KYKSVKASLGDDESYIYAKPFMVGEEA---LVESPYRSSSIYSYFLKQRLKVQNGLLDKK 246

Query: 262 VDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQR 321
           +DPLT +QK+L+DPMFQYKDILYEYDSY KDE EYRDLYALH LNH+YKTRDRILKNNQR
Sbjct: 247 IDPLTCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLNHIYKTRDRILKNNQR 306

Query: 322 LQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFXXXXX 381
           LQDN DTE+LDQGFTRPKVLIVVPTR+ AY V DKII KSG+DQVDKKGKFYDQF     
Sbjct: 307 LQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSL 366

Query: 382 XXXXXXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDK 441
                   FQ IFKGNT+DFFV+GLKFTRKAIKLYSNFYQSDII+CSPLG+QMI+ENTDK
Sbjct: 367 PPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDK 426

Query: 442 KKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQ 501
           KKRQDDFLSSIEL+++DQLHS+EYQN++HIFTIFDH+NKIP +QH+ADFSRIRMWYIN+Q
Sbjct: 427 KKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQ 486

Query: 502 AKLFRQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRF 561
           AKLFRQTMVFTKY+SP        RC N  GRWKNHK++  E SSIG+LGLK++QIFQRF
Sbjct: 487 AKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVRQIFQRF 546

Query: 562 DIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRIL 621
           DI+G SI++EPDYRFK FTSVIIPSIVKS  Y+DGIL+YIPDYTD++RIRNY+KEKT IL
Sbjct: 547 DIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMKEKTTIL 606

Query: 622 FGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFY 681
           FGDINEYS QR+LN+NRSL QQGR+KV+LYTERLHHYRRYEIKGVKSVVFYKPP NPEFY
Sbjct: 607 FGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFY 666

Query: 682 NEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
           NE VRFIGKNAFLGNTDLNISTVR +Y KLDGLSLERIVGTKRA +L HAQ EVYEFK
Sbjct: 667 NETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEVYEFK 724

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/718 (64%), Positives = 535/718 (74%), Gaps = 13/718 (1%)

Query: 24  HRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 83
           HRKRGRQELR I+RS+ +++  D +  + +                              
Sbjct: 16  HRKRGRQELRKIKRSSGRRTE-DVDADKIDYVAEEPVGRNDNDAVSDVGSEDDLDVGDED 74

Query: 84  XRKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRXXXXXXXXXXXXX 143
            +K KVY ALLTIL++EHPEPK     + K   E+ SD    + G+              
Sbjct: 75  EKKKKVYDALLTILKSEHPEPK-----RMKTKAEESSDRTTQSDGNENAESEPVDDQLEI 129

Query: 144 XXXNGL--XXXXXXXXXXXXXXXXXXVESDDEQDPFESHFNKPTEQFVDKLHAAFESREI 201
              NGL                    V+S+DEQDPFESHFN+  E+ VD L  AF+S+ I
Sbjct: 130 E--NGLLGDREDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNI 187

Query: 202 KYKATKXXXXXXXXXXXXKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPK 261
           +YK+ K            +P + GEE   + + S     SI+SYF+KQRLKIQN L + K
Sbjct: 188 RYKSVKAPLNGDESYIYAQPVVVGEE---SSVESPYKSSSIYSYFLKQRLKIQNGLQDKK 244

Query: 262 VDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQR 321
           +DPL  LQ++L+DPMFQYKDILYEYDSY KDEDEYRDLY LH LNH+YKTRDRILKNNQR
Sbjct: 245 IDPLNALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILKNNQR 304

Query: 322 LQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFXXXXX 381
           LQDN DTE+LDQGFTRPKVLIVVPTRD AY V DKII KSG+DQVDKKGKFYDQF     
Sbjct: 305 LQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSL 364

Query: 382 XXXXXXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDK 441
                   FQ IFKGNTNDFFV+GLKFTRKAIKLYSNFYQSDIIVCSPLG+QMI+ENTDK
Sbjct: 365 PPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDK 424

Query: 442 KKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQ 501
           KKRQDDFLSSIE++++DQLHS+EYQN++HI TIFDHLNKIP +QH+ADFSRIRMWYIN+Q
Sbjct: 425 KKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQ 484

Query: 502 AKLFRQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRF 561
           AK FRQTMVFTKY+SP        RCRN  GRWKNH+ + PE SSIG+LGLKI+QIFQRF
Sbjct: 485 AKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRF 544

Query: 562 DIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRIL 621
           D +G SIV+EPDYRFK FTSV+IPSIVKST Y+DGILIYIPDYTD++RIRNY+KEKT IL
Sbjct: 545 DTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTIL 604

Query: 622 FGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFY 681
           FGDINEYS QR+LN+NRSL QQGR+KV+LYTERLHHYRRY+IKGVKSV+FYKPP NPEFY
Sbjct: 605 FGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFY 664

Query: 682 NEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
           +E VRFIGKNAF GNTDLNISTVR +Y KLDG+SLERIVGTKRA +L HAQ EVYEFK
Sbjct: 665 SETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  905 bits (2338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/725 (63%), Positives = 538/725 (74%), Gaps = 15/725 (2%)

Query: 22  DHHRKRGRQELRTIRRSAAKKSR-----YDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXX 76
           D  RKRGR+ELR IRR+  +K R      +      N                       
Sbjct: 12  DGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANGDDVGDEVGD 71

Query: 77  XXXXXXXXRKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRXXXXXX 136
                    K +VYGALLTIL++EHPEPK +++ K   +        L+N          
Sbjct: 72  EASDDEEEMKKQVYGALLTILKSEHPEPKKQKKEKVNKVL-------LDNEQQDESDASE 124

Query: 137 XXXXXXXXXXNGLXXX-XXXXXXXXXXXXXXXVESDDE-QDPFESHFNKPTEQFVDKLHA 194
                     N L                    E  DE QDPFE+HFN   E+F DKL  
Sbjct: 125 EEEDETQQIENALMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDV 184

Query: 195 AFESREIKYKATKXXXXXXXXXXXXKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQ 254
           +F++ +IKYK+TK            KP I  +E+E+  +  S +  SI SYF+KQRLK+Q
Sbjct: 185 SFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDEIES-PVELSVNKSSIHSYFLKQRLKMQ 243

Query: 255 NNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDR 314
           NNL++PKVDPLTPLQK+L+DPMFQYKDILY+YDSYGKDEDEYRDLY+LH LNH+YKTRD+
Sbjct: 244 NNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDK 303

Query: 315 ILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYD 374
           ILKNNQRLQDN DTE LDQGFTRPKVLIVVPTRDTAY+V +KII KSG+DQVDKKGKF D
Sbjct: 304 ILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKD 363

Query: 375 QFXXXXXXXXXXXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQM 434
           QF             FQ IFKGNTNDFFVLG+KFTRKAIKLYSNFYQSDII+CSPLG+QM
Sbjct: 364 QFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQM 423

Query: 435 IVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIR 494
           I+ENTDKKKRQDDFLSSIEL+I+DQLHS+EYQN++H+FTI +H+NKIP EQHDADFSR+R
Sbjct: 424 ILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVR 483

Query: 495 MWYINDQAKLFRQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKI 554
           MWYINDQAKLFRQTM+FTKY+SP        +C+NW GRWKNHK+++   SSI K+G+KI
Sbjct: 484 MWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKI 543

Query: 555 KQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYL 614
           +QIFQRF+ + GS+VDEPDYRFK FTSV +P+IVK+T Y+DG LIYIP+YTDY+R+RNYL
Sbjct: 544 RQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYL 603

Query: 615 KEKTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKP 674
           K+KT ILFGDINEYS+Q++LNSNRSL QQGRVKVLLYTERLHHYRRYEIKGVK+VVFY+P
Sbjct: 604 KDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQP 663

Query: 675 PTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNE 734
           P NPEFY EVVR+IGKNAFLGNTDLNISTVR +Y KLD LSLE IVG+KRAG+LCHAQNE
Sbjct: 664 PKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNE 723

Query: 735 VYEFK 739
           VYEFK
Sbjct: 724 VYEFK 728

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/723 (61%), Positives = 525/723 (72%), Gaps = 17/723 (2%)

Query: 26  KRGRQELRTIRRSAAKKSRYDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXR 85
           KRGR+ELR ++R+  + +  D                                      R
Sbjct: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSDSDAEAR 66

Query: 86  KGKVYGALLTILETEHPEPKHKRQPKE----KLLKEQVSDSNLNNTGDRXXXXXXXXXXX 141
           KGKVYGALLTIL++EHPE K ++  K     ++ K  V D N     +            
Sbjct: 67  KGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHEELEEENEEEQIDNAI- 125

Query: 142 XXXXXNGLXXXXXXXXXXXXXXXXXXVESDDEQDPFESHFNKPTEQFVDKLHAAFESREI 201
                  L                   +S+DEQDPFESHFN+  E  ++ L AAF+S+++
Sbjct: 126 -------LDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQL 178

Query: 202 KYKATKXXXXXXXXXXX-----XKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNN 256
           +Y++ K                 +PT+ G +  + +L  S    SI SYF+K+RLKIQN+
Sbjct: 179 QYRSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQND 238

Query: 257 LLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRIL 316
           LL  K D L  +QKEL+DPMFQYKDILYEY++YGK EDEYR LYALHALNHVYKTRDRIL
Sbjct: 239 LLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRIL 298

Query: 317 KNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQF 376
           KNNQRLQ+N+DTE LDQGFTRPKVLI+ PTRDTAY +   II KSG+DQVDK+GKF DQF
Sbjct: 299 KNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQF 358

Query: 377 XXXXXXXXXXXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIV 436
                        FQ IFKGNTNDFFVLG+KFTRKAIKLYSNFYQSDIIVCSPLG+QMIV
Sbjct: 359 YEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIV 418

Query: 437 ENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMW 496
           ENTDKKKRQDDFLSSIE+ I+DQLHS+EYQN++H++TIF+HLN IP EQHDADFSRIRMW
Sbjct: 419 ENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMW 478

Query: 497 YINDQAKLFRQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQ 556
           YINDQA+ FRQTMVFTKY+SP        +CRNW GRWKNH+IV+ E S IGKL L+++Q
Sbjct: 479 YINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQ 538

Query: 557 IFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKE 616
           IFQRF++ GGSIVDEPDYRFK FTSVIIP I+KST Y+DGILIYIP+YTDYVR+RNYLKE
Sbjct: 539 IFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKE 598

Query: 617 KTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPT 676
           KTRILFGDINEYS Q++L +NRSL QQGR+KVLLYTERLHHYRRYEIKGVKSV+FYKPP+
Sbjct: 599 KTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPS 658

Query: 677 NPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVY 736
           +PEFY EVVR IG+NAFLGNTDLNISTVR +Y KLD L+LE +VGT+RAG+LCH QNE+Y
Sbjct: 659 DPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIY 718

Query: 737 EFK 739
           EFK
Sbjct: 719 EFK 721

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  868 bits (2242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/655 (63%), Positives = 504/655 (76%), Gaps = 7/655 (1%)

Query: 85  RKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRXXXXXXXXXXXXXX 144
           +K +VY AL+TIL++EH EPK +    E   +E ++D +L+                   
Sbjct: 72  KKKQVYDALVTILKSEHKEPKMRDNLNETSKEEHLTDEDLD-----EDEKFETEEQEIEN 126

Query: 145 XXNGLXXXXXXXXXXXXXXXXXXVESDDEQDPFESHFNKPTEQFVDKLHAAFESREIKYK 204
               +                   ESD++ DPF+SHFN+PTEQF +K   AF++++IKY+
Sbjct: 127 NLLSIKDDEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFTNKFADAFKNKQIKYR 186

Query: 205 ATKXXXXXXXXXXXXKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVDP 264
           + K            +P I   E E  ++ S     SI SY +K+RLKI N+LL+P V+ 
Sbjct: 187 SIKYKINEYESSIYSEPRIL--EDEQTKVKSPVLKSSIHSYALKKRLKINNDLLDPAVNN 244

Query: 265 LTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQD 324
           LT +QKEL+DPMFQYKDILYEY +YGKDE+EYR LY LH LNH+YKTRDRILKNN ++QD
Sbjct: 245 LTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNSKVQD 304

Query: 325 NTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFXXXXXXXX 384
           N D E+LDQGFTRPKVLIV PTRD  Y + ++IIKKSG+DQ+DKK KF DQF        
Sbjct: 305 NPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEESLLPA 364

Query: 385 XXXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKKR 444
                FQ +FKGN+ND+FVLG+KFTRKAIKLYSNFYQSDIIVCSPLG+ MI+ENTDKKKR
Sbjct: 365 SKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTDKKKR 424

Query: 445 QDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAKL 504
           QDDFLSSIEL+I+DQLHS+E+QN++H+ +IF+H+NKIP EQHD DFSRI+MWYINDQAKL
Sbjct: 425 QDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYINDQAKL 484

Query: 505 FRQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDIM 564
           FRQTM+FTKY+SP        +C+NW GRWKNHK++ P  SSIG+LGL++KQ+F RFDI+
Sbjct: 485 FRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHRFDII 544

Query: 565 GGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILFGD 624
           GGSIVDEPDYRFK+FTSVI+ SI KSTSY+DG+LIYI DYTDYVR+RNYLKEKT ILFGD
Sbjct: 545 GGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTILFGD 604

Query: 625 INEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYNEV 684
           INEYS+Q+++NSNR+L QQ RVKVLLYTERLHH+RRYEIKGVK++VFYK PTNPEFYNEV
Sbjct: 605 INEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEFYNEV 664

Query: 685 VRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
           VR+IGKNAF GNTD+NIS VRT+Y KLDGL+LERI+GTKRA +L H QNE YEFK
Sbjct: 665 VRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/723 (59%), Positives = 521/723 (72%), Gaps = 33/723 (4%)

Query: 25  RKRGRQELRTIRRSAAKKSRYDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 84
           +K GR+ELRTI R+ A+ +    N ++ +                               
Sbjct: 21  KKTGRKELRTITRANARHA----NESKDDFENEPDMSSEEEELADNKPRSDEEEEEDIET 76

Query: 85  RKGKVYGALLTILETEHPEPKHKR-----QPKEKLLKEQV---SDSNLNNTGDRXXXXXX 136
           +K KVY ALLT+LE+EHP  K K+     + K+  L+E V   SD +     +       
Sbjct: 77  KKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDEDEEEAIENALVETN 136

Query: 137 XXXXXXXXXXNGLXXXXXXXXXXXXXXXXXXVESDDEQDPFESHFNKPTEQFVDKLHAAF 196
                     NG                    + +D+ D FE HFN  +E    KL +AF
Sbjct: 137 DDEDDVGSDING------------------DEDDEDKADSFELHFNNVSELQATKLASAF 178

Query: 197 ESREIKYKATKXXXXXXXXXXXXKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNN 256
             ++I+YK+ K            +PT+ GE+  +    S K  +S+ SYFIKQ+LKIQNN
Sbjct: 179 RDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCK--KSLHSYFIKQKLKIQNN 236

Query: 257 LLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRIL 316
           LL+ K + L PLQK L+DPMFQY+D+LYEY SY + E+EYRDLYALH LNHVYKTRDRIL
Sbjct: 237 LLDDKKEALAPLQKNLVDPMFQYQDLLYEYRSY-EQEEEYRDLYALHVLNHVYKTRDRIL 295

Query: 317 KNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQF 376
           +N+Q+LQDN+D E LDQGFTRPKVLIVVPTRD AY++  KII+KSGLDQVDK+GKF DQF
Sbjct: 296 RNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQF 355

Query: 377 XXXXXXXXXXXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIV 436
                        F+ IFKGNTNDFFVLG KFTRK +KLYSNFYQSD+I CSPLG+Q+I+
Sbjct: 356 FDASLPPSSKPKSFKHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLIL 415

Query: 437 ENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMW 496
           ENTDKKKRQDDFLSSIEL+++DQLHS+EYQNL+HI TIF H+NKIP +QHDADFSRIRMW
Sbjct: 416 ENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMW 475

Query: 497 YINDQAKLFRQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQ 556
           YIN+QA LFRQTMVFTKY SP        +CRN  GRWKNH IV PE SSI +LGLK++Q
Sbjct: 476 YINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQ 535

Query: 557 IFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKE 616
           IFQRFD++GGS +DEPDYRFK FTSVII SI+KST Y+DGIL+YIPDYTDYVR+RN+L+E
Sbjct: 536 IFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLRE 595

Query: 617 KTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPT 676
           KT +LFGDINEYSEQ++L SNR+L QQG+VKVLLYTERLHH+RRYEIKGVKSV+FYKPPT
Sbjct: 596 KTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPT 655

Query: 677 NPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVY 736
           NPEFY EVVR+IGK+AFLG+ DLNISTVR VYCKLDGLSLER+VGTKRA +L H QNE+Y
Sbjct: 656 NPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIY 715

Query: 737 EFK 739
           EFK
Sbjct: 716 EFK 718

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/714 (60%), Positives = 511/714 (71%), Gaps = 21/714 (2%)

Query: 26  KRGRQELRTIRRSAAKKSRYDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXR 85
           KRGR+ELR+IRR    K+  +    EH +                              R
Sbjct: 18  KRGRKELRSIRRPQRNKAHEEP---EHLNESSEGEVKNHHNGMQHNEEIANVEEDEENKR 74

Query: 86  KGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRXXXXXXXXXXXXXXX 145
           + KVYGALLTIL +EHP+PK K   +E  ++ +  DS  +   D                
Sbjct: 75  R-KVYGALLTILNSEHPKPKPK---QEVTVQSRKEDSESDVEEDERDEVEQLEDNLARVD 130

Query: 146 XNGLXXXXXXXXXXXXXXXXXXVESDDEQDPFESHFNKPTEQFVDKLHAAFESREIKYKA 205
            N                     ESDDEQD F+SHFN+  E  VDKL AAF+ R++KYK+
Sbjct: 131 ENP---------SEDDLSEDADEESDDEQDTFDSHFNQVPENVVDKLDAAFKERQLKYKS 181

Query: 206 TKXXXXXXXXXXXXKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVDPL 265
            K            KP +   E ++ +L      +S+ SY  KQRLKIQN+L +   + L
Sbjct: 182 AKVPIGENESMVYSKPLLL--EDQSKKLEIPSRHESLKSYVFKQRLKIQNDLEH---ENL 236

Query: 266 TPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQDN 325
           T  Q+ L+DPM QY D+LYEY+SY KDEDEYRDLYALH LNHVYKTRD+ILKNNQR+ DN
Sbjct: 237 TSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDN 296

Query: 326 TDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFXXXXXXXXX 385
            D +YLDQGFTRPKVLIVVPTRDTAY+V +KII KSG+DQ+DKKGKF DQF         
Sbjct: 297 PDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLPPSS 356

Query: 386 XXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKKRQ 445
               FQ +FKGNTNDFFVLG+KFTRKAIKLYSNFYQSDII+CSPLG+Q+I+ENTDKKKRQ
Sbjct: 357 KPKSFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQ 416

Query: 446 DDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAKLF 505
           DDFLSSIE+ I DQLHS+EYQN++H+ TIFDHLN IP EQHD DF R+R+WYIN+QAKLF
Sbjct: 417 DDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLF 476

Query: 506 RQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDIMG 565
           RQTM+FTKYVSP        +C+N  GRWKNH  + P  SSIGKLGLK++QIFQR D+  
Sbjct: 477 RQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGA 536

Query: 566 GSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILFGDI 625
            SI++E D+RFK FTSVIIPSI+KST Y+DGIL+YIPDY D++R+RNY+KEKT I+FGDI
Sbjct: 537 ASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDI 596

Query: 626 NEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYNEVV 685
           NEYS Q++LNSNR+L QQGR KVLLYTERLHH+RRYEIKGVKSVVFY+PPTNPEFY+EVV
Sbjct: 597 NEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVV 656

Query: 686 RFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
           RFI K+A LG TDLNISTVRT+Y KLDG+SLERIVGTKRA IL H QNEVYEFK
Sbjct: 657 RFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/577 (67%), Positives = 468/577 (81%), Gaps = 5/577 (0%)

Query: 168 VESDDEQ-DPFESHFN-KPTEQFVDKLHAAFESREIKYKATKXXXXXXXXXXXXKPTIFG 225
           +ESDDE+ DPF++HFN +   +  + L  A +  +++YK+ K            +  IF 
Sbjct: 124 IESDDEEKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFS 183

Query: 226 E---ELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPMFQYKDI 282
               E ET ++   K   S+ SYF+K+RL+IQNNLL+ + + LT LQ++++DPM QYKDI
Sbjct: 184 VPYIEGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDI 243

Query: 283 LYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLI 342
           LYEYD+YGKDEDEYRDLY LH LNHVYKTRD+I+KNNQ+LQDN D+E+LDQGFTRPKVLI
Sbjct: 244 LYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLI 303

Query: 343 VVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFXXXXXXXXXXXXXFQQIFKGNTNDFF 402
           + PTRD+AY++  K+I+KSGLDQVDKKGKF DQF             FQ IFKGNTND+F
Sbjct: 304 IAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGNTNDYF 363

Query: 403 VLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHS 462
           VLG+KFTRKAIKLYSNFYQSDIIVCSPLG+QMIVENTDKKKRQDDFLSS+E+ I+DQ HS
Sbjct: 364 VLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHS 423

Query: 463 LEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSPXXXXX 522
           +EYQN  H+FTIFDHLNKIP EQHDADFSRIRMWYINDQAK FRQTM+FTKY+SP     
Sbjct: 424 IEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSL 483

Query: 523 XXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSV 582
              +CRN EGRWKNHKIV+ E SS+G +GLK++QIFQRF+++G S+ DEPDYRFK FTSV
Sbjct: 484 LNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSV 543

Query: 583 IIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQ 642
           +I +I KST YDDG LIYIP+Y+DYVR+RNY+KEKT ILFGDINEYSEQR L SNR+L  
Sbjct: 544 VISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFN 603

Query: 643 QGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNIS 702
           QGR+KVLLYTERLHH+RRYE+KGVK+VVFYKPP++PEFY EVVR+IGK  FLG+ DLNIS
Sbjct: 604 QGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNIS 663

Query: 703 TVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
           TVR  Y KLDGL+LE+IVGTKR G+L H QNE YEFK
Sbjct: 664 TVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/714 (57%), Positives = 507/714 (71%), Gaps = 18/714 (2%)

Query: 26  KRGRQELRTIRRSAAKKSRYDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXR 85
           K GR++LR I R+  K+ RYD   T  + T                              
Sbjct: 9   KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVEQ------H 62

Query: 86  KGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRXXXXXXXXXXXXXXX 145
           +G+ Y ALLT+L++EHPE KHK   K K   ++  + +  N G                 
Sbjct: 63  RGQAYNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSEDEQQNIENALDDV 122

Query: 146 XNGLXXXXXXXXXXXXXXXXXXVESDDEQDPFESHFNKPTEQFVDKLHAAFESREIKYKA 205
             G+                   ES+DE DPFESHF+K +E  +      F+ + +KYK+
Sbjct: 123 SGGVVDEEDMEDSLSDVD-----ESEDESDPFESHFSKYSESRLYAFDKGFKDKTVKYKS 177

Query: 206 TKXXXXXXXXXXXXKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVDPL 265
           +K            KP +  EE+        K  Q++ SYFIKQ+LK+ N+  N  + PL
Sbjct: 178 SKTDVSEEESLIYSKPCLDDEEV-----LPVKGKQTLSSYFIKQKLKLANDFQNNGL-PL 231

Query: 266 TPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQDN 325
           T +QKEL+DPMFQYKD+LYEYD Y  DED+YRDLY+LHALNHVYKTRDRILKNNQ+LQ+N
Sbjct: 232 TEIQKELVDPMFQYKDMLYEYDDYA-DEDQYRDLYSLHALNHVYKTRDRILKNNQKLQEN 290

Query: 326 TDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFXXXXXXXXX 385
            D E LDQGFTRPKVLIVVPTRD A+++  KI++KSGLDQ DKK KF DQF         
Sbjct: 291 NDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTS 350

Query: 386 XXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKKRQ 445
               FQ IF+GNTNDFFVLGLKFTRK++K+YSNFYQSDII+CSPLG+Q+I+ENTDKKKRQ
Sbjct: 351 KPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQ 410

Query: 446 DDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAKLF 505
           DDFLSSIE++I+DQLHS+EYQN  H+ TIF H+NKIP +Q +ADFSRIRMWYIN+QAK F
Sbjct: 411 DDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFF 470

Query: 506 RQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDIMG 565
           RQT+VFTKY+SP        +CRN  GRWKNH+ + PE SSIG+LGLK++QIFQRFD+ G
Sbjct: 471 RQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAG 530

Query: 566 GSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILFGDI 625
           G+ +DEPDYRFK FTSVI+PSIVKST Y+DGIL+YIPDYTD++R+RNYLKEKT I+FG+I
Sbjct: 531 GTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEI 590

Query: 626 NEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYNEVV 685
           NEYS Q++L SNR+  Q G+VKVLLYTERLHH+RRYEIK VKSV+FYKPP NPEFY+EVV
Sbjct: 591 NEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVV 650

Query: 686 RFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
           R IGKN FLGN D+NISTVR +Y K+DGLSLER+VG+KRA +L H QNEVYEFK
Sbjct: 651 RNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/570 (67%), Positives = 470/570 (82%), Gaps = 6/570 (1%)

Query: 172 DEQDPFESHFNKPTEQFVDKLHAAFESREIKYKATKXXXXXXXXXXXXKPTIFGEELET- 230
           D+ D FESHFN  ++  VD + A F+ ++IKYK+ K            KP +  ++ ET 
Sbjct: 139 DQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDETI 198

Query: 231 -NRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDSY 289
            N + +S +     SYFIKQRLKIQN+LL+   + LTPL+K+LLDPMFQYKD+L EY +Y
Sbjct: 199 DNPVLTSSYD----SYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNY 254

Query: 290 GKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDT 349
             DE EYR+LY+LH LNH+YKTRD+ILK+NQRLQ+N D E LDQGFTRPKVLIVVPTRDT
Sbjct: 255 ENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDT 314

Query: 350 AYEVTDKIIKKSGLDQVDKKGKFYDQFXXXXXXXXXXXXXFQQIFKGNTNDFFVLGLKFT 409
           AY+V + II+KSGLDQ+DKKGKF DQF             F+ +FKGNTNDFFVLG+KFT
Sbjct: 315 AYQVVETIIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFKGNTNDFFVLGMKFT 374

Query: 410 RKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLA 469
           RKAIKLYSNFYQSDII+CSPLG+QMI+ENTDKKKRQDDFLSSIE++IVDQLHS+EYQN++
Sbjct: 375 RKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNIS 434

Query: 470 HIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSPXXXXXXXXRCRN 529
           H++TI +H+NKIP +Q +ADFSRIRMWYINDQAK  RQTM+FT+Y+SP        +C N
Sbjct: 435 HVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANAIINGKCHN 494

Query: 530 WEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVK 589
             GRWKN++I++ E SSIG+LG+KIKQIFQRFD++GG++VDE DYRFK+FTSV++ +IVK
Sbjct: 495 MAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVK 554

Query: 590 STSYDDGILIYIPDYTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQQGRVKVL 649
           ST Y+DGIL+YIP+YTDY+R+RNY+KEKT ILF +INEYS Q++L+SNRS+ QQGR KVL
Sbjct: 555 STGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVL 614

Query: 650 LYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYC 709
           LYTERLHHYRRYE+KG+KSV+FYKPPTNPEFYNEV+RF  KNAFLG +D+NIST+RTVY 
Sbjct: 615 LYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYS 674

Query: 710 KLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
           KLDGL+L+RIVG+KRA ILCH QNE Y+FK
Sbjct: 675 KLDGLALQRIVGSKRAAILCHGQNESYDFK 704

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 42/85 (49%), Gaps = 8/85 (9%)

Query: 25  RKRGRQELRTIRR-SAAKKSRYDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 83
           +KRGR ELR+IRR + ++ S++D  V   ++                             
Sbjct: 12  KKRGRTELRSIRRPNRSQHSKHDQQVVHESENEDSLESSSDDDEDIAQAEAENSD----- 66

Query: 84  XRKGKVYGALLTILETEHPE-PKHK 107
            RK KVYGALLTIL +EHPE  KHK
Sbjct: 67  -RKEKVYGALLTILNSEHPERKKHK 90

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/571 (66%), Positives = 466/571 (81%), Gaps = 4/571 (0%)

Query: 169 ESDDEQDPFESHFNKPTEQFVDKLHAAFESREIKYKATKXXXXXXXXXXXXKPTIFGEEL 228
           E +D+ D  E HFN  +E+  + L AAF+++E++Y++ K            +PT+  E  
Sbjct: 181 EEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEP- 239

Query: 229 ETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDS 288
             + +S+    QS+ SYFIKQRLKIQN+LL+ + D LTPLQK+++DPMFQY+D+LYEY+ 
Sbjct: 240 -ASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQDLLYEYED 297

Query: 289 YGKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRD 348
           Y K E EYRDLYALH LNH+YKTRDRILKNNQRLQ+N D E LDQGFTRPKVLIV PTRD
Sbjct: 298 YDK-ETEYRDLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRD 356

Query: 349 TAYEVTDKIIKKSGLDQVDKKGKFYDQFXXXXXXXXXXXXXFQQIFKGNTNDFFVLGLKF 408
            AY++  KII+KSGLDQVDKK KF DQF             FQQ+FKGNTNDFFVLG KF
Sbjct: 357 AAYDILSKIIQKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKF 416

Query: 409 TRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNL 468
           TRK IKLYSNFYQSDII+CSPLG+Q+I+ENTDKKKRQDDFLSSIELL+VDQLHS+E+QN+
Sbjct: 417 TRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNM 476

Query: 469 AHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSPXXXXXXXXRCR 528
            H+ +IF+H+NKIP +QHDADFSRI+MWYINDQAKLFRQT++FTK+ SP        +CR
Sbjct: 477 LHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCR 536

Query: 529 NWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIV 588
           N+ GRWKNH+++ PE SS+G+LG++ + IFQRFD++G S+ +EPD RFKHF SVI+P+IV
Sbjct: 537 NYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIV 596

Query: 589 KSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQQGRVKV 648
           KST Y+DGIL+YIPDYTD+VR+RNYL+EKT ILFGDINEYSEQR+L SNR++ QQGRVKV
Sbjct: 597 KSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKV 656

Query: 649 LLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVY 708
           LLYTERLHH+RRYEIKGVK+V+FYKPPTNPEF+ EV R++GK+AFLG  DLNIS VR ++
Sbjct: 657 LLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLF 716

Query: 709 CKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
            KLDGLSLERIVGT+RA +L H  NE YEFK
Sbjct: 717 SKLDGLSLERIVGTERAAVLTHGPNETYEFK 747

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/720 (56%), Positives = 502/720 (69%), Gaps = 19/720 (2%)

Query: 26  KRGRQELRTIRRSAAKKSRYDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXR 85
           K GR++LR+IR    K SRYDS   E                                  
Sbjct: 21  KGGRKQLRSIR----KASRYDSKKPEDEPVETPEEEINEVEDVHEERTEVSRKQES---- 72

Query: 86  KGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRXXXXXXXXXXXXXXX 145
            G+ Y ALLT+L+ EH   K K +   +      S  +  +                   
Sbjct: 73  NGEAYAALLTLLKAEHGTGKKKVKAGPQGEGSGESQISEISPEAEQDEEEEEEEEEETAI 132

Query: 146 XNGLXXXXXXXXXXXXXXXXXXVESDDEQD-----PFESHFNKPTEQFVDKLHAAFESRE 200
            NGL                   +++ +QD     P E+HFN   E+  D L  AF++++
Sbjct: 133 ENGLAEHLDSDGDEAAEIGDEEDDNNGDQDENASDPLEAHFNSVPEKDTDALDQAFKTKQ 192

Query: 201 IKYKATKXXXXXXXXXXXXKPTIFGEELETNRLSSSKHG-QSIFSYFIKQRLKIQNNLLN 259
           ++Y+++K            +P +    LE+        G QS+  YFIKQRLKIQN+LL+
Sbjct: 193 VRYRSSKIKISKNEEFIYSRPDL---NLESRTPIQVPQGTQSLSPYFIKQRLKIQNDLLD 249

Query: 260 PKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNN 319
            K + LTPLQK+++DP+FQY+D+LYEY++Y + E EYRDLYALHAL+H+YKTRDRILKNN
Sbjct: 250 SK-NNLTPLQKKIVDPIFQYQDLLYEYENYDQ-ETEYRDLYALHALDHIYKTRDRILKNN 307

Query: 320 QRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFXXX 379
           QRLQDN D E LDQGFTRPKVLIVVPTRD AY V  KII+KSGLDQVDKK KF DQF   
Sbjct: 308 QRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKSGLDQVDKKSKFRDQFYQD 367

Query: 380 XXXXXXXXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENT 439
                     FQQ+FKGNTNDFFVLG KFTRK IKLYSNFYQSDIIVCSPLG+Q+I+ENT
Sbjct: 368 SLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQSDIIVCSPLGIQLILENT 427

Query: 440 DKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYIN 499
           DKKKRQDDFLSSIELL++DQLHS+E+QN+ H+ +IF+H+NKIP +QHDADFSRI+MWYIN
Sbjct: 428 DKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINKIPQQQHDADFSRIKMWYIN 487

Query: 500 DQAKLFRQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQ 559
           DQAKLFRQT++FT++ +P        +CRN+ GRWKNH IV  E SS+ +LG++ + +FQ
Sbjct: 488 DQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAEKSSLSQLGMRTRLVFQ 547

Query: 560 RFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTR 619
           RFD+ GG+  DEPD+RFKHF SVI+P+IV+ST Y+DGIL+YIPDYTD++R+RNYL+EKT 
Sbjct: 548 RFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIPDYTDFIRVRNYLREKTT 607

Query: 620 ILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPE 679
           ILFGDI+EYSEQR+L +NR+L QQGRVKVLLYTERLHH+RRYEIKGVK+V+FYKPPTNPE
Sbjct: 608 ILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPE 667

Query: 680 FYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
           F+ E VR++ K+AFLG  DLNIS VR +Y KLDGL+LERIVGT+RA IL H  NE YEFK
Sbjct: 668 FFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIVGTERAAILTHGPNETYEFK 727

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/656 (59%), Positives = 482/656 (73%), Gaps = 8/656 (1%)

Query: 85  RKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRXXXXXXXXXXXXXX 144
           R   VYGALL+IL + HPE + KR   EK     V +      G R              
Sbjct: 60  RTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEE---RKNGSRNYETDEVATISASL 116

Query: 145 XXNGLXXXXXXXXXXXXXXXXXXVESDDEQDPFESHFNKPTEQFVDKLHAAFESREIKYK 204
             +                     +S+DE+DPFE HFN+ +E   +KL AAF+ + ++Y+
Sbjct: 117 DDSVDKDEEVEEDDGVYSDGE---DSEDERDPFEYHFNQISEMDTNKLDAAFKEKTVQYE 173

Query: 205 ATKXXXXXXXXXXX-XKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVD 263
           +TK             KP I G +       +     +I SYF+K++LK+ N LL+ K  
Sbjct: 174 STKLPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLLDDKKK 233

Query: 264 PLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQ 323
           PLTPL K L+DP+FQY+D+L+EY+ + + E EYRDLY LH LNH+YKTRDRILKNN +LQ
Sbjct: 234 PLTPLSKTLVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKLQ 292

Query: 324 DNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFXXXXXXX 383
           +N D E LDQGFTRPKVL+V PTR+TAY++ +KII KSGLDQVDKK KF DQF       
Sbjct: 293 ENDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPP 352

Query: 384 XXXXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKK 443
                 FQ +FKGNTNDFFVLG+KFTRK +KLYSNFYQSD+IVCSPLG+Q+I+ENTDKKK
Sbjct: 353 TSKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKK 412

Query: 444 RQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAK 503
           RQDDFLSSIE+L+VDQLHSLE+QN AH+ +IF H+NKIP +QHD+DFSRIRMWYINDQA+
Sbjct: 413 RQDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQAR 472

Query: 504 LFRQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDI 563
           LFRQT++FTKYVSP        +C NW GR+KN + ++PE S+I +LGLK++Q+F RFD+
Sbjct: 473 LFRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDL 532

Query: 564 MGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILFG 623
             GS VDEPDYRFK FTSV +P I KST Y+DGIL+YIPDYTD++R+RNY K++TRILFG
Sbjct: 533 FTGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFG 592

Query: 624 DINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYNE 683
           +I EYS+QR++ SNR+L QQG+VKVLLYTERLHH+RRY+IKGVKSV+FYKPP+NPEFY E
Sbjct: 593 EITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQE 652

Query: 684 VVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
           ++R IGKNAFLGN DLNISTVR  YCKLD LSLERIVG+KRA +L  +QNE+YEFK
Sbjct: 653 LIRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/718 (56%), Positives = 501/718 (69%), Gaps = 21/718 (2%)

Query: 22  DHHRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXXXXXXX 81
           D  RKRGR++LR+IRR+     R D    E  +                           
Sbjct: 13  DGSRKRGRKDLRSIRRA-----RNDKEPVEEPEIPVASEEDGELSEDSEEDATNEVQEQE 67

Query: 82  XXXRKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRXXXXXXXXXXX 141
               K K YGALLTIL++EHPE + + + K+K   +  S S+     D            
Sbjct: 68  DS--KEKAYGALLTILKSEHPEDRQRERRKKKQDLQDPSSSD-----DELSEDEKGEVEA 120

Query: 142 XXXXXNGLXXXXXXXXXXXXXXXXXXVESDDEQDPFESHFNKPTEQFVDKLHAAFESREI 201
                 G                    E D    PFESHFN  +E  +D L  A++ ++I
Sbjct: 121 NLVDTPGEEEPQSEEELSEGDEDESEDERD----PFESHFNMQSES-IDSLDEAWKQKKI 175

Query: 202 KYKATKXXXXXXXXXXXXKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPK 261
             K+ K            K T+ G+  E    S   H   + SY +K++LKIQNNLL  +
Sbjct: 176 VNKSGKIRVDDDESLIYTK-TLAGKGQEFELPSHKGH---LSSYPLKRKLKIQNNLLESQ 231

Query: 262 VDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQR 321
            D LTPLQ++++DP+FQY+D+LYEY+ Y +DEDEYRDLY LH LNH+YKTRDRILK+NQR
Sbjct: 232 DDVLTPLQRKIVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKTRDRILKDNQR 291

Query: 322 LQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFXXXXX 381
           L  N D E+LDQGFTRPKVLIV PTRDTAY++  K+I+KSGLDQVDKK K  DQF     
Sbjct: 292 LATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVL 351

Query: 382 XXXXXXXXFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDK 441
                   F+  FKGNTNDFFVLG+KFTRKAI+LYSNFYQSD+IVCSPLG+Q+I+ENTD+
Sbjct: 352 PPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDR 411

Query: 442 KKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQ 501
           KKRQDDFLSSIEL+I+DQL+S+E+QN++H+FTIF H+NKIP EQHD DF R+RMWYIN+Q
Sbjct: 412 KKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQ 471

Query: 502 AKLFRQTMVFTKYVSPXXXXXXXXRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRF 561
           AKL RQT++FT+YV+P        +CRN  GRWKNH  +  E SS+ KLG +++QIFQR 
Sbjct: 472 AKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRV 531

Query: 562 DIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRIL 621
           D+ G S+VDEPDYRF+ FTSVI+PSI KST Y+DGIL+YIPDY D++R+RNYLK+KT IL
Sbjct: 532 DLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTIL 591

Query: 622 FGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFY 681
           FGDINEYS+ R+L S RSL QQGR+KVLLYTERLHH+RRYEIKGVKSV+FY+PP+NPEFY
Sbjct: 592 FGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFY 651

Query: 682 NEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
           NEVVR+IGK+AFLG+TDLNISTVR VY KLDGL+LERIV +KRA +L H QNE+YEFK
Sbjct: 652 NEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/573 (63%), Positives = 453/573 (79%), Gaps = 8/573 (1%)

Query: 169 ESDDEQDPFESHFNKPTEQFVDKLHAAFESREIKYKATKXXXXXXXXXXXXKPTIFGEEL 228
           ESD+EQD F+ HFN+ +   V +L AAF++   +Y+  K            KP    E  
Sbjct: 138 ESDEEQDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARGEEEILYS-KPVASSEGT 196

Query: 229 ETNRLSSSKHGQSIFSYFIKQRLKIQNNLL--NPKVDPLTPLQKELLDPMFQYKDILYEY 286
           E      ++   S+  Y IKQRL++ N L   +P+  PLTP QK LLDPMFQY+DILYEY
Sbjct: 197 EGPVRVPAR---SLRGYAIKQRLRMHNGLTADDPE-KPLTPQQKVLLDPMFQYQDILYEY 252

Query: 287 DSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPT 346
           + Y + E EYR+LY LH LNHVYKTRDRILKNNQ+LQDN D E LDQGFTRPK L+VVPT
Sbjct: 253 EGYDR-EREYRELYTLHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPT 311

Query: 347 RDTAYEVTDKIIKKSGLDQVDKKGKFYDQFXXXXXXXXXXXXXFQQIFKGNTNDFFVLGL 406
           R TAY+V D ++++SG++QVDKK KF DQF             FQ +FKGNTNDFFVLG+
Sbjct: 312 RATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGM 371

Query: 407 KFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQ 466
           KFTRKAI+LYSNFYQSD+IVCSPLG+Q+I+ENTDKKKRQDDFLSSIE++++DQLHS+E+Q
Sbjct: 372 KFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQ 431

Query: 467 NLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSPXXXXXXXXR 526
           N+AH+  IF H+NKIP +Q DADFSRIRMWYI DQAKLFRQTMVFT+Y+SP        +
Sbjct: 432 NIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRK 491

Query: 527 CRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPS 586
           C NW GR K+H++V+ E S IG+LGLK++QIFQRF+++GGS VDEPD+RFK FTSV++P 
Sbjct: 492 CANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPG 551

Query: 587 IVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQQGRV 646
           I K+T YD GIL+YIP+YTD++R+RNYLK+KTRILFGDINEYS+QR+L SNR+L Q GR+
Sbjct: 552 IEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRI 611

Query: 647 KVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRT 706
           KVLLYTERLHH+RR+E+KGVKSV+ YKPP+NPEFY E++R+IGK+AFLG  DLNI+TVR 
Sbjct: 612 KVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRC 671

Query: 707 VYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739
           +Y K+D L+LERIVGTKRA +L H QNEVYEFK
Sbjct: 672 LYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 40/83 (48%), Gaps = 7/83 (8%)

Query: 25  RKRGRQELRTIRRSAAKKSR-----YDSNVTEHNDTXXXXXXXXXXXXXXXXXXXXXXXX 79
           +KRGR +LRTI+RS   K R     YD+N T+HND                         
Sbjct: 8   KKRGRSQLRTIQRSKYAKKRNSGRNYDTN-TKHNDESKPADALVSGEEAESESDDAKDEE 66

Query: 80  XXXXXRKGKVYGALLTILETEHP 102
                R  +VYGALLTIL++EHP
Sbjct: 67  DVGKKR-NQVYGALLTILKSEHP 88

>Kpol_1053.37 s1053 (57362..59596) [2235 bp, 744 aa] {ON}
           (57362..59596) [2235 nt, 745 aa]
          Length = 744

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 53/100 (53%), Gaps = 18/100 (18%)

Query: 261 KVDPLTPLQKELLDPMFQYK-DILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNN 319
           ++ PLTPL+ ++L+  +++  +   EY S+  +   +  L+ +   +HVY T   ILK  
Sbjct: 287 EISPLTPLEDDVLEGAYKHVFETPREYSSFTSN---FDSLF-IDRKSHVYSTISEILK-- 340

Query: 320 QRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIK 359
             L D +DT  L+Q    PK L       T  +VTD+++K
Sbjct: 341 --LVDGSDTTILNQD--SPKEL-------TISQVTDEVLK 369

>Ecym_1365 Chr1 complement(748590..752792) [4203 bp, 1400 aa] {ON}
           similar to Ashbya gossypii AEL061W
          Length = 1400

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 24/43 (55%)

Query: 231 NRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELL 273
           N LSSSKH   + S FI+ RL + N      VD LT LQ  LL
Sbjct: 60  NNLSSSKHNDPLLSGFIQLRLMLNNLKSLSDVDSLTVLQPFLL 102

>ZYRO0E03322g Chr5 (260990..265570) [4581 bp, 1526 aa] {ON} similar
           to uniprot|P39993 Saccharomyces cerevisiae YEL022W
          Length = 1526

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 231 NRLSSSKHGQSIFSYFIKQRLKIQNNLLN-PKVDPLTPLQKELL 273
           N LSS+KH   + S F++ RL + NNL N  ++D LT LQ  LL
Sbjct: 101 NNLSSNKHNDPLLSGFVQLRLML-NNLQNLEEIDSLTLLQPFLL 143

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,659,429
Number of extensions: 3189286
Number of successful extensions: 9147
Number of sequences better than 10.0: 36
Number of HSP's gapped: 9353
Number of HSP's successfully gapped: 49
Length of query: 739
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 622
Effective length of database: 40,065,477
Effective search space: 24920726694
Effective search space used: 24920726694
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)