Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B035202.293ON50150126170.0
NCAS0B062202.293ON48650119000.0
Smik_9.892.293ON49149517550.0
Skud_9.832.293ON49149517330.0
YIL090W (ICE2)2.293ON49149517190.0
Suva_9.1092.293ON49149517180.0
KAFR0J013302.293ON49149816830.0
TDEL0G022302.293ON48849216330.0
KNAG0A053902.293ON49749716260.0
CAGL0D04202g2.293ON49950716180.0
ZYRO0A02024g2.293ON48648816160.0
SAKL0E07524g2.293ON47949914720.0
Kpol_1003.422.293ON49049014310.0
KLTH0G10516g2.293ON47449813560.0
Kwal_27.115002.293ON47549713420.0
ADL208W2.293ON50250812511e-168
Ecym_33322.293ON51351812371e-166
TBLA0B059802.293ON49349412151e-163
TPHA0C034402.293ON57953112191e-162
KLLA0E08207g2.293ON48649411901e-159
TBLA0B069902.293ON53653611871e-158
Skud_14.296na 1ON45649732.2
SAKL0G05412g5.549ON16172702.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B03520
         (501 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...  1012   0.0  
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   736   0.0  
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   680   0.0  
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   672   0.0  
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   666   0.0  
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   666   0.0  
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   652   0.0  
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   633   0.0  
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   630   0.0  
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   627   0.0  
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   627   0.0  
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   571   0.0  
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   555   0.0  
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   526   0.0  
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   521   0.0  
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   486   e-168
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   481   e-166
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   472   e-163
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   474   e-162
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   462   e-159
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            461   e-158
Skud_14.296 Chr14 complement(542444..543814) [1371 bp, 456 aa] {...    33   2.2  
SAKL0G05412g Chr7 (444920..445405) [486 bp, 161 aa] {ON} similar...    32   2.6  

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score = 1012 bits (2617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/501 (100%), Positives = 501/501 (100%)

Query: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60
           MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR
Sbjct: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60

Query: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120
           KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL
Sbjct: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120

Query: 121 SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINS 180
           SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINS
Sbjct: 121 SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINS 180

Query: 181 NTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEK 240
           NTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEK
Sbjct: 181 NTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEK 240

Query: 241 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNF 300
           GSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNF
Sbjct: 241 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNF 300

Query: 301 VLRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVS 360
           VLRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVS
Sbjct: 301 VLRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVS 360

Query: 361 VPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIM 420
           VPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIM
Sbjct: 361 VPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIM 420

Query: 421 KILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNI 480
           KILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNI
Sbjct: 421 KILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNI 480

Query: 481 FFTIIIYASELFGTTATANKQ 501
           FFTIIIYASELFGTTATANKQ
Sbjct: 481 FFTIIIYASELFGTTATANKQ 501

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/501 (72%), Positives = 425/501 (84%), Gaps = 16/501 (3%)

Query: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60
           MISSSF+RG+R  SA FYLLFTLISIPISFKIGGL CGLAFT +LF +YFLSTTLS+ AR
Sbjct: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60

Query: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120
           KYGS   I LT  LYY QH IIASLLYLFLSGFS+E L+  L D  + +D I+D+ ++N+
Sbjct: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120

Query: 121 -SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEIN 179
            SST +NW LY+ YY FFVQPW+++LSYSTPFFTLSEGFFTILAIQA+GETNKWLV EIN
Sbjct: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180

Query: 180 SNTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTE 239
           SNTW+ISSLL SGGVITASLYYLYRIYVTPIWQLS+QTASLLGFTLSLVGGLG+YGIVT+
Sbjct: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240

Query: 240 KGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNN 299
           KGSVIESS+FFAYIVRCIYEISPKLATTAT+EILE+FKEVWQRHQ NL + +NLL YY+N
Sbjct: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300

Query: 300 FVLRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTV 359
            VL++I+ +WE    KIN N            +F+T+F S + ++ I  PIWKL K FT+
Sbjct: 301 VVLKNIETIWESF--KINDN------------SFITSF-STERVITIFMPIWKLLKTFTI 345

Query: 360 SVPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRI 419
           +VPSSI+EL  VTY+MA ES+SPAV++NLCFRVLIFYSATRIIPALQRR+D+EL+KSRRI
Sbjct: 346 TVPSSINELCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRI 405

Query: 420 MKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCN 479
           MK+LYWYSPC+LIAMY HLILQYSGELK +LCLWGCN K    +QP++IVDSWGFWNWCN
Sbjct: 406 MKVLYWYSPCILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCN 465

Query: 480 IFFTIIIYASELFGTTATANK 500
           IFFTI++YASEL GTT  + +
Sbjct: 466 IFFTILVYASELIGTTPGSKQ 486

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/495 (67%), Positives = 407/495 (82%), Gaps = 7/495 (1%)

Query: 2   ISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARK 61
           +S SFM+  R  +A FYLLFTL+SIPISFK+GGL+CGL+FT TLFT+YF++TTL++LAR+
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  YGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLS 121
           YG    IFLT  LYYSQH IIASLLYLFLSGFS+++L   L     + +   + ++ +L+
Sbjct: 64  YGGKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRPNESESFLEALKNSLN 123

Query: 122 STNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSN 181
           S   N+ LY+ Y+ F VQPW+++L+ STPFFTLSEGFFTILAIQAVGETN+WL N++NSN
Sbjct: 124 SNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSN 183

Query: 182 TWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKG 241
           TWIISSLL SGGVITASLYYLYRIYVTPIW LSIQTASLLGF LS+V GLGLYGIV++KG
Sbjct: 184 TWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKG 243

Query: 242 SVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFV 301
           SVIESSLFFAYIVRCIYEISPKLATTATDEIL++FK+VWQ+HQ NLPT DNLL Y++N +
Sbjct: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVI 303

Query: 302 LRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSV 361
           L++ +MLW   + +  +   +      F+ + L + LS + +  I KP WK FKNFT SV
Sbjct: 304 LKNAEMLWGSFIPRGRKKTGD------FH-DKLISVLSFEKVSLISKPFWKFFKNFTFSV 356

Query: 362 PSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMK 421
           P SI+E   VT +MA ESVSPA+V+NLCFRVL+FYSATRIIPALQR+ND +L+KSRRIMK
Sbjct: 357 PLSINEFCQVTIKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMK 416

Query: 422 ILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNIF 481
            LYWYSPC+LIAMYTHLILQYSGELKKDLC+WGC+ KW   +QPE+IVDSWGFWNWCNIF
Sbjct: 417 GLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGSDQPEIIVDSWGFWNWCNIF 476

Query: 482 FTIIIYASELFGTTA 496
            TI++YA+EL G+ +
Sbjct: 477 CTILVYATELIGSGS 491

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/495 (67%), Positives = 408/495 (82%), Gaps = 7/495 (1%)

Query: 2   ISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARK 61
           +S SFM+  R  +A FYLLFTL+SIPISFK+GGL+CGL+FT TLFT+YF++TTL++LA++
Sbjct: 4   LSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAKR 63

Query: 62  YGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLS 121
           +G    IFLT  LYYSQH +IASLLYLFLSGFS+++L   L + + + +   D ++ +L+
Sbjct: 64  HGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKDSLN 123

Query: 122 STNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSN 181
           S   N+ LY+ YY F VQPW+++L+ STPFFTLSEGFFTILAIQAVGETN+WL N++NSN
Sbjct: 124 SNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSN 183

Query: 182 TWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKG 241
           TWIISSLL SGGVITASLYYLYRIYVTPIW LSIQTASLLGF LS+V GLGLYGIV++KG
Sbjct: 184 TWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKG 243

Query: 242 SVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFV 301
           SVIESSLFFAYIVRCIYEISPKLATTATDEIL++FK+VWQ+HQ NLPT DNLL Y++N V
Sbjct: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVV 303

Query: 302 LRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSV 361
           L++ +MLW   + +  +   +      F+ + + + LS + +  I +P WK FKNFT SV
Sbjct: 304 LKNAEMLWGSFIPRGRKKTGD------FH-DKIISILSFEKVSLISRPFWKFFKNFTFSV 356

Query: 362 PSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMK 421
           P SI+E   VT +MA ESVSPA+VINLCFRVL+FYSATRIIPALQR+ND +L+KSRRIM+
Sbjct: 357 PLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMR 416

Query: 422 ILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNIF 481
            LYWYSPC+LIAMYTHLILQYSGELKKDLC+WGC+ KW    QPE+IVDSWGFWNWCNIF
Sbjct: 417 GLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIF 476

Query: 482 FTIIIYASELFGTTA 496
            TI++YA+EL G+ +
Sbjct: 477 CTILVYATELIGSGS 491

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/495 (67%), Positives = 406/495 (82%), Gaps = 7/495 (1%)

Query: 2   ISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARK 61
           +S SFM+  R  +A FYLLFTL+SIPISFK+GGL+CGL+FT TLFT+YF++TTL++LAR+
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  YGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLS 121
           +G    IF T  LYYSQH IIASLLYLFLSGFS+++L   L +   + +   + ++ +L+
Sbjct: 64  HGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKNSLN 123

Query: 122 STNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSN 181
           S   N+ LY+ YY F VQPW+++L+ STPFFTLSEGFFTILAIQAVGETN+WL N++NSN
Sbjct: 124 SNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSN 183

Query: 182 TWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKG 241
           TWIISSLLTSGGVITASLYYLYRIYVTPIW LSIQTASLLG  LS+V GLGLYGIV++KG
Sbjct: 184 TWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVSQKG 243

Query: 242 SVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFV 301
           SVIESSLFFAYIVRCIYEISPKLATTATDEIL +FK+VWQ+HQ NLPT DNLL Y++N +
Sbjct: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFHNVI 303

Query: 302 LRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSV 361
           L++ ++LW   + +  +   +      F+ + L + LS + +  I KP WK FKNFT SV
Sbjct: 304 LKNAEVLWGSFIPRGRKKTGD------FH-DKLISILSFEKVSLISKPFWKFFKNFTFSV 356

Query: 362 PSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMK 421
           P SI+E   VT +MA ESVSPA+VINLCFRVL+FYSATRIIPALQR+ND +L+KSRRIMK
Sbjct: 357 PLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMK 416

Query: 422 ILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNIF 481
            LYWYSPC+LIAMYTHLILQYSGELKKDLC+WGC+ KW   +QPE+IVDSWGFWNWCNIF
Sbjct: 417 GLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIF 476

Query: 482 FTIIIYASELFGTTA 496
            TI++YA+EL G+ +
Sbjct: 477 CTILVYATELIGSGS 491

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/495 (66%), Positives = 405/495 (81%), Gaps = 7/495 (1%)

Query: 2   ISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARK 61
           +S SFM+  R  +A FYLLFTL+SIPISFK+GGL+CGL+FT TLFT+YF++TTL++LAR+
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  YGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLS 121
            G    IFLT  LYYSQH +IASLL+LFLSGFS+++L   L + + + +   + ++ +L+
Sbjct: 64  NGGRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRSNESESFLEALKNSLN 123

Query: 122 STNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSN 181
           S   N+ LY+ YY F VQPW+++L+ STPFFTLSEGFFTILAIQAVGETN+WL N++NSN
Sbjct: 124 SNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSN 183

Query: 182 TWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKG 241
           TWIISSLL SGGVITASLYYLYRIYVTPIW LSIQTASLLGF LS+V GLGLYGIV+++G
Sbjct: 184 TWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQRG 243

Query: 242 SVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFV 301
           SVIESSLFFAYIVRCIYEISPKLATTATDEIL++FK+VWQ+HQ NLPT DNLL Y++N +
Sbjct: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVI 303

Query: 302 LRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSV 361
           L++ ++LW   +       P     +S     + + LS + +  I KP W+  KNFT SV
Sbjct: 304 LKNAEVLWGSFI-------PRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSV 356

Query: 362 PSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMK 421
           P SI+E   VT +MA ESVSPA+VINLCFRVL+FYSATRIIPALQR+ND +L+KSRRIMK
Sbjct: 357 PLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMK 416

Query: 422 ILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNIF 481
            LYWYSPC+LIAMYTHLILQYSGELKKDLC+WGC+ KW  P+QPE+IVDSWGFWNWCNIF
Sbjct: 417 GLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIF 476

Query: 482 FTIIIYASELFGTTA 496
            TI++YA+EL G+ +
Sbjct: 477 CTILVYATELVGSGS 491

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/498 (65%), Positives = 399/498 (80%), Gaps = 17/498 (3%)

Query: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60
           ++S S +RG+R FS  FYLLFTLISIP+SFKIGG+ CGL+FT TLF  YFLSTTLS+LAR
Sbjct: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62

Query: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120
           + GS F I LT  +YY QHLIIASLLY FLSGFS+++L   L D T+K++++  V  ++L
Sbjct: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVL--VANQDL 120

Query: 121 SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINS 180
             + SNW LY  YY++ V+PWK++LSYSTPFF L+EGFFTILAIQA+GETN+WL +E NS
Sbjct: 121 MVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNS 180

Query: 181 NTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEK 240
           N+WIISSLL S GV+TASLYYLYRIYVTPIW+LS QTA+LLG  LSL  GLG++GI++E+
Sbjct: 181 NSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISER 240

Query: 241 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNF 300
           GSV+ESSLFFAYIVRCIYEISPKLATTATDEILE+FKEVWQ HQG LP TDN+L YY + 
Sbjct: 241 GSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSV 300

Query: 301 VLRHIDMLWELLVSKINQNDPNNTLPSSFNI-NFLTTFLSKDLLLRICKPIWKLFKNFTV 359
           +L++ +M+WE  +SK  Q+  N+TL S F   NF   F           P+WK FKNFT+
Sbjct: 301 ILKNTEMIWEAFLSKTKQHS-NHTLNSFFTAENFWIHF----------NPLWKFFKNFTI 349

Query: 360 SVPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRI 419
           SVP SISEL  +  QMA ES+SPAVV+NLCFRVLIFYSATRIIP+LQR+   + +KSRRI
Sbjct: 350 SVPFSISELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRI 409

Query: 420 MKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCN--LKWLIPNQP-ELIVDSWGFWN 476
           MK+LYWYSPC+LIAMYTHLILQYSGELK++L LWG +  L +L+  +   ++VDSW FWN
Sbjct: 410 MKVLYWYSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWN 469

Query: 477 WCNIFFTIIIYASELFGT 494
           WCNIF+TI+IY  ELFGT
Sbjct: 470 WCNIFWTILIYGGELFGT 487

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/492 (63%), Positives = 387/492 (78%), Gaps = 10/492 (2%)

Query: 2   ISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARK 61
           IS SF++G R   A FYLL TL++IPISFK+GGL CGL+FT TLF +Y ++TTLS++A+ 
Sbjct: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63

Query: 62  YGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLS 121
           YG+   I  T F+YY QH +IASLLYLFLSGFS+E+LT  L D +Q    + +V+R N+ 
Sbjct: 64  YGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNVF 123

Query: 122 STNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSN 181
           S +S+W LY+ YY + VQPW+ +L++ST FF LSEGFFT+L IQA+GETN+WL++E+NSN
Sbjct: 124 SNHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNSN 183

Query: 182 TWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKG 241
           TWII+SLLTSGGVITASLYYLYRIYVTPIW LS+QTASLLGFTLS+V G+GL+GIV++ G
Sbjct: 184 TWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKNG 243

Query: 242 SVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFV 301
           SVIESSLFFAYIVRCIYEISPKLATTATDEILE+ K  WQ+HQ NL TT+NLL YY + V
Sbjct: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDVV 303

Query: 302 LRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSV 361
           L++ +M+WE +V +   +D              T     + L     PIWK FK F +SV
Sbjct: 304 LKNAEMVWESIVLRTKNSDATT----------FTAIQPLNKLWHAFTPIWKFFKGFVLSV 353

Query: 362 PSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMK 421
           PSSI  +  VT ++A ESVSPA+V+NLCFRVL+FYSATRIIPALQR+N  EL+KSRRIM 
Sbjct: 354 PSSIGGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMN 413

Query: 422 ILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNIF 481
           +LYWYSPC+LIAMYTHLILQYSGEL  DLCLWGC+ KW    QP++ +++W FWNWCNIF
Sbjct: 414 VLYWYSPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIF 473

Query: 482 FTIIIYASELFG 493
           +T++IY SEL G
Sbjct: 474 WTVLIYGSELIG 485

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/497 (62%), Positives = 394/497 (79%), Gaps = 13/497 (2%)

Query: 2   ISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARK 61
           ++S F+RG R  S A YLL TLISIPISFK+GGL CGLAFTATLF +YF+STTLS++ARK
Sbjct: 5   LTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARK 64

Query: 62  YGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLS 121
            G+   I L+  LYY QH IIASLL+LFLSGFS+ +L   + +D   ++ ++ ++  ++S
Sbjct: 65  NGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMS 124

Query: 122 STNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSN 181
           S+ +NW  Y+ YY + V PWK++LS+STPFFTLSEGFFTILAIQA+GETNKWL  E NSN
Sbjct: 125 SSEANWIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSN 184

Query: 182 TWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKG 241
            WIISSLLTS  VI+A+LYYLYRIYVTPIW+L++QTASLLGF LSLV GLG+YGIV++ G
Sbjct: 185 AWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDSG 244

Query: 242 SVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFV 301
           SVIESSLFFAYIVRCIYEISPKLATTATDE+LE+FK+VWQ+ QGNLP  +NL+FYYNN +
Sbjct: 245 SVIESSLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNVI 304

Query: 302 LRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSV 361
           L++I+M W+  + +   +   N  PS          L  +   + CKPIWK FKNFT+SV
Sbjct: 305 LKNIEMAWDNFILRTGTSGTFNYNPS----------LLLNNTWKFCKPIWKFFKNFTLSV 354

Query: 362 PSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMK 421
           P SI E++L+T++M+ ESVSPAVVINLCFR+LIFYSATRI+P+LQR++  E ++SR++M+
Sbjct: 355 PFSIREILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVME 414

Query: 422 ILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCN---LKWLIPNQPELIVDSWGFWNWC 478
           ++YWYSPC+LIAMY HLILQYS ELK +LCLWGCN   L +       ++VD+W FWNWC
Sbjct: 415 LVYWYSPCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWC 474

Query: 479 NIFFTIIIYASELFGTT 495
           N+F TI++YA+EL G T
Sbjct: 475 NVFCTILVYANELIGDT 491

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/507 (62%), Positives = 388/507 (76%), Gaps = 26/507 (5%)

Query: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60
           +I+    R +R  SAA YL+ TL+SIPISFKIGGLQCGL+FT TLF +Y +STTLS+LAR
Sbjct: 3   LITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLAR 62

Query: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSD---------DTQKVDI 111
           +  +   +F T  LYYSQHL+IA LL+LFLSGFS+E+    LS          D   +D+
Sbjct: 63  RSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFLDL 122

Query: 112 ISDVVRRNLSSTNS-NWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGET 170
           +   +    ++ NS NW LY+ Y+ F VQPW++LLSYSTPFFTL EGFFTILAIQA+GET
Sbjct: 123 LKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIGET 182

Query: 171 NKWLVNEINSNTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGG 230
           NKWL  E+NSNTWII+SLL SGGVIT SLYYLYRIYVTPIW+L+IQ+ASLLGF LS+V  
Sbjct: 183 NKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIVFC 242

Query: 231 LGLYGIVTEKGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTT 290
           LGLYGI++ KGSVIESSLFFAYIVRCIYEISPKLAT AT+EIL++ K+VWQ HQ NL   
Sbjct: 243 LGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLLNR 302

Query: 291 DNLLFYYNNFVLRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPI 350
           DNLL YY+N VL++ +M+WE  +           LP S ++N     + K        P+
Sbjct: 303 DNLLAYYHNVVLKNAEMVWESFI-----------LPRSRSLN----AMEKIRFWLDVTPV 347

Query: 351 WKLFKNFTVSVPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRND 410
           WK FKNFTVSVPSSI ELV VTY+MA ES+SPAV++NLCFR+LIFYSATRIIPALQR + 
Sbjct: 348 WKFFKNFTVSVPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSY 407

Query: 411 SELKKSRRIMKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWL-IPNQPELIV 469
            E ++SRRI+K+LYWYSPCVLIAMYTHLILQYSGELK++LCLWGC   W    +QP ++ 
Sbjct: 408 KEQRQSRRILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVT 467

Query: 470 DSWGFWNWCNIFFTIIIYASELFGTTA 496
           DSW FWNWCNIF+T+++YA+EL GT A
Sbjct: 468 DSWSFWNWCNIFWTVLVYANELIGTQA 494

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/488 (65%), Positives = 383/488 (78%), Gaps = 10/488 (2%)

Query: 7   MRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARKYGSNF 66
           ++ VR   A FYLL  LI+IPISFK+GGL CGL+FT TLF +YF+STTLSL  R Y S F
Sbjct: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64

Query: 67  SIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLSSTNSN 126
            +F T  +YYSQH IIASLLYLFLSGFS+E+LT  L   +Q    + +V++ N  S +SN
Sbjct: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHSN 124

Query: 127 WNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSNTWIIS 186
           W LY+ YY + VQPW+++LS+ST FF+LSEGFFTILAIQAVGE+++WL+ EINSN W I+
Sbjct: 125 WILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNIT 184

Query: 187 SLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKGSVIES 246
           SLL SGGVITA+LYYLYRIYVTP+W+LSIQTASLLGFTLSLV GLGLYGIV++ GSVIES
Sbjct: 185 SLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIES 244

Query: 247 SLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFVLRHID 306
           SLFFAYIVRCIYEISPKLATTATDEILEIFKE WQ+HQ N  +T+NLL YY++ VL   +
Sbjct: 245 SLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAE 304

Query: 307 MLWELLVSK-INQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSVPSSI 365
           M+WE +VSK +  +DP             + F        I KP+   FKNFT+SVPSSI
Sbjct: 305 MMWESIVSKTVTTSDP---------FYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSI 355

Query: 366 SELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMKILYW 425
             L  VT +MA +SVSPA+V+NL FRVLIFYSAT+IIPALQ + D +L KSRRIM +LYW
Sbjct: 356 EGLFQVTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYW 415

Query: 426 YSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNIFFTII 485
           YSPC+LIAMYTHLILQYSGEL +DLCLWGCN  W   NQ +++VDSWGFWNWCNIF+TI+
Sbjct: 416 YSPCILIAMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTIL 475

Query: 486 IYASELFG 493
           +Y SEL G
Sbjct: 476 VYGSELIG 483

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/499 (58%), Positives = 369/499 (73%), Gaps = 22/499 (4%)

Query: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60
           M+  S ++ +R     FYLL  LI+IPISF++GGL CGL+FT TLF +YFL+TTL ++++
Sbjct: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSK 60

Query: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120
           KY +     +T F+YY QH II SLL+LFLSGF++++L   +  D            RN 
Sbjct: 61  KY-NRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRNK 119

Query: 121 SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINS 180
           S  +S W  Y+ YY F V+PW+++L +STP+FTL EGFFT+L IQA+GETNKWL    NS
Sbjct: 120 SGKHS-WIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178

Query: 181 NTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEK 240
           NTWII SLL SGGVIT SLYYLYRIYVTP+W+LSIQTASLLGFTLS+V GLGLYGIV+ K
Sbjct: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238

Query: 241 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNF 300
           GSVIESSLFFAYIVRCIYEISP+LAT+A DEI +I K+ WQ+HQGNLP TDNLL YY N 
Sbjct: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP-TDNLLSYYRNV 297

Query: 301 VLRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVS 360
           VL++ +M+W+ +V K     P+ T               + + LR+ +P+WK  KNFT+S
Sbjct: 298 VLKNGEMIWDAIVQKTGTTSPSTT---------------QMVWLRL-QPLWKFTKNFTIS 341

Query: 361 VPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIM 420
           VPSSI E+  VT +MA ESV+P VVINL FR+L+FYSATRIIPALQ+ + +  K SRR+M
Sbjct: 342 VPSSIREIFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLM 401

Query: 421 KILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQP--ELIVDSWGFWNWC 478
           +++YWYSPC++IAMYTHLILQYSGEL  DLCLWGC   W   N P  +++VD+WGFWNWC
Sbjct: 402 RLIYWYSPCIVIAMYTHLILQYSGELNNDLCLWGC-FPWSHTNDPSSKVVVDAWGFWNWC 460

Query: 479 NIFFTIIIYASELFGTTAT 497
           N+F T+ IY  EL G  ++
Sbjct: 461 NVFCTLAIYGLELIGGKSS 479

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/490 (57%), Positives = 351/490 (71%), Gaps = 8/490 (1%)

Query: 4   SSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARKYG 63
            + +R V+     FYLL  + +IPISFKIGGL CGL FT TLF +YF STTL+++AR++G
Sbjct: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNIIARRWG 65

Query: 64  SNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLSST 123
           S  +I +T   +Y Q+ II SLL+LFL+GF++EDL   +    Q  +   D++R ++  +
Sbjct: 66  SKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDIPVS 125

Query: 124 NSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSNTW 183
             NW L++ YY++ V+PW+ +LSYSTP FTL EGFFTIL IQ +GE N WL +E NSN W
Sbjct: 126 VKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNIW 185

Query: 184 IISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKGSV 243
           IISSLLTSGG+IT SLYYLYRIY TPIW LS+  A+LLGFTLSLVG LG+YGIV+  GSV
Sbjct: 186 IISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGSV 245

Query: 244 IESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFVLR 303
           IESSLFFAYIVRCIYEI+P+LATTAT+E LE  KEVWQ H  NL   D  + Y+ +    
Sbjct: 246 IESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFISYFYDSFHM 305

Query: 304 HIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSVPS 363
                W L  S+        T    +  N+   + S  ++     PIW+  K  T SVP+
Sbjct: 306 QAHKFWTLFTSR--------TPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPT 357

Query: 364 SISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMKIL 423
           SISEL  +T +MA +SVSPA++INLCFR++IFYSATRIIPA+Q+R  SE +K R IMK L
Sbjct: 358 SISELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKAL 417

Query: 424 YWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNIFFT 483
           YWYSPC+LIAMYTHLILQYSGELKKDLCLWGC+  W   +Q  + VD+W FWNWCNIF+T
Sbjct: 418 YWYSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWT 477

Query: 484 IIIYASELFG 493
           IIIY SEL G
Sbjct: 478 IIIYGSELIG 487

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/498 (54%), Positives = 363/498 (72%), Gaps = 26/498 (5%)

Query: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60
           M   S ++  R    +FYLL  LI+IPISF++GGL CGL+FT TLF +Y ++TTL + AR
Sbjct: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120
             G      L    YY+QH  I SLL+LFLSGFS+++L   +  +T+  + + D++R   
Sbjct: 61  ARGLAK---LASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTRPDESLIDLLRSTT 117

Query: 121 SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINS 180
            S    W  Y+ YY + V+PW+++L  STP+FTL EGFFT+L IQAVGETN+WL     S
Sbjct: 118 QS--QTWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGS 175

Query: 181 NTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEK 240
           N W+IS L+ SGGVITA+LYYLYRIYVTPIW+LS+QTASLLGFT S+V GLG+YGIV+ +
Sbjct: 176 NMWVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGR 235

Query: 241 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNF 300
           GS IESSLFFAYIVRC+YEISP+LAT+A DEI  + KE W     +L ++D LL YY + 
Sbjct: 236 GSTIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDI 295

Query: 301 VLRHIDMLWELLVSKINQNDPNNTLP--SSFNINFLTTFLSKDLLLRICKPIWKLFKNFT 358
           +L++ +M+W+ ++++ N N   +  P  +S+N              R+ +P+WK  K+FT
Sbjct: 296 ILKNGEMVWDAILARTNVNVGASGTPVWASWN--------------RV-QPLWKFVKHFT 340

Query: 359 VSVPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRR 418
            SVPSSI E+  +T +MARE+++PAVVINLCFR+LIFYSATRIIPALQ+++    ++SRR
Sbjct: 341 SSVPSSIQEIFYLTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRR 397

Query: 419 IMKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWC 478
            M++LYWYSPC++IAMYTHLILQYSG++  DLCLWGC   W +P+ P+++VDSWGFWNWC
Sbjct: 398 FMRMLYWYSPCIVIAMYTHLILQYSGQISNDLCLWGC-FPWSVPDTPKVVVDSWGFWNWC 456

Query: 479 NIFFTIIIYASELFGTTA 496
           NIF T+ IYASEL G+ +
Sbjct: 457 NIFCTMAIYASELLGSKS 474

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/497 (54%), Positives = 366/497 (73%), Gaps = 24/497 (4%)

Query: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60
           MI  S ++ +R    +FYLL  LI+IPI+F++GGL CGL+FT TLF +Y ++TTL + AR
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120
             G  F+  L    YY+QH  I SLL+LFLSGFS+++L   +  +T+  + + D++R   
Sbjct: 61  ARG--FAK-LASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLR--- 114

Query: 121 SSTNSN-WNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEIN 179
           SST+S  W  Y+ YY + V+PW++LL  STP+FTL EGFFT+L IQAVGETN+WL     
Sbjct: 115 SSTHSQPWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHG 174

Query: 180 SNTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTE 239
           SN W+IS L+TSGGVITA+LYYLYRIYVTPIW+LS+QTASLLGFT S+V GLG++GIV+ 
Sbjct: 175 SNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSG 234

Query: 240 KGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNN 299
           +GS IESSLFFAYIVRC+YEISP+LAT+A DEI  + K+ W     +L ++D  L YY +
Sbjct: 235 RGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRD 294

Query: 300 FVLRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTV 359
            +L++ +M+W+ ++++ N N  +   P ++            +     +P+WK  K+FT 
Sbjct: 295 IILKNGEMIWDAVLARTNVN-VSGAGPVAW------------ISWHRVQPLWKFVKHFTS 341

Query: 360 SVPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRI 419
           SVPSSI E+ L+T  MARE+++PAVVINLCFR+LIFYSATRIIPALQR++    ++SRR 
Sbjct: 342 SVPSSIQEIFLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQRKHK---RRSRRF 398

Query: 420 MKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCN 479
           M++LYWYSPC++IAMYTHLI+QYSG++  DLCLWGC   W  P   +++VDSWGFWNWCN
Sbjct: 399 MRMLYWYSPCIVIAMYTHLIMQYSGQISNDLCLWGC-FPWSPPEGSKVVVDSWGFWNWCN 457

Query: 480 IFFTIIIYASELFGTTA 496
           IF T+ IYASELFG+ +
Sbjct: 458 IFCTMAIYASELFGSKS 474

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  486 bits (1251), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 253/508 (49%), Positives = 344/508 (67%), Gaps = 21/508 (4%)

Query: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60
           M+    +R +R   A+FYL   LI++PISF+IGGL CGL+FT TLF +YF++TTL + A 
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120
             G  +   +   LYY QH ++ S+L+LFLSGF+++ L   L     K      +   N+
Sbjct: 61  TRGDEWK-HIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNM 119

Query: 121 ----------SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGET 170
                     S  +     Y +YY + V+PW+Y+L ++TP FTL+EGFFT+LAIQ +GET
Sbjct: 120 NESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGET 179

Query: 171 NKWLVNEINSNTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGG 230
            +WL  + NS  W+ISSL+ SG VIT S+YYLYRIYVTPIW LS+ TA+LLGFTLSLV G
Sbjct: 180 GRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFG 239

Query: 231 LGLYGIVTEKGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTT 290
           LGLYGI++ KGS IESSLFFAY+V CIYEISP+LA TA  EI ++    WQ  QG LP  
Sbjct: 240 LGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP-K 298

Query: 291 DNLLFYYNNFVLRHIDMLWELLVSK--INQNDPNNTLPSSFNINFLTTFLSKDLLLRICK 348
           ++LL YY NF+L + + LW++L+ K  +  +   +  PSS  +      + +    +  +
Sbjct: 299 NSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNK-SQ 356

Query: 349 PIWKLFKNFTVSVPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRR 408
            +W   KNF+  +P SI E+ +VT  +ARES++ AVV NL FRV++FYSATRIIPALQR 
Sbjct: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416

Query: 409 NDSELKKSRRIMKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLI--PNQPE 466
                 +SR++M+I+YWYSPC++IAMYTH+IL+YSGEL  +LC+WGC   WL    N+  
Sbjct: 417 TGG--TQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGC-FPWLQSEANRDR 473

Query: 467 LIVDSWGFWNWCNIFFTIIIYASELFGT 494
            +VD+WGFWNWCN+FFT++IYA EL G+
Sbjct: 474 WVVDAWGFWNWCNLFFTLLIYAVELIGS 501

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  481 bits (1237), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 260/518 (50%), Positives = 351/518 (67%), Gaps = 30/518 (5%)

Query: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60
           M+S   +R +R   A FYL   LI+IPISF++GGL CGL+FT TLF +YF +TTL +   
Sbjct: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTT 60

Query: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120
                F + L   +YY QH +I S+L+LFLS F+ + L   +  D         +   N+
Sbjct: 61  NGSGKFKL-LASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNV 119

Query: 121 S-----------STNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGE 169
           +               +   Y+ YY + V+PW+Y+L ++TP+FTL+EGFFT+LAIQA+GE
Sbjct: 120 NESLLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179

Query: 170 TNKWLVNEINSNTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVG 229
           T +WL  + NSNTW+I SLL SG VIT S++YLYRIYVTPIW LS+QTA+LLGFTLSLV 
Sbjct: 180 TGRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239

Query: 230 GLGLYGIVTEKGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPT 289
           GLGLYGI++ KGS IESSLFFAY+VRCIYEISP+LA TA  EI ++  + WQ  QG L +
Sbjct: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-S 298

Query: 290 TDNLLFYYNNFVLRHIDMLWELLVSK--INQNDPNNTLPSSFNINF-LTTFLSKDLLLRI 346
            +NLL YYN FV  + +  W+ L+ K  I          + F  +   T+ ++KD L+ +
Sbjct: 299 KNNLLTYYNTFV-SNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIIL 357

Query: 347 -------CKPIWKLFKNFTVSVPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSAT 399
                  C+ IW   KNF+V +P SI E+++VT +MA+ES++PAV+ NL FRVL+FYSAT
Sbjct: 358 QTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSAT 417

Query: 400 RIIPALQRRNDSELKKSRRIMKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKW 459
           RIIPALQ+   +   +SR++M+I+YWYSPC++IAMYTHLIL+YSGEL  DLC+WGC   W
Sbjct: 418 RIIPALQKATGA--TQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGC-FPW 474

Query: 460 L---IPNQPELIVDSWGFWNWCNIFFTIIIYASELFGT 494
           L      + + +VD+W FWNWCN+FFT++IYA EL G+
Sbjct: 475 LNFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  472 bits (1215), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 254/494 (51%), Positives = 340/494 (68%), Gaps = 21/494 (4%)

Query: 8   RGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARKYGSNFS 67
              R F A  YLL  L+++PI+F++GGLQCGLAFT TLF+ YF++TTL+ +ARK      
Sbjct: 10  ESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAIARKLRWQRF 69

Query: 68  IFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLSSTNSNW 127
           I  T FLYY Q+  I  +L++FLS FSH +L+I +SD+   ++ I+ +++ N +  +   
Sbjct: 70  IAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILKNNDTYPSKTI 129

Query: 128 NLYHNYYTFFVQP-WKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSNTWIIS 186
           +  + Y+ ++  P WK+ LSYSTP F L EGFFTILAIQ +GETN WL    NS+ WII 
Sbjct: 130 SFIYKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGETNIWLTTVKNSSIWIIL 189

Query: 187 SLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKGSVIES 246
           SL+ S  ++T S+YY+Y+IYVTP+W LS Q ASLL FT SLVGG+ +YGIV+ +GSV+ES
Sbjct: 190 SLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVAIYGIVSHRGSVVES 249

Query: 247 SLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFVLRHID 306
           SLFFAYIV CIYEISP +ATTA D+I +  KE WQ HQ N   +DNLL YY N +++++D
Sbjct: 250 SLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDNLLIYYYNSLIKNVD 309

Query: 307 MLWELLVSKINQNDPNNTLPSSFN-INFLTTFLSKDLLLRICKPIWKLFKNFTVSVPSSI 365
              +L + K+   D      + FN + F    +SK    +  K I KL K FT+ +PSSI
Sbjct: 310 EFIKLKIIKLTTKD---NFSNKFNSLLFQCVKISK----KSFKFILKLSKRFTLGIPSSI 362

Query: 366 SELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRR------NDSELKKSRRI 419
            EL  +T +MA ES+SP +++NLC+RVLIFY+ATRIIPAL+ R      N+ + K + + 
Sbjct: 363 YELYSITLKMASESISPVILVNLCYRVLIFYAATRIIPALESRSNGFSNNNIKTKSNSKF 422

Query: 420 MKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCN 479
           MK+LYWYSPC+LIAMYT+LILQYSGELK +  L      W   N  E++VDSW FWNWCN
Sbjct: 423 MKVLYWYSPCILIAMYTNLILQYSGELKSEFKL------WNNSNNNEVVVDSWRFWNWCN 476

Query: 480 IFFTIIIYASELFG 493
           IF+TI +Y SEL G
Sbjct: 477 IFWTITLYGSELIG 490

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  474 bits (1219), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 257/531 (48%), Positives = 349/531 (65%), Gaps = 70/531 (13%)

Query: 15  AAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARKYGSNFSI-FLTGF 73
            AFYLL  +++IPISFKIGG+ CGL+FT TLF +YF+ST+++++ ++   N ++  L   
Sbjct: 64  VAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTHNTTLRLLASS 123

Query: 74  LYYSQHLIIASLLYLFLSGFSHEDLTIPLS--DD---TQK-----------------VDI 111
           L+Y Q+ II+SLL ++L GF+++DL   L+  DD    +K                 V+I
Sbjct: 124 LFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQILFIIKDYFVNI 183

Query: 112 ISDVVRRNLSSTN--------------------SNWNLYHNYYTFFVQPWKYLLSYSTPF 151
           ++ ++ R  +  N                    ++W L+  YY  F++PWK+LL  STPF
Sbjct: 184 MNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWILFFYYYYIFIKPWKFLLINSTPF 243

Query: 152 FTLSEGFFTILAIQAVGETNKWLVNEINSNTWIISSLLTSGGVITASLYYLYRIYVTPIW 211
           FTL EGFFTIL IQ +GETN WL  + +S+ W+I SLL+SGGVITA+LYYL RIYVTP W
Sbjct: 244 FTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLYYLNRIYVTPFW 303

Query: 212 QLSIQTASLLGFTLSLVGGLGLYGIVTEKGSVIESSLFFAYIVRCIYEISPKLATTATDE 271
            L++ TAS+LGFTLS+VGGLG++GIV++ GS IESSLFFAYIVRCIYE+SP+LA +ATDE
Sbjct: 304 DLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMSPELAISATDE 363

Query: 272 ILEIFKEVWQRHQGNLPTTDNLLFYYNNFVLRHIDMLWELLVSKINQNDPNNTLPSSFNI 331
            LE F EVWQ +Q  +   DN+L Y   +++        +          ++  P +  +
Sbjct: 364 FLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSI---------EHHLFPKTIEL 414

Query: 332 NFLTTFLSKDLLLRICKPIWKLFKNFTVSVPSSISELVLVTYQMARESVSPAVVINLCFR 391
                 +SK+L   I K  W   KNFT++VPSSI++L+ +T QMA +S+SPA++INL FR
Sbjct: 415 G-----ISKNL---IVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIINLSFR 466

Query: 392 VLIFYSATRIIPALQRRNDSELKKSRRIMKILYWYSPCVLIAMYTHLILQYSGELKKDLC 451
           ++IFYSATRIIPA+QRR   +       M  +YW+SPC+LIAMYTHLILQ+SGELKK++C
Sbjct: 467 LMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELKKNIC 526

Query: 452 LWGCNLKWLIPNQP---------ELIVDSWGFWNWCNIFFTIIIYASELFG 493
           LW C   WL  +            +IVDSW FWNWCNIF+TIIIYASEL G
Sbjct: 527 LWNCE-NWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIG 576

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  462 bits (1190), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 248/494 (50%), Positives = 322/494 (65%), Gaps = 51/494 (10%)

Query: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60
           +I  S ++ +R F    YL   LI+IPISF++GGL CGL+FT TLF +YF+STT  L+  
Sbjct: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101

Query: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120
             GS     L+  +YY QHL+I S+L++FLS F                         N+
Sbjct: 102 DRGSA----LSTLIYYLQHLLIPSILFMFLSYF------------------------ENI 133

Query: 121 SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINS 180
            S   +   +  ++   V+PW+  L +STP FTL EG FTILAIQA+GET +WL     S
Sbjct: 134 DSDTVDSEYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRS 193

Query: 181 NTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEK 240
           N W+I SLL SGG+IT SL+Y YRIYVTP+W+LS  +ASLLGFT S+V G+GLYGI    
Sbjct: 194 NQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGS 252

Query: 241 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNF 300
           GSV+ESSLFFAY+VR +YEISPK+A  A DEI +I KE W+ HQ NLP  DNLL      
Sbjct: 253 GSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----EL 308

Query: 301 VLRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVS 360
           + ++   +W    S+I ++ P N         ++      D    I  P+W   KNFT S
Sbjct: 309 MTKNYRAIW----SQIVEHTPRNH-------KYIKMM---DQCKWILNPLWNSVKNFTKS 354

Query: 361 VPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIM 420
           VP SI E+ +VT++MA+ES+ PAVVINL FR+LIFYSATRIIP LQ RN  E +  RRIM
Sbjct: 355 VPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQ-RNTKERRSFRRIM 413

Query: 421 KILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNI 480
             +YWYSPC++IAMYTHLIL+YSG+LK DLC+WGC   +    +P+++VDSW FWNWCNI
Sbjct: 414 NFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGC---FPYETEPKIVVDSWSFWNWCNI 470

Query: 481 FFTIIIYASELFGT 494
           + T++IYA EL G+
Sbjct: 471 YSTMLIYALELMGS 484

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  461 bits (1187), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 258/536 (48%), Positives = 360/536 (67%), Gaps = 48/536 (8%)

Query: 2   ISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARK 61
           +  S  + +R     FYL+  LI+IP +FKIGGL CGL+FT TLF +YFLSTT+ L+A++
Sbjct: 4   VVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKR 63

Query: 62  YGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVR--RN 119
             +NF I L+  +YY QH++IASLLY+F++ FS  +L   LS++  K D +  ++   +N
Sbjct: 64  TLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNN--KTDQLPSLLYYIKN 121

Query: 120 LSSTNSNWNLYHNYYTFF----VQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLV 175
            +S + + N ++  + ++    VQPW YLLS+STPFFTL EGFFTIL IQA+GET  WL+
Sbjct: 122 DTSKSVSQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWLL 181

Query: 176 NEINSNTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYG 235
            +     + + + L S GVI  ++++LY+IY   +W+LSIQTASLLG T+SLV  +G++G
Sbjct: 182 LKKQKKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFG 241

Query: 236 IVTEKGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLF 295
           I +  GS+IESSLF  YI+RC YEISP+L+T+AT EIL+  KE WQ HQG++  T+++LF
Sbjct: 242 IFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILF 301

Query: 296 YYNNFVLRHID--MLWELLVSKINQNDPNN----TLPSSFNINFLTTFLSK--DLLLRI- 346
           YYNN +L++I+   L+    SK N     N     +  S N N+  T ++K  DL+  I 
Sbjct: 302 YYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTN-NYTLTDITKPSDLIHLIG 360

Query: 347 -----------CKPIWKLFKNFTVSVPSSISELVLVTYQMARESVSPAVVINLCFRVLIF 395
                        PI++L K+F +++P+S++ L  VTY++A +SVSP++VINLCFRVLIF
Sbjct: 361 FKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIF 420

Query: 396 YSATRIIPALQRRNDSELKKSRRIMKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGC 455
           YSATRIIPA+QR+N  E K+SR  +K  Y +SPC++IAMYT+LILQYSGELK DLC+WGC
Sbjct: 421 YSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGC 480

Query: 456 NL------------------KWLIPNQPELIVDSWGFWNWCNIFFTIIIYASELFG 493
           ++                      PN+ E IV+SWGFWNWCNIF TI IY  EL G
Sbjct: 481 DIISKSISQRMSTINMDVGSDDTYPNR-EFIVNSWGFWNWCNIFCTIFIYGCELMG 535

>Skud_14.296 Chr14 complement(542444..543814) [1371 bp, 456 aa] {ON}
           YNL040W (REAL)
          Length = 456

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 8/49 (16%)

Query: 233 LYGIVTEKGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQ 281
           + GI+TEK +V+E S +F YI     E+S KL     DE+ EI  EV +
Sbjct: 148 MGGIITEKRAVLEPSDYFNYI-----ELSRKL---TEDEVTEISGEVNE 188

>SAKL0G05412g Chr7 (444920..445405) [486 bp, 161 aa] {ON} similar to
           uniprot|Q04082 Saccharomyces cerevisiae YDR437W Protein
           required for cell viability
          Length = 161

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 12/72 (16%)

Query: 48  IYFLSTTLSLLARKYGSNFSIFLTGFLYYSQHLIIASLLYLFLS--GFSHEDLTIPLSDD 105
           I F+S  + LL ++Y          ++ Y Q LI+  +L+++L    ++ + LT+PL D 
Sbjct: 64  IRFISEVMELLPQRY----------WITYVQCLILMGMLFIYLGLLAYNEDVLTVPLDDM 113

Query: 106 TQKVDIISDVVR 117
               D  +D+V+
Sbjct: 114 RTLTDDKADIVK 125

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,630,601
Number of extensions: 2424615
Number of successful extensions: 9836
Number of sequences better than 10.0: 59
Number of HSP's gapped: 10044
Number of HSP's successfully gapped: 60
Length of query: 501
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 387
Effective length of database: 40,409,475
Effective search space: 15638466825
Effective search space used: 15638466825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)