Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B023808.256ON1219121958480.0
NCAS0B049808.256ON1204122929040.0
Suva_10.1688.256ON1220122525710.0
YLR084C (RAX2)8.256ON1220122525420.0
Smik_12.1438.256ON1220122525340.0
Skud_12.1528.256ON1220122725300.0
ZYRO0C01804g8.256ON1209123424920.0
KAFR0B026908.256ON1210120623460.0
TDEL0F038308.256ON1195122122900.0
SAKL0H17204g8.256ON1211122622720.0
Kpol_392.108.256ON1226122622290.0
KNAG0G020008.256ON1202124020130.0
TPHA0B032508.256ON1215121320090.0
TBLA0E043908.256ON1278126918700.0
KLLA0F18975g8.256ON1200124117060.0
Kwal_56.235898.256ON1213124316710.0
AGR095W8.256ON1201123316690.0
KLTH0G13838g8.256ON1214122916610.0
Ecym_43158.256ON1212123616100.0
CAGL0L12144g8.256ON1156119316020.0
TDEL0A068406.271ON574110800.94
ABL063C3.302ON407143753.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B02380
         (1219 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...  2257   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...  1123   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   994   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   983   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   980   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   979   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   964   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   908   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   886   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   879   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   863   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   780   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   778   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   724   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   661   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   648   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   647   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   644   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   624   0.0  
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   621   0.0  
TDEL0A06840 Chr1 complement(1196243..1197967) [1725 bp, 574 aa] ...    35   0.94 
ABL063C Chr2 complement(282530..283692,283760..283820) [1224 bp,...    33   3.3  

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score = 2257 bits (5848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1138/1219 (93%), Positives = 1138/1219 (93%)

Query: 1    MLFSWVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFY 60
            MLFSWVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFY
Sbjct: 1    MLFSWVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFY 60

Query: 61   RYKGQQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXX 120
            RYKGQQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFI       
Sbjct: 61   RYKGQQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFILSGTGSL 120

Query: 121  XXXXXXXXXXXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMW 180
                             IEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMW
Sbjct: 121  SGYSLTNQLLYNLTTLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMW 180

Query: 181  DSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFN 240
            DSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFN
Sbjct: 181  DSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFN 240

Query: 241  STTVDIGQLVPLSASTWDTGESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTK 300
            STTVDIGQLVPLSASTWDTGESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTK
Sbjct: 241  STTVDIGQLVPLSASTWDTGESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTK 300

Query: 301  IRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYAN 360
            IRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYAN
Sbjct: 301  IRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYAN 360

Query: 361  TTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQN 420
            TTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQN
Sbjct: 361  TTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQN 420

Query: 421  AYAVFANDTLNEPNCNXXXXXXXXXXXANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQ 480
            AYAVFANDTLNEPNCN           ANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQ
Sbjct: 421  AYAVFANDTLNEPNCNSIESSSSSSLSANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQ 480

Query: 481  IKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYS 540
            IKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYS
Sbjct: 481  IKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYS 540

Query: 541  GYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLL 600
            GYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLL
Sbjct: 541  GYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLL 600

Query: 601  QYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVV 660
            QYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVV
Sbjct: 601  QYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVV 660

Query: 661  KLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNK 720
            KLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNK
Sbjct: 661  KLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNK 720

Query: 721  NSSITNVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSGA 780
            NSSITNVVNLTIHDTELLVIDNQAIYNV          ALQLSLWSSGSNLNRDTVFSGA
Sbjct: 721  NSSITNVVNLTIHDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSGA 780

Query: 781  IALLDYTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKTDSYSELLFS 840
            IALLDYTDLNGSIAIG                 LYTGLFLNDSLSIYASKTDSYSELLFS
Sbjct: 781  IALLDYTDLNGSIAIGNNFTVTNITNNVSSTNSLYTGLFLNDSLSIYASKTDSYSELLFS 840

Query: 841  NGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSKI 900
            NGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSKI
Sbjct: 841  NGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSKI 900

Query: 901  NGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGTQ 960
            NGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGTQ
Sbjct: 901  NGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGTQ 960

Query: 961  LLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESYE 1020
            LLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESYE
Sbjct: 961  LLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESYE 1020

Query: 1021 NGAWSTIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADGFIINGNIYDTEYGTIQAMIY 1080
            NGAWSTIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADGFIINGNIYDTEYGTIQAMIY
Sbjct: 1021 NGAWSTIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADGFIINGNIYDTEYGTIQAMIY 1080

Query: 1081 NFKEWRPYYIISSTNSQIAGQIFMNRDDSALYNSQSVLQNPNNAXXXXXXXXXXXXXXXX 1140
            NFKEWRPYYIISSTNSQIAGQIFMNRDDSALYNSQSVLQNPNNA                
Sbjct: 1081 NFKEWRPYYIISSTNSQIAGQIFMNRDDSALYNSQSVLQNPNNATVTTPSSTSSGTPSAT 1140

Query: 1141 XXXQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALNPR 1200
               QPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALNPR
Sbjct: 1141 HSSQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALNPR 1200

Query: 1201 TNEDEMLETVPPEKLMKFL 1219
            TNEDEMLETVPPEKLMKFL
Sbjct: 1201 TNEDEMLETVPPEKLMKFL 1219

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score = 1123 bits (2904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/1229 (50%), Positives = 847/1229 (68%), Gaps = 35/1229 (2%)

Query: 1    MLFSWVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFY 60
            ML   +   LLLI  + ASQLS+++  LN+T++NIP LNLT ++D++F+LLG ID LSFY
Sbjct: 1    MLIKILLGALLLIPQIYASQLSSLQENLNITHINIPNLNLT-TDDNSFELLGGIDSLSFY 59

Query: 61   RYKGQQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXX 120
            RY GQQNFT+GI+P SNSNGL YYSNNT IQL EPS D+ I +I PFGSDSFI       
Sbjct: 60   RYTGQQNFTSGILPNSNSNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFILSGKGSL 119

Query: 121  XXXXXXXXXXXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMW 180
                             ++ IFN +++ V +IL+D ++V FGGNFT+   + N HS+ +W
Sbjct: 120  GGYSLSNQLLFNLSSFSLKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALW 179

Query: 181  DSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFL-IQNTTSSQNNIF 239
            + T++ST  L F GFGENS+INSI KLNDDNILFAG+FYTLD    L + N T     + 
Sbjct: 180  NYTANSTSLLPFVGFGENSLINSITKLNDDNILFAGKFYTLDNSTLLNVVNDT-----MR 234

Query: 240  NSTTVDIGQLVPLSASTWDTGESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPT 299
            N + +++GQL+PLSA+TW +  S FD +TFVCPD T E+W Q+GT+G+L C LPF+VAPT
Sbjct: 235  NISDINLGQLIPLSAATWSSTGSFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPT 294

Query: 300  KIRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYA 359
            KIRIYNSP+ DN++SLFRI ++ ++ IMNLTYIDP+  +LKHCDAFCPLY+K +L  A  
Sbjct: 295  KIRIYNSPDPDNEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASE 354

Query: 360  NTTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQ 419
            N T  S+ I LL DNT+DI+W+Q+FQEFAF+NQ+S SS++F+AL+SYG NV LSSFQ+YQ
Sbjct: 355  NVTLSSEMIELLNDNTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQ 414

Query: 420  NAYAVFANDTLNEPNCNXXXXXXXXXXXANDWEMGLTGQTYISTTYTPNQDPVPYVSFSP 479
            +AYA+FAN++LNEP+CN            N W  G+  Q Y+ TTY P+Q  +P V+F P
Sbjct: 415  DAYAIFANNSLNEPSCNSLESFSSSDLSNNTWTRGMDDQNYVKTTYIPHQGVLPEVTFHP 474

Query: 480  QIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELY 539
             +KY GQYSI +YTPGC QD+TCSSR IVNVTVW+++  SIL+T LIYQNN +LKYDELY
Sbjct: 475  DLKYSGQYSIELYTPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELY 534

Query: 540  SGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGL 599
            SGYL+ SP++T+ Y SG+Y+  T  TVV DRLN++I+SL++     N TN+ E   LNGL
Sbjct: 535  SGYLNYSPKITVTYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLE---LNGL 591

Query: 600  LQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKV 659
             QYQ+SNFSTSS +++  ++ NTS+NQL+L  FS N S+ A LY+D TLL+G  + G+ +
Sbjct: 592  FQYQLSNFSTSSKDSSIARVANTSINQLTLTGFSSNVSLSASLYND-TLLVGAGDDGLSI 650

Query: 660  VKLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFN 719
             +LN+++ I+SS++  + G   G  SYS G+L YG++N S + + ++++NG+F+ I N  
Sbjct: 651  YELNKDLAIQSSSQQGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNI- 709

Query: 720  KNSSITNVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSG 779
              S ITN  N+TI D+ELLV DN  I+NV          +  LSLWSSGSN N DT+FSG
Sbjct: 710  -TSPITNFANITIDDSELLVFDNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSG 768

Query: 780  AIALLDYTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKTD-SYSELL 838
            A++ + +T+L+GS++I                   Y  +FLNDS++ Y  K D S SE++
Sbjct: 769  ALSQVQFTNLSGSVSIANNLSATSLRSIGSP----YAAIFLNDSVTGYVLKNDSSTSEMI 824

Query: 839  FSNGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNS 898
            FS+G  APW +   ++ M+Y ++Q+MLAV SS  + N ELSILNL +F+ +ANETLN NS
Sbjct: 825  FSDGSKAPWRWTGYVDSMLYLTNQSMLAVGSSS-SVNGELSILNLDSFKVLANETLNQNS 883

Query: 899  KINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELING 958
             +  +++FE NS+++VGGNF+I  + C GLCLYNY  N+W TF N +INGTI ++++ N 
Sbjct: 884  SVKTMVHFERNSSILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFND 943

Query: 959  TQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLES 1018
            +QL+++G+F+ ++ SSVNLA+M+L+   +  I+ G    ++ F TI D I  WN   L  
Sbjct: 944  SQLIIAGVFDTKSQSSVNLALMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFE 1003

Query: 1019 YENGAWSTIQ-SNFNSSTTIRSIEPIGFGPT----LQKRDGTGSADG-FIINGNIYDTEY 1072
            Y + +W  I  SN NSSTTI S   IG+  T    L+KRD + +++   I+ G IYD  Y
Sbjct: 1004 YTSNSWVDIPISNSNSSTTIDS---IGWTTTTDNNLKKRDNSETSNNVLIVKGQIYDNVY 1060

Query: 1073 GTIQAMIYNFKEWRPYYIISS--TNSQIAGQIFMNRDDSALYNSQSVLQNPNNAXXXXXX 1130
            G IQAMIYNF+EW PY  I+S  +++    ++F++RD S L++SQ  LQ  N        
Sbjct: 1061 GHIQAMIYNFEEWIPYLSINSLVSSANQPAELFIDRDVSKLFDSQLALQVSNTTASITAS 1120

Query: 1131 XXXXXXXXXXXXXQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDG 1190
                             +    +KKIDRGFVVLIGLALALGT+++LGI+G++LAY F+D 
Sbjct: 1121 SSTPTPTSSP-----KKKLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDD 1175

Query: 1191 DGSHDALNPRTNEDEMLETVPPEKLMKFL 1219
            DG +D + PR NEDEML+TVPPEKLM+F+
Sbjct: 1176 DGDYDVITPRVNEDEMLKTVPPEKLMEFI 1204

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  994 bits (2571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/1225 (43%), Positives = 779/1225 (63%), Gaps = 21/1225 (1%)

Query: 5    WVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKG 64
            W     LL    +ASQL +IK +L++ +  +P+LN++  ND+  Q+LG +D LSFY Y G
Sbjct: 7    WTLALPLLTLGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTG 66

Query: 65   QQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXXXXXX 124
            QQNFT  I   +NS GL+YYSNNT I LEE   DT I KITPFG+DSFI           
Sbjct: 67   QQNFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVP 126

Query: 125  XXXXXXXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTS 184
                         +  IF  S+  V+ +L++D+ VYFGGNF+  NG+   H  ++WDSTS
Sbjct: 127  LGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTS 186

Query: 185  SSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNI--FNST 242
            ++T+ L FGGFGE+S +NSIVKLNDDNILFAG+FYTLD+   L  ++T++ N     N+T
Sbjct: 187  NTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNASSTLNAT 246

Query: 243  TVDIGQLVPLSASTWDT-GESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKI 301
            T+++GQ +PL  ++WD+ G +TF+S   VCPDT++++W+  GT+GSL C LP+EVAPTKI
Sbjct: 247  TLELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKI 306

Query: 302  RIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANT 361
            R+YNSPN DN +SLF+ILTN +  IMNLTY+DPIS EL+ CD FCPLYS+  L  A  N 
Sbjct: 307  RLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNV 366

Query: 362  TSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNA 421
            +S  D I  + +N TD+KW+ +FQ+FAF N++SV+S++F AL+SYGN V LS  +LYQ+ 
Sbjct: 367  SSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDT 426

Query: 422  YAVFANDTLNEPNCNXXXXXXXXXXXA-NDWEMGLTGQTYISTTYTPNQ-DPVPYVSFSP 479
            ++ +AN++LNE  C+           + N W  GLTGQ+YI+  Y PNQ  P P V+F P
Sbjct: 427  FSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYP 486

Query: 480  QIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELY 539
             I +PG Y+IN YTPGC QD+TCSSR IVNVT+W+    +++ T LIYQNN  LKYD++Y
Sbjct: 487  SIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIY 546

Query: 540  SGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGL 599
            SGYL  SP + ++YVSG+YASNT   +VAD++N++ DSL+     S  T+      LNG+
Sbjct: 547  SGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGI 606

Query: 600  LQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKV 659
            LQYQ SNF+ ++S  T  KI NT+LN  S++ + KN+SM+AD+YD   L+LG  +  I V
Sbjct: 607  LQYQRSNFTATTSNGT--KIANTTLNLFSVDNYPKNSSMFADVYDKK-LILGGKDNHISV 663

Query: 660  VKLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFN 719
            +  N+N+++ SS   ++ G+  G +  + G+L +G+   S   + ++ +NG+F  + N++
Sbjct: 664  IDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYS 723

Query: 720  KNSSITNVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSG 779
            K  ++ N +N+T+ + +L+V +N  I+N           +  LSLWS+G+N N D +FSG
Sbjct: 724  K--AVENAINITLANNDLIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNNDNDDVLFSG 781

Query: 780  AIALLDYTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKTDSYSELLF 839
            A++ + ++DL+GS                      Y G +LN+S   YA KT+S S++ F
Sbjct: 782  AVSQMQFSDLSGSARF--LNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYF 839

Query: 840  SNGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSK 899
            SN  S  W++   I  MVY+++QT+L +  S+ +  +ELSILNL  F TIANETL  N+K
Sbjct: 840  SNNVSPSWNWSNNITKMVYANNQTLLVIG-SESSTTAELSILNLRNFTTIANETLGSNAK 898

Query: 900  INGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGT 959
            IN  +NFE NS+L+VGG+F + + NC+GLC+YNY+S  W TF N++I G I Q+   N +
Sbjct: 899  INAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNES 958

Query: 960  QLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESY 1019
            +L++SGLF  +   S+ L   +L+   +  +  G    L SF    + I+ WN   L  Y
Sbjct: 959  ELIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIY 1018

Query: 1020 ENGAWST--IQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADG--FIINGNIYDTEYGTI 1075
            ++  W+T  +  N +S +++ +I+       L+KR  T +  G   ++NGN    +YG +
Sbjct: 1019 KDQKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNL 1078

Query: 1076 QAMIYNFKEWRPYYIISSTN-SQIAGQIFMNRDDSALYNSQSVLQNPNNAXXXXXXXXXX 1134
            Q ++++ + W PY+   +   S     IF+NRD SA +NSQ  L N N            
Sbjct: 1079 QGLLFDSQNWTPYFTSETLEASSYNPTIFINRDVSADFNSQIPLSNSN---MTVTSPQST 1135

Query: 1135 XXXXXXXXXQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSH 1194
                          K+  +K +DRGFVVLIGLALALGTVS+LGI+G++LAY+FKD +G +
Sbjct: 1136 SPLSPSSSASSEPNKKSKKKNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDY 1195

Query: 1195 DALNPRTNEDEMLETVPPEKLMKFL 1219
              + PR +E+EML+TVPPEKLMKF+
Sbjct: 1196 RPIKPRIDENEMLDTVPPEKLMKFV 1220

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  983 bits (2542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1225 (43%), Positives = 788/1225 (64%), Gaps = 21/1225 (1%)

Query: 5    WVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKG 64
            W   F  L+ I +ASQL NIK++L++ +  +P LN++ +N +  Q+LG +D LSFY Y G
Sbjct: 7    WTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTG 66

Query: 65   QQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXXXXXX 124
            QQNFT  I P ++S+GL+YYSNNT IQLE+ S+DT I KITPFG DSFI           
Sbjct: 67   QQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNIS 126

Query: 125  XXXXXXXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTS 184
                         + PIFN S+  V+ +L D+S +YFGGNF+  NG+   +S ++WDS S
Sbjct: 127  VGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSIS 186

Query: 185  SSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNI--FNST 242
            ++T+ L FGGFGENS +NSIVKLN+DNILFAG+FYTLD+P  LI ++ +  N+    N+T
Sbjct: 187  NTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNSTSSLNAT 246

Query: 243  TVDIGQLVPLSASTWDT-GESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKI 301
            T+++GQ +PL  ++WD+ G +TF SD+ VCP+T E++W+   T+GSL C LP+EV+PTKI
Sbjct: 247  TLELGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYEVSPTKI 306

Query: 302  RIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANT 361
            R+YNS   D+++S+F+ILT+ +  IMNLTY+DP+S ELK+C  FCPLYS+A L  A  N 
Sbjct: 307  RLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNV 366

Query: 362  TSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNA 421
            +S  D I  + +N TD+KWT +FQ+FAF+N++ VSS++FVAL+SYG +V LS  +LYQ+ 
Sbjct: 367  SSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDT 426

Query: 422  YAVFANDTLNEPNCNX-XXXXXXXXXXANDWEMGLTGQTYISTTYTPNQ-DPVPYVSFSP 479
            ++ +AND+LNE  C+            +NDW  GLTG++YI+  Y P+Q +P+P V F P
Sbjct: 427  FSTYANDSLNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPIPRVKFYP 486

Query: 480  QIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELY 539
             I +PG Y+IN+YTPGC QD+TCS+R IVNVT+W+    +I+ T LIYQNN  LKYD++Y
Sbjct: 487  NIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIY 546

Query: 540  SGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGL 599
            SGYL  SP + +EYVSG+Y +NT   VVAD++NV+  SL+     S+ +N  +   LNG+
Sbjct: 547  SGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETLLNGI 606

Query: 600  LQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKV 659
            LQYQ SNF  +S+   + K+ NT+LN   ++ + KN+S+YAD+Y DN L++G  +  I +
Sbjct: 607  LQYQKSNF--TSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIY-DNKLVIGGVSNRISI 663

Query: 660  VKLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFN 719
            V LN++ ++ SS   ++ G+  G +  + G+L +G+   S+  + +  +NG+F  +  FN
Sbjct: 664  VDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENV--FN 721

Query: 720  KNSSITNVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSG 779
            ++ ++ + +N+++ + + +V+DN  + N           +  LSLW++G+N + D +FSG
Sbjct: 722  QSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSG 781

Query: 780  AIALLDYTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKTDSYSELLF 839
            A++ + Y +LNGS+                     Y G +LN+S + YA + DS +++ F
Sbjct: 782  AVSHMQYGNLNGSVRF--LNENEIEPLNLEGGIVPYLGAYLNESATAYAYEVDSLNKIYF 839

Query: 840  SNGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSK 899
            SN     W++  GI  M+Y+ +QT+LAV++   +  +ELSI +L     IANETL  N++
Sbjct: 840  SNEVYPSWNWSSGITQMLYADNQTLLAVSAGS-STTAELSIFDLRNLTMIANETLGSNAR 898

Query: 900  INGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGT 959
            IN L+NFE N +++VGG+F + + NC+GLCLYNY+S  W TF N++I G I Q+   N +
Sbjct: 899  INALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSS 958

Query: 960  QLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESY 1019
            +L++SGLF  +   S+ L   +L+   +  +  G    L SF    D I+ WN   L  Y
Sbjct: 959  ELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIY 1018

Query: 1020 ENGAW--STIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADG--FIINGNIYDTEYGTI 1075
             N  W  +++  N +S +++ +I       TL KR      +G   ++NGN   ++YG +
Sbjct: 1019 RNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYL 1078

Query: 1076 QAMIYNFKEWRPYYIISSTN-SQIAGQIFMNRDDSALYNSQSVLQNPNNAXXXXXXXXXX 1134
            Q+++++F++W PY+I  +TN S     IF+NRD S  +NSQS L N N            
Sbjct: 1079 QSLLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVN---ITVTSPQST 1135

Query: 1135 XXXXXXXXXQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSH 1194
                         + +  +KKI RGFVVLIGLALALGTVS+LGI G++LAY+FKD +G +
Sbjct: 1136 SSQPPSSSASSESKSKSKKKKIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDY 1195

Query: 1195 DALNPRTNEDEMLETVPPEKLMKFL 1219
              + PR +E+EML+TVPPEKLMKF+
Sbjct: 1196 KPIKPRIDENEMLDTVPPEKLMKFV 1220

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  980 bits (2534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1225 (42%), Positives = 777/1225 (63%), Gaps = 21/1225 (1%)

Query: 5    WVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKG 64
            W   FL L    +ASQL NIK++L++ +  +P LN++ +N +  Q+LG +D +SFY+Y G
Sbjct: 7    WTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFYKYTG 66

Query: 65   QQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXXXXXX 124
            QQNFT GI PG+NS+GL+YYSNNT IQLE+ S+DT I KITPFG DSFI           
Sbjct: 67   QQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSGTINNIS 126

Query: 125  XXXXXXXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTS 184
                         + PIFN S+ +V+T+L++D+ VYFGGNF+  NG+   HS ++WD+ S
Sbjct: 127  VGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVWDAMS 186

Query: 185  SSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIF--NST 242
             + + L FGGFGENS +NSI+KLNDDNI+FAG+FYTLD+   LI ++ +  N+ F  N+T
Sbjct: 187  DTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGTNSTFSLNAT 246

Query: 243  TVDIGQLVPLSASTWDT-GESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKI 301
             +++GQ + L  ++WD+ G +T  S++ VCP+    +W+   T+GSL C LP+EV+PTKI
Sbjct: 247  KLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYEVSPTKI 306

Query: 302  RIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANT 361
            R+YNS +  ++++LF+ILTN +  IMNLTY+DP+S ELK+CD FCPLYS+A L  A  N 
Sbjct: 307  RLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLAASQNA 366

Query: 362  TSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNA 421
            +S  D I  +  N TD+KW+ +FQ+FAF N++ V+S++ +AL+SYG+++ LS  +LYQN 
Sbjct: 367  SSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLELYQNT 426

Query: 422  YAVFANDTLNEPNCNX-XXXXXXXXXXANDWEMGLTGQTYISTTYTPNQ-DPVPYVSFSP 479
            ++ +AN++LNE  C+             N W  GLTG++YI+T Y P+Q +P+P V F P
Sbjct: 427  FSTYANNSLNEYGCSALVNDSSSSILSNNSWYNGLTGESYIATNYIPDQNEPIPRVKFYP 486

Query: 480  QIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELY 539
             I + G Y+IN YTPGC QD+TCSSR IVNVTVW+    +++ T  IYQNN  LKYD+++
Sbjct: 487  NIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYDQIF 546

Query: 540  SGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGL 599
            SGYL  SP + +EY+SG+Y+SNT   VVADR+NV+  SL+     S   N      LNG+
Sbjct: 547  SGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQTPLNGI 606

Query: 600  LQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKV 659
             QYQ SNF+ ++S  T  K+ NT+LN   +  + KN S+  ++Y+D  L++G  +  I  
Sbjct: 607  FQYQKSNFTGTTSNKT--KVGNTTLNLFPVNNYPKNASLLVEIYND-KLIVGGVSNRIST 663

Query: 660  VKLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFN 719
            + LNEN +I+SS   ++ G+  G +    G+L YG+   S   + ++ +N +F ++PN++
Sbjct: 664  IDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVPNYS 723

Query: 720  KNSSITNVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSG 779
            K   + +  N++I D EL V DN  I N           +  LSLW++G+N N D +FSG
Sbjct: 724  K--RVNSATNISIADNELFVFDNNYIINASSNAQISNSTSFSLSLWAAGNNGNGDVLFSG 781

Query: 780  AIALLDYTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKTDSYSELLF 839
             ++ +++++LNGS +                    Y G +LN+S+S YA +TD+ +++ F
Sbjct: 782  TVSHMEFSNLNGSASFKNEDQVQALNIGRGIVP--YFGAYLNESVSAYAYETDALNKIYF 839

Query: 840  SNGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSK 899
            SN  +  W++   I  M+Y+++QTML V SS+ +  ++L+I NL    TIANETL  N+K
Sbjct: 840  SNKVNPSWNWSNTITRMLYANNQTML-VVSSESSSTADLTIFNLRNMTTIANETLGSNAK 898

Query: 900  INGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGT 959
            ++ L+NFE NS+++VGG+F I + NCSGLCLYNY++  W TF N++I G + Q+ L N +
Sbjct: 899  VSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSS 958

Query: 960  QLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESY 1019
            +L++SGLFN +   S+ L   +L+ + +  +  G    L SF    + ++ WN   L  Y
Sbjct: 959  ELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIY 1018

Query: 1020 ENGAW--STIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADG--FIINGNIYDTEYGTI 1075
             N  W  +++ S+ +   ++ +I       TL KR    + DG   ++NGN    +YG +
Sbjct: 1019 GNQKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNL 1078

Query: 1076 QAMIYNFKEWRPYYIISSTNSQ-IAGQIFMNRDDSALYNSQSVLQNPNNAXXXXXXXXXX 1134
            Q+++++F+ W PY+I   +NS       F+NRD S  +NSQ  L N N            
Sbjct: 1079 QSLLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLN---ITVTNPQST 1135

Query: 1135 XXXXXXXXXQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSH 1194
                         + +  +KKIDRGFVVLIGLALALGTVS+LGI+G++LAY+FKD +G +
Sbjct: 1136 SSQSPSTSATSESKSKSEKKKIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDY 1195

Query: 1195 DALNPRTNEDEMLETVPPEKLMKFL 1219
              + PR +E+EML+TVPPEKLMKF+
Sbjct: 1196 KPIKPRIDENEMLDTVPPEKLMKFV 1220

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1227 (42%), Positives = 770/1227 (62%), Gaps = 25/1227 (2%)

Query: 5    WVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKG 64
            W   F  L    +ASQL NIK++L++ +  +P LN++  N +  Q+LG +D LS Y Y G
Sbjct: 7    WTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTG 66

Query: 65   QQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXXXXXX 124
            QQNFT  I PG+NS GL+YYSNNT IQ+E+ S+DT I KITPFG+DSFI           
Sbjct: 67   QQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSGTINNMP 126

Query: 125  XXXXXXXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTS 184
                         + PIF+  +  V+++LI+ + VYFGGNF+  NG+   HS ++WDS S
Sbjct: 127  IGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSIS 186

Query: 185  SSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLI---QNTTSSQNNIFNS 241
            + T+ L FGGFGENS +NSI+KLNDDNILFAG+FYTLD+   LI    N T++  ++ N+
Sbjct: 187  NKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGSNNTTNSTSLLNA 246

Query: 242  TTVDIGQLVPLSASTWD-TGESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTK 300
            T +++GQ +PL  +TWD  G +TF+S++ VCP+  E++W+   T+G+L CKLP+EV+PTK
Sbjct: 247  TKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPYEVSPTK 306

Query: 301  IRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYAN 360
            +R+YNS + D ++S+F+ILTN +  IMNLTY+DP+S +LK+CD FCPLYS+A L  A  N
Sbjct: 307  VRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQN 366

Query: 361  TTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQN 420
             +SP D I  L +N TD+KW+ +FQ+FAF N++ V+ ++F A++SYG +V LS  +LYQ+
Sbjct: 367  VSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQD 426

Query: 421  AYAVFANDTLNEPNCNXXXX-XXXXXXXANDWEMGLTGQTYISTTYTPNQD-PVPYVSFS 478
             ++ +AN++LNE  C+            +N W  GL G++YI+T Y PNQD P P V+F 
Sbjct: 427  TFSTYANNSLNEYGCSALANDSSSSTLSSNSWYNGLGGESYIATEYVPNQDEPTPRVNFY 486

Query: 479  PQIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDEL 538
            P I +PG Y IN YTPGC QD TCSSR IVNVT+W+    +++ T  IYQNN  LKYD++
Sbjct: 487  PNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQI 546

Query: 539  YSGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNG 598
            YSGYL  SP + +EYVSG++ SNT   VVAD++NV+   L+     S   N  E + LNG
Sbjct: 547  YSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEYIPLNG 606

Query: 599  LLQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIK 658
            +LQYQ SNF++++S  T  KI NT+LN  +++ +  N+S++AD   D  L+LG +N  I 
Sbjct: 607  VLQYQKSNFTSTTSNET--KIGNTTLNVFAVDNYPNNSSLFADTNGDR-LILGGTNNHIS 663

Query: 659  VVKLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNF 718
            ++ LN+N+++  S +  + G+  G +  S G+L +G+   S+  + ++ +NG+F  +  F
Sbjct: 664  IIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVLLFNGSFENV--F 721

Query: 719  NKNSSITNVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFS 778
            N + ++ + +N+++ + +L+V DN  I N           +  LSLWS+GSN N D +FS
Sbjct: 722  NYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFS 781

Query: 779  GAIALLDYTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKTDSYSELL 838
            GA++ + +  LNGS                      Y   +LN+S + YA +T+  +++ 
Sbjct: 782  GAVSRMQFGGLNGSARF--LSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIY 839

Query: 839  FSNGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNS 898
            FSN     W++   I  M+Y+++Q++L V S   +  +ELSI NL  F  IANET+  N+
Sbjct: 840  FSNNVDPSWNWSTSITRMLYANNQSLLTVGSES-STTAELSIFNLKNFTMIANETMGSNA 898

Query: 899  KINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELING 958
            KIN L+NFE NS+L+VGGNF + + NCSGLCLYNY+S  W TF N++  G I Q+     
Sbjct: 899  KINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAA 958

Query: 959  TQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLES 1018
            +QL++SGLF+ +   SV LA  +L+   +  +  G    + SF    + I+ WN   L  
Sbjct: 959  SQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLI 1018

Query: 1019 YENGAWSTIQSNFNSSTTIRSIEPI--GFGP-TLQKRDGTGSADG--FIINGNIYDTEYG 1073
            Y +  W+ I S   + ++I S+  I    GP TL +R    + +G   +++GN    +YG
Sbjct: 1019 YRDQEWN-ITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYG 1077

Query: 1074 TIQAMIYNFKEWRPYYIISSTN-SQIAGQIFMNRDDSALYNSQSVLQNPNNAXXXXXXXX 1132
             +Q ++++F+ W PY++  S+N S     IF+NRD S  +NSQ  L N N          
Sbjct: 1078 NLQGLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPLSNLN----VTETGP 1133

Query: 1133 XXXXXXXXXXXQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDG 1192
                            K   +K+IDRGFVVLIGLALALGTVS+LGI G++LAY+FKD +G
Sbjct: 1134 QSASSQFPSSSASSELKPKSKKRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEG 1193

Query: 1193 SHDALNPRTNEDEMLETVPPEKLMKFL 1219
             +  + PR +E+EML+TVPPEKLMKF+
Sbjct: 1194 DYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  964 bits (2492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1234 (41%), Positives = 743/1234 (60%), Gaps = 40/1234 (3%)

Query: 1    MLFSWVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFY 60
            MLF  + +F  L+ I   SQLS+++ +LN +N+ +P L+LT+S +   +LLGD   L+FY
Sbjct: 1    MLFFALLSFYFLLAITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFY 60

Query: 61   RYKGQQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXX 120
            +Y GQ+NFT+ +   ++S+GLIYYSN+T +QL   SNDT I +I P G DSFI       
Sbjct: 61   KYTGQENFTSPLNSSTDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHI 120

Query: 121  XXXXXXXXXXXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMW 180
                              +PIF   + EV +IL+D  LVYFGGNFT  NG+   HS+++W
Sbjct: 121  DGYNLQRQLHYNLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLW 180

Query: 181  DSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFN 240
            +S  +ST  L F GFG+NS +NSI++L+ DNILFAG FY LD+   L       +N+I  
Sbjct: 181  NSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLL-------ENHILG 233

Query: 241  S---------TTVDIGQLVPLSASTWDTGESTFDSDTFVCPDTTEESWIQSGTTGSLTCK 291
            S         T V++G  +PL  + W +  S FD+D F+CPD   ESW+QSGT+GSL C 
Sbjct: 234  SNNSSSKSNWTDVELGLAIPLQNANWTSSSSQFDADDFICPDPERESWLQSGTSGSLACS 293

Query: 292  LPFEVAPTKIRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSK 351
            LP E  P KIRIYNSP EDN+VSLFRIL    +GI+NL+Y+DP   EL++CDAFCPLY++
Sbjct: 294  LPQETTPYKIRIYNSPVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNR 353

Query: 352  AILSQAYANTTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVA 411
              L +A +N++S  +      +NTTDIKW ++FQEFAF+N + +SSV+FVAL SYG+NV 
Sbjct: 354  QRLEEASSNSSSVENMTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVG 413

Query: 412  LSSFQLYQNAYAVFANDTLNEPNCNXXXXXXXXXXXANDWEMGLTGQTYISTTYTPNQDP 471
            LSS+Q +Q+  +++AN++LN+P C             NDW  GL GQTY+ST+Y  +Q  
Sbjct: 414  LSSWQFFQSRASIYANNSLNQPACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGN 473

Query: 472  VPYVSFSPQIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNK 531
            +P V+F PQI+YPG YSI +YTPGC  D TC+ RAIVNVT+WD D    L++E+IY+NN 
Sbjct: 474  IPRVTFHPQIQYPGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNN 533

Query: 532  ELKYDELYSGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNT 591
            ELKYDEL+ G+L SSP+VT+EY S +Y +N  + VVAD +     SLE         +  
Sbjct: 534  ELKYDELWDGHLKSSPKVTLEYHSPIYPNNPTSVVVADYI-----SLEAKSFDHFEKHKK 588

Query: 592  EIMNLNGLLQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLG 651
            +I  LNG+ QYQISNF+ +    T   I NTSL+   L  FS N+S++A LY+++TLLL 
Sbjct: 589  DIT-LNGIFQYQISNFTKN---ITKESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLA 644

Query: 652  NSNGGIKVVKLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGT 711
            +S      +KL++N  ++SS   +L     G  SYS G++ +G+YN S +    +++NG+
Sbjct: 645  DSKSKAAEIKLDKNWSVDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGS 704

Query: 712  FNEIPNFNKNSSITNVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNL 771
            FN     N+  S+    N+ +  TELLV DN+  YNV             LS+WS+G N 
Sbjct: 705  FNSYDKINR--SVERFTNIDLKGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNT 762

Query: 772  NRDTVFSGAIALLDYTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKT 831
            N D +FSGA++  DY +L G +++                   Y G +LND+L+ YA K 
Sbjct: 763  NGDLIFSGAVSDNDYENLQGPVSL--FQNGSAVSSNIKDNINPYMGAYLNDTLTAYAYKD 820

Query: 832  DSYSELLFSNGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIAN 891
             S S ++FSNG   PW +   I  M+Y +   +LA+ +S      +LS+LNLTT E +AN
Sbjct: 821  GSDSRIVFSNGDEGPWRWTNSIETMIYRNRDALLALGTSSSPSLPQLSVLNLTTSEVLAN 880

Query: 892  ETLNVNSKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIA 951
            ETL+  +++N +I F  NSTL++GGNF+   ++C+GLCLYNY +  W TFAN SI G + 
Sbjct: 881  ETLDKGAEVNSMILFGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVT 940

Query: 952  QMELINGTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITW 1011
            Q++L N ++LL++G       S VNL  ++++   + ++  G    L+SF    D+++ W
Sbjct: 941  QVQLRNSSELLIAGSLRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVW 1000

Query: 1012 NGIMLESYENGAWSTIQ-SNFNSSTTIRSIEPIGFGPTLQKRDGTGS---ADGFIINGNI 1067
            N   L +Y+N +W  I  SN  S T ++ I  +    +L+KR  + S    DG ++ GN 
Sbjct: 1001 NDTSLMAYDNTSWRHISTSNSTSFTKLQDIHQVSLEHSLEKRANSSSNSNLDGLLVYGND 1060

Query: 1068 YDTEYGTIQAMIYNFKEWRPYYIISST--NSQIAGQIFMNRDDSALYNSQSVLQNPNNAX 1125
              T+  + QA IY++  W P +I +S   NS     IFMN+D S  + S+ +L NP N  
Sbjct: 1061 -KTQGDSYQASIYDYYSWTPLFIANSKSENSNSGPNIFMNQDVSDFFISEQMLPNPTNHT 1119

Query: 1126 XXXXXXXXXXXXXXXXXXQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAY 1185
                              + H        K+DRG+VVLIGLALA+GTV ++G+ G+++AY
Sbjct: 1120 SSRSSSSSSSAVTSNSGDKKHRASH----KVDRGYVVLIGLALAIGTVVVIGVFGILIAY 1175

Query: 1186 IFKDGDGSHDALNPRTNEDEMLETVPPEKLMKFL 1219
            +F +  G ++ L+P     +  ET PP K  KFL
Sbjct: 1176 MFGEDIGGYEFLSPPAEGTKAAETAPPAKSSKFL 1209

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1206 (43%), Positives = 770/1206 (63%), Gaps = 19/1206 (1%)

Query: 18   ASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTGIIPGSN 77
            ASQLS ++N L +     P L  +++ND + QLLG  D LS Y Y GQQNF+  I P +N
Sbjct: 20   ASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTN 79

Query: 78   SNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXX 137
            SNGL+YYSNNTLIQL +  +DT I  I P GSDSFI                        
Sbjct: 80   SNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLS 139

Query: 138  IEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGGFGE 197
            + PIFNT++E+V++IL+D+ LVYFGGNFT  NGT + HS+ +W+ TS+ST  L F GFGE
Sbjct: 140  VYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGE 199

Query: 198  NSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNSTTVDIGQLVPLSASTW 257
            NS IN+I++LNDDNILFAGEFYTLD+   L  NT+++  NI++   +++  L+PL+ +TW
Sbjct: 200  NSSINNILRLNDDNILFAGEFYTLDDASLLTSNTSNATTNIYD---LELSPLLPLNEATW 256

Query: 258  DTGESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKIRIYNSPNEDNQVSLFR 317
             +  S FD+ +F+C +   ++W  SGTTG+L C LP++ A TKIRIYNSP+  NQ+S FR
Sbjct: 257  SSDVSDFDASSFICVNPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFR 316

Query: 318  ILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLADNTTD 377
            ++++ +  IMN+TYIDP +  L+HCD++CPL S+  LS A ++  S S+   LL+DN T 
Sbjct: 317  LISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSA-SDAASVSEMARLLSDNATV 375

Query: 378  IKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNEPNCNX 437
            IKW+ E+QEF F+N +S + +QF+AL+SYG+NVAL+ + LYQ+ YAVFAN++LN  +C  
Sbjct: 376  IKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTS 435

Query: 438  XXXXXXXXXXA-NDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPGQYSINIYTPGC 496
                      + NDW  G +GQTY++T YT   DP+P V+F+  + Y G Y IN+YTPGC
Sbjct: 436  NNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGC 495

Query: 497  TQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSSSPRVTIEYVSG 556
            + D TCS+R +VNVTV+D    SIL+T  IYQNN+ LKYDEL+SGYL +S R+ +EYVSG
Sbjct: 496  SDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSG 555

Query: 557  LYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQISNFSTSSSETTD 616
            + + +T  TVVADR N+ + SL++ G  S+  N + +  LNGL QYQ+SN  +S+  ++ 
Sbjct: 556  ISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGSTVA-LNGLFQYQLSN-FSSTFNSSS 613

Query: 617  VKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLNENMDIESSNEASL 676
             K+  T LNQ  L+ F+ N+S++A  Y DN LL+G +   +  ++ + +++  +S+ + +
Sbjct: 614  AKVGKTFLNQYPLDIFNTNSSLFASTY-DNYLLVGGAEQSVYALESSNDLNFSTSDNSGV 672

Query: 677  TGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSSITNVVNLTIHDTE 736
             G       +S GI  YG +NLS      V YNG+FN    +  NSSI    N+T  ++E
Sbjct: 673  EGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQY-GNSSIDTFKNVTFGNSE 731

Query: 737  LLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSGAIALLDYTDLNGSIAIG 796
            +LV +N  +YNV          +L LSLWS+G+N N D +F+GA + + Y+  N SI IG
Sbjct: 732  ILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDLLFNGASSQMSYSFNNESINIG 791

Query: 797  XXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKTDSYSELLFSNGYSAPWSFFEGINYM 856
                              Y GL++N S   Y  + D  + + F+NG    W +   +   
Sbjct: 792  ANNIVQGLNFNESIDP--YLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAA 849

Query: 857  VYSSHQTMLAVASSDFNKNSE-LSILNLTTFETIANE-TLNVNSKINGLINFEHNSTLIV 914
            +YS +Q++L   +S   ++S  L++LN TT++ IANE   +  S+I+G++NF  N+T I+
Sbjct: 850  IYSDNQSLLIAGTSSSLESSSFLTVLNTTTYDVIANESLSSQQSQISGIVNFASNATAII 909

Query: 915  GGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGTQLLLSGLFNAQNISS 974
            GGNF++   NC GLCL+NY ++ W +FA+ SINGT+  M+L N ++L++SGLF+ +NISS
Sbjct: 910  GGNFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISS 969

Query: 975  VNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESYENGAWSTIQ-SNFNS 1033
            + +A ++L    ++++K G++N  +SF     KI+ WN   L  YE+  W+  + SN NS
Sbjct: 970  ITMASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERISNINS 1029

Query: 1034 STTIRSIEPIGFGPTLQKRDGTGSADGFIINGNIYDTEYGTIQAMIYNFKEWRPYYIISS 1093
            S+ + ++  +     L KRD T S+D  +++G +YD  YG IQAM+Y+F  W PY +I+S
Sbjct: 1030 SSVVDNLNYVTLASALSKRD-TSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYLLINS 1088

Query: 1094 TNSQIAGQIFMNRDDSALYNSQSVLQNPNNAXXXXXXXXXXXXXXXXXXXQPHHQKQVGR 1153
              S  +   F++RD S+  N+Q  L   +                      P+   +  +
Sbjct: 1089 -ESDSSINAFIDRDMSSFTNTQVALLTNSGTVSNSSSSTTSPGASASATSIPN---KTHK 1144

Query: 1154 KKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALNPRTNEDEMLETVPPE 1213
            +KIDRGFVVL+GLALALGTV++LGI G+++AY+F+D +G+++ +NPR +E+EM+ETVPPE
Sbjct: 1145 RKIDRGFVVLLGLALALGTVAVLGIAGVIMAYVFRDDNGAYEPINPRIDENEMIETVPPE 1204

Query: 1214 KLMKFL 1219
            KLMK++
Sbjct: 1205 KLMKYI 1210

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1221 (40%), Positives = 738/1221 (60%), Gaps = 41/1221 (3%)

Query: 9    FLLL--IHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQ 66
            FLL   + +  ASQL N+KN   + N+  P L+      +  QL G  + L+F +Y+GQ+
Sbjct: 6    FLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFPG---EALQLFGGFNALTFPQYEGQE 62

Query: 67   NFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXXXXXXXX 126
            NFT  I   ++S G++YYSN+T I+L   S+D+Y+ KI PFGS+SFI             
Sbjct: 63   NFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPFGSESFILGGSGSLLGYELG 122

Query: 127  XXXXXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSS 186
                       + PIF  S+ +V+ IL D  + YFGGNF+  NG++  HS+  W+S+S++
Sbjct: 123  RQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSSNT 182

Query: 187  TEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNSTTVDI 246
            T  L FGGFGE SI+NSI+KL+ DNILF GEFYTLD+   LI N  +S+ N  +S +++I
Sbjct: 183  TSLLPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTN--HSQSIEI 240

Query: 247  GQLVPLSASTWDTGESTFDSD-TFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKIRIYN 305
             +L+PL A+TW+T   +      F+CP++ +E+W    T+GSL   LP+E  P K+RIYN
Sbjct: 241  NELLPLRAATWNTDSDSSFDSSAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYN 300

Query: 306  SPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPS 365
            SP E N VSLFRI+T  + GIMNLTY+DP+S EL +CDAFCPL  +  L  A AN  +  
Sbjct: 301  SPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNT-- 358

Query: 366  DTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVF 425
              +  L +N TDI+W+ ++Q+FAF+N+I+V+ +QF+AL SYG+ V LSSFQLYQ+    +
Sbjct: 359  SQVVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTY 418

Query: 426  ANDTLNEPNCNXXXXXXXXXXXANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPG 485
            AN++LNE  C             ++W+ GL GQ+Y+   +   Q+ +P V+F P I Y G
Sbjct: 419  ANNSLNEVGCESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAG 478

Query: 486  QYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSS 545
            QY++N+YTPGC+ D TC+SR+IVNVT+W   G SIL++ L++QNN+ +KYD++YSG+L +
Sbjct: 479  QYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLET 538

Query: 546  SPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQIS 605
            +P +T+EY S +  +N    VVADRL V+++S+++     N T+  E + LNG+ QYQ+S
Sbjct: 539  APVLTLEYYSPISPNNPSNVVVADRLEVIVESVDI---LKNQTD--ETIPLNGMFQYQLS 593

Query: 606  NFSTSSSETTDVK--ITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLN 663
            NF+ S    TD K  I NT+LN  +++ F KN S+++ +Y +NTL +G S  G+  V+L+
Sbjct: 594  NFTNS----TDSKPSIANTTLNSYTVQNFPKNASLFSSMY-NNTLWVGGSVSGVAAVELD 648

Query: 664  ENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSS 723
            E++ + S+ + +  G   G SSYS GI+ +G +NLSS+    + +NG F    N    ++
Sbjct: 649  EDLHVSSTAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNL--ETT 706

Query: 724  ITNVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSGAIAL 783
            +    N++    ELLV +N+ ++N+             LSLWS+G N   DT+FSGA+  
Sbjct: 707  LRTYTNVSFQQDELLVFNNEYVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAVTK 766

Query: 784  LDYTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKTDSYSELLFSNGY 843
              +  L GS +I                   Y    LNDS++ YA +  S S+L F NG 
Sbjct: 767  NQFPGLYGSASI--YSNSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGK 824

Query: 844  SAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSKINGL 903
              PW++F  IN M YS + T+LA+ +        LS+ NLT+F+ +AN T++ N  I+ +
Sbjct: 825  EGPWTWFGTINSMRYSKNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSM 884

Query: 904  INFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGTQLLL 963
            + F+ NS+L+VGG++ I  ++CSGLCLYNYD  +W  FAN+SI G I +M+L     LL+
Sbjct: 885  VFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLI 944

Query: 964  SGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESYENGA 1023
            SG  N  N +SVNL   ++S Y V+ +       ++SF    + IITWN   L  Y +G 
Sbjct: 945  SGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGD 1004

Query: 1024 WSTIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSA-DGFIINGNIYDTEYGTIQAMIYNF 1082
            W  ++ + +S  +I  +  +   P L KR    S  D  ++ G  Y  EY   QA IYNF
Sbjct: 1005 WQNLEFDNSSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQNY-AEYP--QASIYNF 1061

Query: 1083 KEWRPYYIISSTNSQIAGQ--IFMNRDDSALYNSQSVLQNPNNAXXXXXXXXXXXXXXXX 1140
            + W PYY+ +  + +   +   F N+DDS LY+SQ++L +P                   
Sbjct: 1062 QRWLPYYVANKADDEDPSRTTFFTNQDDSQLYDSQNLLSDPTRTTTSSSSSTTSSSQTS- 1120

Query: 1141 XXXQPHHQKQVGRK--KIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALN 1198
                   +  + RK  KI+RGFVVLIGLALALGTV ++GI G++LA +F +G   ++ ++
Sbjct: 1121 -----PSKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVF-NGHSGYEQVD 1174

Query: 1199 PRTNEDEMLETVPPEKLMKFL 1219
            PR +E EM++TVPPEKL+KFL
Sbjct: 1175 PRADESEMIDTVPPEKLLKFL 1195

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1226 (40%), Positives = 746/1226 (60%), Gaps = 46/1226 (3%)

Query: 12   LIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTG 71
            L  ++  SQLS++K  LN+ +++IP ++L++S +D   LLGD + L+FYRY GQ+NFT  
Sbjct: 14   LCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGS 73

Query: 72   IIPGSNSNGLIYYSNNTLIQLEEPSNDTYIA---KITPFGSDSFIXXXXXXX-XXXXXXX 127
            I        LIYYSN T I+L+  S++   A    I PFG DSFI               
Sbjct: 74   ITE--TEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQ 131

Query: 128  XXXXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSST 187
                         IFN SI  V  IL DD +VYFGG F    G S  HS+++W+ST++  
Sbjct: 132  QLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEI 191

Query: 188  EFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNSTTVDIG 247
            + L F GFG +S++NSI++L++DNI+FAG+F TLD+   L Q      N+  N+T ++  
Sbjct: 192  QLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQ--IRGSNSSKNATDIEFD 249

Query: 248  QLVPLSASTWDTGESTFDSDTFVCPDTTEESWIQSGT-TGSLTCKLPFEVAPTKIRIYNS 306
            QL+PL  + W + + + +  + +CP    + W Q GT TG  T  L  ++ P+K+RIYN+
Sbjct: 250  QLIPLKHAGW-SSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIYNA 308

Query: 307  PNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSD 366
             + D QVSLFRI+T+ A GIMNLTY+DP + EL +CDA+CPL S  +L QA AN T  SD
Sbjct: 309  FDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSD 368

Query: 367  TIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFA 426
            ++  + +N T+IKWT  +QEFAF+N++SV S+ F+ALDSYG++V L  F++YQN Y  FA
Sbjct: 369  SVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFA 428

Query: 427  NDTLNEPNC-NXXXXXXXXXXXANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPG 485
            NDTLN+PNC N              W  G    +YI +TY    D +P V+F P I Y G
Sbjct: 429  NDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGD-LPSVNFYPNITYAG 487

Query: 486  QYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSS 545
             Y++N+ TPGCT D +CSSR IVNVTVWD    ++L+T+LIYQNN + KYD LYSGYL S
Sbjct: 488  DYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYLES 547

Query: 546  SPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQIS 605
            +P++T+++   +   ++ + +VADR++V+IDS++   +     N T    LNGL QYQIS
Sbjct: 548  APKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINET----LNGLFQYQIS 603

Query: 606  NFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLNEN 665
            NF+T S+++  +KI NT++N+ S+E    N+ ++A  Y +NTLL+  +  GI V++LN++
Sbjct: 604  NFTTISNDS--LKIGNTTINRYSIENVPSNSELFAGYY-NNTLLVDGAFNGIAVLQLNDD 660

Query: 666  MDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSSIT 725
            ++I S       G T G ++YS G+L  G++NLSS+    ++YNGTF+   N   N  IT
Sbjct: 661  LNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTN--IT 718

Query: 726  NVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSGAIALLD 785
               N+TI D+ELLV +N+ I+NV          +  LSLWS+GSN   D +  GA++   
Sbjct: 719  RFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQ 778

Query: 786  YTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYA--SKTDSYSELLFSNGY 843
            YT+LNG++ I                  +YT  ++NDS + YA  SK DS   +L + G 
Sbjct: 779  YTELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGN 838

Query: 844  SA---PWSFFEGINYMVYSSHQTMLAVASSDFNKN-SELSILNLTTFETIANETLNVNSK 899
             +   P S+   +N M+Y+   ++LAV ++  + N + LS+ N++  + I  E L   S 
Sbjct: 839  RSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSS 898

Query: 900  INGLINFEHNSTLIVGGNFTILQ--SNCSGLCLYNYDSNEWLTFANHSINGTIAQMELIN 957
            +N ++ F  NS+L+VGG+FTI +  ++CSGLCLYNY++++W  F N+SI+G I  ++  N
Sbjct: 899  VNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFN 958

Query: 958  GTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIG---DKIITWNGI 1014
            GTQLL+SG    +N + +NLA +++++  V+ ++ G + ++QSF T     D++IT +  
Sbjct: 959  GTQLLISGNLYTENETGINLAKLNMASNEVTILRHG-STMVQSFVTFDHTTDELITQSDN 1017

Query: 1015 MLESYENGAWSTIQS-NFNSSTTIRSIEPIGFGPTLQKRDGTGSADGFIINGNIYDTEYG 1073
             +  Y NG W  + S +FN S  + + + I    T  KRD +  A   ++NG++  + YG
Sbjct: 1018 EISYYTNGEWKNLTSEDFNDSLYMGA-QLIPLKQTSSKRDVSNRA--LLVNGDLKHSTYG 1074

Query: 1074 TIQAMIYNFKEWRPYYIISSTNSQIAGQIFMNRDDSALYNSQSVLQNPNNAXXXXXXXXX 1133
            ++ AM+Y+F++W PY+I+   N+  A  IFMN+D S+LY +Q++LQ              
Sbjct: 1075 SVSAMLYDFEDWMPYFIVDGENAGRASNIFMNKDLSSLYTTQTILQG---------SNTS 1125

Query: 1134 XXXXXXXXXXQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGS 1193
                      +   + +    KIDRGFVVLIGLALA+GTV++LG  G ++AY F    G 
Sbjct: 1126 TSTTSSNMPSETSDKNESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFAGNKGQ 1185

Query: 1194 HDALNPRTNEDEMLETVPPEKLMKFL 1219
            ++ L PR +E +M++TVPPEKLMKF+
Sbjct: 1186 YEPLKPRVDEGDMIDTVPPEKLMKFV 1211

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1226 (40%), Positives = 746/1226 (60%), Gaps = 26/1226 (2%)

Query: 10   LLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFT 69
            L +I + QASQL+N+K+ L +  VNIP +N   +N++  Q+L +I+GL+FY+Y+GQQNFT
Sbjct: 11   LGIIGVSQASQLTNVKDSLGINTVNIPQINFGNTNNE-IQILSNIEGLTFYQYQGQQNFT 69

Query: 70   TGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXXXXXXXXXXX 129
              I   SN++GLIYYSN+TLI+L E S++T I +I P   D+FI                
Sbjct: 70   GSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQL 129

Query: 130  XXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEF 189
                    I P+FN  ++ +K+IL+D  +VYFGGNF+  +     +S+I W+  + + + 
Sbjct: 130  LYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDM 189

Query: 190  LNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTS-----SQNNIFNSTTV 244
            L F GFG+NS +NSI+KL++DN+LF G+F TLD+   L+ N T+     S ++    T +
Sbjct: 190  LPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVSNITTYTQQNSTSSSSTETNL 249

Query: 245  DIGQLVPLSASTWDTGESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKIRIY 304
            ++ Q + L  ++W +      S  F+CP+   E+W  +GTTG +TC L FE + +KIRI+
Sbjct: 250  ELEQQISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIF 309

Query: 305  NSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSP 364
            NSP E +Q++ FRI+T  + GIMNLTY+DP++ E+K+CDAFCPLYS   L  +  N T+ 
Sbjct: 310  NSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQASSENATTS 369

Query: 365  SDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAV 424
            + T   +  N T+I W+ ++QEFAF+NQ+ V+++Q +AL SYG+NV LS FQLYQN+Y++
Sbjct: 370  ASTSAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSI 429

Query: 425  FANDTLNEPNCNXXXXXXXXXXXAND-WEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKY 483
            FAN++LNEP C+           +N+ W  GL  Q+YI+T YTP  DP P V+F P I  
Sbjct: 430  FANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINR 489

Query: 484  PGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYL 543
             G Y++NIYTPGCT D TCS R IVNVT+WD+    +++T LIYQNN E+KYD+L+ G+L
Sbjct: 490  IGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFL 549

Query: 544  SSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMN--LNGLLQ 601
              +P+VT+EY SG+   N+   VVAD ++++  ++E+     N T++TE +   LNG+ Q
Sbjct: 550  DYAPKVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTEELKVPLNGMFQ 609

Query: 602  YQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVK 661
            YQ+SN  TSS+  + +K+ NTSLN   + +FS + S+Y   Y++ TLLLG S  G+  + 
Sbjct: 610  YQLSN-FTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEYNE-TLLLGGSIAGVYALS 667

Query: 662  LNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKN 721
            L+   +I S+      G   G  +Y+GG++ +G +N+S++I   ++YNGTF+   N N N
Sbjct: 668  LSNYTNIRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSLSYNGTFDSFGNVNSN 727

Query: 722  SSITNVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSGAI 781
              I    NLT  ++E+L  +N+  +N           AL LS+WS+GSN   DT+FSG I
Sbjct: 728  --IATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLI 785

Query: 782  ALLDYTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKTDSYSELLFSN 841
               ++ +LN S  +                   Y G++LNDSL+ Y   + S S +LFSN
Sbjct: 786  TRNEFPNLNNSAVL--TGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFSN 843

Query: 842  GYSAPWSFFEGINYMVYSSHQTMLAVAS-SDFNKNSELSILNLTTFETIANETLNVNSKI 900
            G    W+    ++   YS ++TM   +S S+ +  +EL +LN TT + + NET +VNS I
Sbjct: 844  GLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSI 903

Query: 901  NGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGTQ 960
            N +++F  NS+L+VGG+FT   +NCS LCL N  +N+W +F+N   +GTI  +E  N ++
Sbjct: 904  NSIVSFGRNSSLLVGGDFTAPNTNCSNLCLLNLGNNQWSSFSNK-FDGTITGLEFANDSR 962

Query: 961  LLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESYE 1020
            LL+SG +  +N S ++L  +DL+     S+ + D+  + SF      I+ W+   + SY 
Sbjct: 963  LLISGSYRFENQSGISLGYIDLNNQEFKSL-LSDSQKVNSFNYNNGTIVAWDSSTIYSYR 1021

Query: 1021 NGAWSTIQ-SNFNSSTTIRSIEPIG---FGPTLQKRDGTGSADGFIINGNIYDTEYGTIQ 1076
              +WS  Q  N NSST+I++++ +       +        + +  ++ G +Y  +YG +Q
Sbjct: 1022 GDSWSNHQIPNTNSSTSIKNVQIVSKLNNSLSTNNTSNNLNDELILVFGELYSEDYGFVQ 1081

Query: 1077 AMIYNFKEWRPYYII---SSTNSQIAGQIFMNRDDSALYNSQSVLQNPNNAXXXXXXXXX 1133
            AM Y+F+ W PYYI    SS N+     +FMN+D S LY SQ VLQNPN+          
Sbjct: 1082 AMFYDFQNWIPYYITQPYSSLNTS-KNSLFMNKDISLLYESQVVLQNPNSTISISSTSSS 1140

Query: 1134 XXXXXXXXXXQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGS 1193
                          +      KI RG+VVLIGLALA+GTV++LGI G+ +AYIF D  G 
Sbjct: 1141 SATTRSSSTSSTSLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGE 1200

Query: 1194 HDALNPRTNEDEMLETVPPEKLMKFL 1219
            +  + PR +E EML+TVPPEKLMKF+
Sbjct: 1201 YVRIKPRIDEHEMLDTVPPEKLMKFI 1226

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/1240 (38%), Positives = 712/1240 (57%), Gaps = 67/1240 (5%)

Query: 1    MLFSWVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFY 60
            M  S V+     + I +AS L N++ ILN T V +PT ++   N+  FQ+L DI+G+SFY
Sbjct: 1    MWCSVVYCLWFAVAITRASNLENVRRILNATEVTVPTFDVGNKNNQ-FQILDDINGISFY 59

Query: 61   RYKGQQNFTTGIIPGSNSNGLIYYSNNTLIQLEEP-SNDTYIAKITPFGSDSFIXXXXXX 119
             Y GQQNFTT     ++   LIYYSN T + L +  + +  I  I P G DSFI      
Sbjct: 60   EYLGQQNFTTDA-NVTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGM 118

Query: 120  XXXXXXXXXXXXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIM 179
                              I  IF+T +  ++ + +D  LVYF GNFT  N T      IM
Sbjct: 119  INNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFMGNFTFNNNTG----AIM 174

Query: 180  WDSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIF 239
            WDS   S   L F GFG  + INSI+KLNDDNILFAG F T+     L+Q+  S ++ + 
Sbjct: 175  WDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEES-VR 233

Query: 240  NSTTVDIGQLVPLSASTWDT-GESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAP 298
            N+T++ +   VPL  S W T GE   DS   +CPD +++SW  S TTG  TC+LPF++ P
Sbjct: 234  NTTSLLLNPSVPLQYSQWKTNGE--LDSSQLICPDPSKDSWSVSATTGDFTCELPFQITP 291

Query: 299  TKIRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAY 358
            +KIRIYNSP++D+QVSLFR LT  A  IMNLTY+DP+S  +  CDAFCPLYSK +L   +
Sbjct: 292  SKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQW 351

Query: 359  ANTTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLY 418
             NT + ++T+ ++ +N+T+I+WT  +QEFA ++ ++ +S++F AL SYGNN+ L+ FQ+Y
Sbjct: 352  DNT-AEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIY 410

Query: 419  QNAYAVFANDTLNEPNCN-----XXXXXXXXXXXANDWEMGLTGQTYISTTYTPNQDPVP 473
            Q +++ F N++ N PNCN                 N+W     G+ Y++  YTPN++PVP
Sbjct: 411  QASFSAFGNNSFNTPNCNNNDKDSNNTFTSSSLSPNNWTS--VGE-YLTVGYTPNENPVP 467

Query: 474  YVSFSPQIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKEL 533
             V++   I++ G+YSIN++TPGC+ D+TCS+R IVN T++D+    +LAT LIYQNN E+
Sbjct: 468  KVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEI 527

Query: 534  KYDELYSGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEI 593
            KYD LYSG L+SS  +T+ Y SGLYASNTV T+VADR+++ I S+++       ++ TE+
Sbjct: 528  KYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDL-------SHRTEV 580

Query: 594  --MNLNGLLQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLG 651
              + LNGL QYQISNF   ++++  +KI NTSLNQ +L  F  + S+ A    ++++LL 
Sbjct: 581  SKLALNGLFQYQISNF---TNDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLS 637

Query: 652  NSNGGIKVVKLNENMDIESSNEASLTGNTAGFSSYSGGILAY-GEYNLSSKITYLVNYNG 710
             + G +  + LN ++ +++S     T N   F  YS G++   G+ N+S       N N 
Sbjct: 638  GTEGNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNT 697

Query: 711  TFNEIPNFNKNSSITNVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXAL-QLSLWSSGS 769
            T +        S  T+V N+T++  ELLV +N  IYNV          ++  L++ S+G+
Sbjct: 698  TMD-------GSLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGA 750

Query: 770  NLNRDTVFSGAIALLDYTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYAS 829
            N   DT+F G +    Y   N S  +                     G+FLND  + Y  
Sbjct: 751  NSINDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFY 810

Query: 830  KTDSYSELLFSNGYS-APWSFFEGINYMVYSSHQTMLAVASSDFNK-NSELSILNLTTFE 887
            K  + S+L  +N  S +   ++     +VY  + T+L V   + N  +S LS+ NLT+F+
Sbjct: 811  KESNKSKLYITNSNSTSGLEWYGEPETVVYDKNDTLLMVGYYNDNTFSSTLSLTNLTSFD 870

Query: 888  TIANETLNVNSKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSIN 947
             I  E LNV S I+ L+ F  N TL+V G+F     NCS LCLYNY S +W + AN+S++
Sbjct: 871  VIKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVS 930

Query: 948  GTIAQMELINGTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKM-GDANI-LQSFATIG 1005
            G++A ++L     +L+ G       + VN+A ++LS   V S+ M  DA + L S     
Sbjct: 931  GSVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSN 990

Query: 1006 DKIITWNGIMLESYENGAWS--TIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADGFII 1063
             +I+ WN  +L S++  +W+  ++    +S+T+I S++ I            G+ D  ++
Sbjct: 991  SRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSVQFISM---------EGTDDALLL 1041

Query: 1064 NGNIYDTEYGTIQAMIYNFKEWRPYYIISSTNSQIAGQIFMNRDDS-------ALYNSQS 1116
             G    +E+G I++++YNF++W PY +      Q  G +FMNRD S        L NS  
Sbjct: 1042 LGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTGHLFMNRDISLHNIAQIPLLNSTR 1101

Query: 1117 VLQNPNNAXXXXXXXXXXXXXXXXXXXQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLL 1176
            VL N + A                      H K  GR+ +DRGFVVLIGLALAL TVS++
Sbjct: 1102 VLTNQSFASSTSSSVSSTSTTLPKVSTT--HSKP-GRRIVDRGFVVLIGLALALATVSVM 1158

Query: 1177 GIIGLVLAYIFKDGDG-SHDALNPRTNEDEMLETVPPEKL 1215
            G+ G++LAYIF+D  G S+  LNPR +E+ M+ T+PPEKL
Sbjct: 1159 GVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/1213 (37%), Positives = 697/1213 (57%), Gaps = 30/1213 (2%)

Query: 18   ASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTGIIPG-S 76
            AS LSNI  +LN+    +P LN   +++ + QLLGD++ L FY Y+GQQNFT     G S
Sbjct: 22   ASSLSNILKLLNIQEFELPNLNFNNTSN-SIQLLGDVENLQFYHYEGQQNFTDDGNSGIS 80

Query: 77   NSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXX 136
            ++N LIYYS++ LIQLE  SNDT I KI P G DSF+                       
Sbjct: 81   STNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTL 140

Query: 137  XIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGGFG 196
             I+PIF+  +  + +IL+D+ +VYFGG FT    + N  S+I W+ TS     L F GFG
Sbjct: 141  SIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFG 200

Query: 197  ENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNST----TVDIGQLVPL 252
             +S +NSI+KLNDDNILF G F TL     L  NTTS+ +N  NST    T+ + Q + L
Sbjct: 201  SDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTNSTENSSTIQLEQQISL 260

Query: 253  SASTWDTGESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKIRIYNSPNEDNQ 312
              +TWD G + FD + FVC   + E+WI  G +G+L    P  V+P+KIRIYN+   ++ 
Sbjct: 261  KYATWDAGTAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDG 320

Query: 313  VSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLA 372
            VSLFRI+T+ + GIMNLTY+DP++ +LK+CDAFCPL + + L  A +N+TS +     + 
Sbjct: 321  VSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFIN 380

Query: 373  DNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNE 432
            +NTT + W++ +QEFAFIN I VS++  +A DSYG+  ALS  +L+Q+++  +AN+TLN+
Sbjct: 381  NNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQ 440

Query: 433  PNCNXXXXXXXXXXXAND--WEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPGQYSIN 490
            P C+            +D  W  GL   +YI+  Y  +  P+P V F P I+  G +SI 
Sbjct: 441  PGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIK 500

Query: 491  IYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSSSPRVT 550
            +YTPGC  D TC SR+IVNVTV D    ++L+T+LIYQNN E+KYDE+++G L+ SP +T
Sbjct: 501  MYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEIT 560

Query: 551  IEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQISNFSTS 610
            + + S +      A +VADR+++    + V  +  +    +  + LNGL QYQ+SNF++ 
Sbjct: 561  LTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSD 620

Query: 611  SSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLNENMDIES 670
                T  K+ N S++QL+L QF  + S+  + ++ N++ L  S   I  ++LN ++++ +
Sbjct: 621  ----TKTKVGNNSIHQLALSQFPSSVSLIGNTFN-NSIFLAGSTSNIVQLQLNSDLELRN 675

Query: 671  SNEASLTGNTAGFSSYSGGILAYGEYNLSS-KITYLVNYNGTFNEIPNFNKNSSITNVVN 729
            +      G T    +YS G+L +G+YN+SS  +   +++NGTF+       N  +T   N
Sbjct: 676  TVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDN--VTTFAN 733

Query: 730  LTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSGAIALLDYTDL 789
             T   +ELL  +N  +YNV              S+ ++G+N N DT+  G I   +Y++ 
Sbjct: 734  FTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNF 793

Query: 790  NGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKTDSYSELLFSNGYSAPWSF 849
            N  + +                   Y  +FLND+ ++YA K    S++++ N  +    F
Sbjct: 794  NEPLKL--YGNSSLESLTFSSSIVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDF 851

Query: 850  FEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSKINGLINFEHN 909
               +N + +S++ ++L   +   N +S L I N++   ++A+E LN    I  +I+F  N
Sbjct: 852  SGTLNKLSFSNNSSLLFANAITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSN 911

Query: 910  STLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGTQLLLSGLFNA 969
            +T++V GNFT+   +C G+CLYNY + +W  FAN +I G+I +M+L N  Q+L+SGLF+A
Sbjct: 912  NTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSA 971

Query: 970  QNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESYENGAWSTIQS 1029
            QN SS+ LA +D+  Y +S +       + SF   G  I  W+   +  Y++  W+ I  
Sbjct: 972  QNYSSITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISF 1031

Query: 1030 NFNSSTTIRSIEPIGFGPTLQKRDGTGSADGFIIN-GNIYDTEYGTIQAMIYNFKEWRPY 1088
               +S  I S+E +    ++  ++ T +    +   G    T YG + AM++   +W+PY
Sbjct: 1032 PNTTSKYIESVEAV----SIDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAGDWKPY 1087

Query: 1089 YIISS--TNSQIAGQIFMNRDDSALYNSQSVLQNPNNAXXXXXXXXXXXXXXXXXXXQPH 1146
            + I++   N   A  +F NRD S+L+NS++ L     A                      
Sbjct: 1088 FSINNFQVNEDPAITLFENRDLSSLFNSKNSLP----ANITSAETSSRSTVSSATATTVV 1143

Query: 1147 HQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALNPRTNEDEM 1206
            ++ +    KIDRGFVVLI LALA+GTV+LLG+ G+ +AYIF+D +  ++++ PR +  EM
Sbjct: 1144 NKIEGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIAYIFRD-EQKYESIKPRIDGQEM 1202

Query: 1207 LETVPPEKLMKFL 1219
            L+TVPPEKLMKF+
Sbjct: 1203 LDTVPPEKLMKFI 1215

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/1269 (36%), Positives = 698/1269 (55%), Gaps = 81/1269 (6%)

Query: 18   ASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLL--GDIDGLSFYRYKGQQNFTTGIIPG 75
            A+QL+++K+IL + N+  P  NL  S + + QLL     D L+F  Y GQQNFT  II  
Sbjct: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPII-S 81

Query: 76   SNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXXXXXXXXXXXXXXXXX 135
            S+ N LIYYSN+T I+L +    T I  I P+G D+FI                      
Sbjct: 82   SSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTD 141

Query: 136  XXIEPIF-NTSIEEVKTILIDD--SLVYFGGNFTVLNGTSNI-HSLIMWDSTSSSTEFLN 191
              + PIF N  + EV+TI  D   +LVYFGGNF+ L   SNI + LI+WDS+S+ T    
Sbjct: 142  LSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYE 201

Query: 192  FGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFL-------IQNTTSSQNNIFNSTTV 244
            FGGFG NS+IN+I+KLN +++LF+G+FYTLD+P  L         N TSS  +  N +T 
Sbjct: 202  FGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTF 261

Query: 245  DIGQLVPLSASTWDTGEST--FDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKIR 302
            ++ Q +PL+   + T ++    + +  +CP +  E+W      GSL   LPF + P+KIR
Sbjct: 262  ELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIR 321

Query: 303  IYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTT 362
            I+NSP+ D++V+ FRI       IM+L Y+DP+  +LK+C  FCPLY++  L    +N  
Sbjct: 322  IFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDN 381

Query: 363  SPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAY 422
              S  I LL +NTTDIKW+  +QEFAF+NQ  +++++F AL SYG+ V LS   L+Q+  
Sbjct: 382  LKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDI 441

Query: 423  AVFANDTLNEPNCNXXXX----------------XXXXXXXANDWEMGLTGQTYISTTYT 466
            AVFAN++ N+P+CN                            NDW   L    Y++ TY 
Sbjct: 442  AVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYL 501

Query: 467  PNQDPVPYVSFSPQIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELI 526
             +   +P V+F P + Y G Y++++ TPGCT D++C SR IVNVT+W+   +SIL T LI
Sbjct: 502  SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSLI 561

Query: 527  YQNNKELKYDELYSGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSN 586
            YQ N+  K+D++++GYL    ++T+ + SG+Y++    T+VADR+N++I+SL+   +T+ 
Sbjct: 562  YQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDF--VTTT 619

Query: 587  GTNNTEIMN--LNGLLQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYD 644
             +N  +I N  LNGL QY   N    S    +   TN+++NQ +   +  N S+ A  YD
Sbjct: 620  SSNEIDIYNVTLNGLFQYPEYN----SVNNLNENYTNSTINQYAYSNYPANVSLIAAAYD 675

Query: 645  DNTLLLGNSNGGIKVVKLNEN-MDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKIT 703
             +TLL+G S   ++  ++ +N  +I   N      +  G   YS G++AYG+   SS   
Sbjct: 676  KDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSY 735

Query: 704  YLVNY-NGTFNEIPNFNKNSSITNVVNLTIHDT-ELLVIDNQAIYNVXXXXXXXXXXALQ 761
              + + N  F  + NF     I +  N+++  + E+L  +N+  YN             +
Sbjct: 736  KAITFTNNKFGTLGNFTD--EIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFE 793

Query: 762  LSLWSSGSNLNRDTVFSGAIALLDYTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLN 821
            LSLWS+G N   D +FSG ++  +  +L G ++I                   Y+ +FLN
Sbjct: 794  LSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYP--YSAVFLN 851

Query: 822  DSLSIYA--SKTDSYSELLFSNGYSAPWSFFEGINYMVYSSHQTMLAVAS-SDFNKNSEL 878
            DS +IYA        + L+ SNG    WS+   I+ M +  ++++L+V + SD +     
Sbjct: 852  DSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSF 911

Query: 879  SILNLTTFETIANETLNVNSKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEW 938
            SILNLT+ + IANETLN NS+I+ L+ F  NS+++VGGNFT     CSGLCL+NY++  W
Sbjct: 912  SILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNW 971

Query: 939  LTFANHSINGTIAQMELINGTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANIL 998
             TF N+++ GT++++EL N + +L+SG  +    ++++LA+++L+TY V SI + + N L
Sbjct: 972  STFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNV-SILLQNTN-L 1029

Query: 999  QSFATIGDKIITWNGIMLESYENGAWSTI------QSNFNSSTTIRSIEPIGFGPTLQKR 1052
             SF   G++I  WN   L  Y N AWS I      +S    S +I  I        L+KR
Sbjct: 1030 TSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKR 1089

Query: 1053 DGTGSADGFIINGNIYDTEYGTIQAMIYNFKEWRPYYIISSTNSQIAG---QIFMNRDDS 1109
                  +  +  G  Y    GT+QA+ Y    W PY+  + TN+        IF N+D S
Sbjct: 1090 -ALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSINIFPNKDIS 1148

Query: 1110 ALYNSQSVLQNPN------------NAXXXXXXXXXXXXXXXXXXXQPHH-------QKQ 1150
            +   S  VL+N N                                 QP         ++Q
Sbjct: 1149 SKIISDFVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSSIIPIIGKQQ 1208

Query: 1151 VGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALNPRTNEDEMLETV 1210
              + KI RGFVVLIGLAL+L TV+LLGI G++L++IF+D  G +++L PRT E EM + V
Sbjct: 1209 NKKHKIQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRTTEHEMFDAV 1268

Query: 1211 PPEKLMKFL 1219
            PPEKLM F+
Sbjct: 1269 PPEKLMPFV 1277

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/1241 (34%), Positives = 676/1241 (54%), Gaps = 75/1241 (6%)

Query: 6    VFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQ 65
            ++  L+L  +++ SQLSNI+ +LN++    P  +   S D T+  + + + L+   Y GQ
Sbjct: 8    IYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD---SPDLTY--MNNFEELTVISYTGQ 62

Query: 66   QNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXXXXXXX 125
            QNFT      +N + L+YYSN+T ++L E S +T +  I P   DSFI            
Sbjct: 63   QNFTVQ----ANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVAL 118

Query: 126  XXXXXXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSS 185
                          PIF +++E V  IL  +  V F GNF++       H  ++WD  ++
Sbjct: 119  EQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVAN 178

Query: 186  STEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNSTTVD 245
            +TE   F GFGENSI+NS+VKLN DNILFAG F  +     L +   ++ ++  + T++ 
Sbjct: 179  TTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQ 238

Query: 246  IGQLVPLSASTWDTGESTFDSDTFVCPDTTEESWIQS-GTTGSLTCKLPFEVAPTKIRIY 304
              Q VPL  S+  TGE+   SD  +CP   +  W  S     +L   L  E+ P+K+RIY
Sbjct: 239  FDQSVPLKLSSI-TGENV-QSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIY 296

Query: 305  NSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSP 364
            NS  E++++SLFRI+T  + GIMNLTY+DP S ELK CDA+CPL S   L+Q   N+T+ 
Sbjct: 297  NSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAA 356

Query: 365  SDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAV 424
              ++ +  +N+T++KW++ +QEFAF+N I V+ +QFVAL SYG+N AL S ++++  + V
Sbjct: 357  PKSVGI-NNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMV 415

Query: 425  FANDTLNEPNCNXXXXXXXXXXXANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYP 484
            +AN++ NEPNC            +++W       TYIST      D +PYV+F P I YP
Sbjct: 416  YANNSYNEPNCESVTEYSKAELSSDNWYTTDESDTYISTNI---DDNIPYVTFHPNITYP 472

Query: 485  GQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLS 544
            G+Y+ NIYTPGC QD++CS R IVNVT+ D     +LA+ LIYQ N E K+D LY+G L 
Sbjct: 473  GRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLG 532

Query: 545  SSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQI 604
            S+P + + +   +  S++V  +V DRL V+ + ++   ++SN T      +LNGL QY  
Sbjct: 533  SAPEIIVTWDKAIGESDSV--MVVDRLGVITEYIDTISISSNDTT----FHLNGLFQYNT 586

Query: 605  SNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLNE 664
            +N + S      +  TN + N  +L  F  + ++YA   +++ L+ GN N GI  V+LN+
Sbjct: 587  ANVTAS------IFSTNDTFNDYALYNFPLDANLYAASLNNDILIGGNFN-GIAKVELND 639

Query: 665  NMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITY-LVNYNG-TFNEIPNFNKNS 722
               I SS +   +G T G   YS G+L  G Y + +   + +++Y+G  FN     ++  
Sbjct: 640  EALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDE-- 697

Query: 723  SITNVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSGAIA 782
             I  +VN TI   ELL+ DN  I+NV            +++  S+G N   D++  G+  
Sbjct: 698  PIDRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFL 757

Query: 783  LLDYTDLNGSIAIGXX-XXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKTDS----YSEL 837
                 +LNG  ++                    Y   ++ND+ + YA +  S       +
Sbjct: 758  KRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRV 817

Query: 838  LFSNGYSAP------WSFFEGINYMVYSSHQTMLAVASSDFNKNS----ELSILNLTTFE 887
            L +N  S+       WS    IN  +Y +   +LA+ ++  N +S    + SILNLT +E
Sbjct: 818  LITNTNSSSHMLQIQWS--APINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYE 875

Query: 888  TIANETLNVNSKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSIN 947
             +A    + N ++N +++F  N++++VGG++ I   NC+ LCLYNY + EW +F N SI 
Sbjct: 876  NVARVNFSTNERVNSMVSFSSNNSILVGGSYEI--DNCNDLCLYNYQTKEWTSFLNDSIT 933

Query: 948  GTIAQMELIN-GTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGD 1006
            G I QM+  + G  LL+ GL    N S++ L  +++ +   S++K G   +L SF  I D
Sbjct: 934  GDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLL-SFVPIDD 992

Query: 1007 K---IITWNGIMLESYENGAWSTIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADGFII 1063
                II      +   E+G WS+     N+ + +   + +  G   +KRD    +   ++
Sbjct: 993  STDNIIAQMNSEILRLESGTWSSFGPQLNNDSIVSGFKVLS-GTESKKRD--EGSHIVLL 1049

Query: 1064 NGNIYDTEYGTIQAMIYN--FKEWRPYYIISSTNSQ---IAGQIFMNRDDSALYNSQSVL 1118
             G +  +E+G + +++Y+   ++W+PY++IS    Q    +   F N +D  L +SQ+VL
Sbjct: 1050 EGTLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDLYLSSSQTVL 1109

Query: 1119 QNPNNAXXXXXXXXXXXXXXXXXXXQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGI 1178
            Q+ N+                              KKIDRGF+VLIGLALAL TV+++G+
Sbjct: 1110 QSNNSDTSASSTPTPSTT---------SSSHSTKDKKIDRGFIVLIGLALALATVAVIGL 1160

Query: 1179 IGLVLAYIFKDGDGSHDALNPRTNEDEMLETVPPEKLMKFL 1219
            IG ++ Y F + +G +++L PR N+DEML+TVPPEKLMKF+
Sbjct: 1161 IGALICYFFINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/1243 (32%), Positives = 662/1243 (53%), Gaps = 61/1243 (4%)

Query: 4    SWVF-NFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRY 62
            SW+  +FL++  +   + L+ I++ L V N  +P+L+L+ SN++  QLLG+   L++YRY
Sbjct: 5    SWLATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRY 64

Query: 63   KGQQNFTTGIIPGSNSNGLIYYSNNTLIQLEEP--SNDTY-IAKITPFGSDSFIXXXXXX 119
             GQ NFT GI        LIY+SN TL++L  P  SN+++ +  + P   DSFI      
Sbjct: 65   TGQDNFT-GISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGA 123

Query: 120  XXXXXXXXXXXXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIM 179
                                 IFN S+  V  I ++ +  YFGG+F       + H LI+
Sbjct: 124  ISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIV 183

Query: 180  WDSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIF 239
            WD   +  E L FGG G++S +NSI+ L+D+NILFAG F T+DE   L  N+T   N+  
Sbjct: 184  WDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSAL--NSTLGINSTS 241

Query: 240  NSTTVDIGQLVPLSASTWDTGESTFDSDTFVCPDTTEES-WIQSGTTGSLTCKLPFEVAP 298
            +S   ++   +PL  + W T + +   D  VCP  +  S W+ +GTTG     +   + P
Sbjct: 242  DSAP-ELSHKIPLKTAKW-TSDGSLQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRP 299

Query: 299  TKIRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAY 358
            +K+R++N+   D +VSLFR++T  + GIMNLTY+DP S EL+ CDA+CPL S   L+ A 
Sbjct: 300  SKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAK 359

Query: 359  ANTTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLY 418
            +   S +D +  L +N T ++W++ +Q+FAF+N + V+S+ F+ALDSYG++V ++ F+LY
Sbjct: 360  SKAAS-TDQVEFL-NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELY 417

Query: 419  QNAYAVFANDTLNEPNCNXXXXXXXXXXXANDWEMGLTGQTYISTTYTPNQDPVPYVSFS 478
            ++ ++V+AND+ N P+C+           A+ W+ G + + Y+  T   N    P V+F 
Sbjct: 418  EDDFSVYANDSFNVPDCSSTSNYSKASLSASQWDQGSSDEDYV-YTLVENSQEAPSVTFY 476

Query: 479  PQIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDEL 538
            PQI Y G Y+IN+ TPGC  D +C SR++VN ++WDS+  ++L++  IYQNN   KYD L
Sbjct: 477  PQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNL 536

Query: 539  YSGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSN---GTNNTEIMN 595
            YSGYL +  +V +EY   +  +     +VA +++V  D  +    T     G  N  +  
Sbjct: 537  YSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKLNGLLHY 596

Query: 596  LNGLLQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNG 655
                    + NF +++S         T L Q S+  F+KN++ + D +  N ++L  S+G
Sbjct: 597  SLSNSSSYLQNFKSNNS---------TDLAQYSVSNFAKNSNFFVDKFK-NYIMLFASSG 646

Query: 656  GIKVVKLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEI 715
             +  +++++  D+ +     +    +G  ++S G+   G ++ S+K      YNG+F +I
Sbjct: 647  KVSKLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAKF--YNGSFFDI 704

Query: 716  PNFNKNSSITNVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDT 775
            P    +S++T   N T+   EL+ + N    N            + L+  S+G N   +T
Sbjct: 705  PL--SHSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGET 762

Query: 776  VFSGAIALLDYTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYA----SKT 831
            VF G++   +YTDLNGS  I                   Y   ++++S + YA    S T
Sbjct: 763  VFYGSLTRNEYTDLNGSFFI-SSNSQSSSRLRGSQGRIWYDATYIDNSTTGYAFYDPSST 821

Query: 832  DS------YSELLFSNGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTT 885
            +       Y ++      S  W+   G   M+YS + ++LA+   +  ++ +L + NLTT
Sbjct: 822  NGSYGVSIYKDMAKERDLSYRWTNMVG--SMLYSKNSSLLALGMKNETRSPQLLLTNLTT 879

Query: 886  FETIANETLNVNSKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHS 945
             E  A      N  IN LI F+ N++++VGG+F   +SNCSGLCL++Y+   W  F ++ 
Sbjct: 880  GEDTATFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNM 939

Query: 946  INGTIAQMELINGTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIG 1005
            ING+I  M++ N + L+L G F+  +   VNLA M L+  + + +  G   IL      G
Sbjct: 940  INGSIHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDG 999

Query: 1006 --DKIITWNGIMLESYENGAWSTIQSNFNSSTTIRSIE--PIGFGPTLQKRDGTGSADGF 1061
              D ++  +   L    N  W +I + F+ S+    +   PI  G   +KR+     +  
Sbjct: 1000 KVDNLVAVSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKRE--EEKNSL 1057

Query: 1062 IINGNIYDTEYGTIQAMIYNFKEWRPYY---IISSTNSQIAGQIFMNRDDSALYNSQSVL 1118
            +I G++    YG I A +Y+F +W PY+     +ST+     +I+ N+D S+ +N Q VL
Sbjct: 1058 LITGDLLHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVL 1117

Query: 1119 QNPNNAXXXXXXXXXXXXXXXXXXXQPHHQKQVGRK--KIDRGFVVLIGLALALGTVSLL 1176
            Q+                             Q+G K  KI RGFVVLIGLALA+GT++++
Sbjct: 1118 QSSRGGNSSSVPSGTSSPTS-------SSPSQLGAKKNKIARGFVVLIGLALAMGTLAVM 1170

Query: 1177 GIIGLVLAYIFKDGDGSHDALNPRTNEDEMLETVPPEKLMKFL 1219
            G+IG+ L + F      + +L PR +E EM++TVPPEKLM+F+
Sbjct: 1171 GVIGIALTFFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1233 (33%), Positives = 637/1233 (51%), Gaps = 76/1233 (6%)

Query: 15   ILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTGIIP 74
            +++ S L ++    ++ +   P L+L+A+ ++   +  D     +Y YKGQQ FT     
Sbjct: 17   VVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQQLFTGQ--E 74

Query: 75   GSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXXXXXXXXXXXXXXXX 134
                + LIYYS  T +QL +  +DT + +I PFGSDSFI                     
Sbjct: 75   QHQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLS 134

Query: 135  XXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGG 194
               +  I   S+E V  IL+D  +VYFGG FT  +G  + HS + W++TS +T  L FGG
Sbjct: 135  TLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGG 194

Query: 195  FGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNT--TSSQNNIFNSTTVDIGQLVPL 252
            FG  S +N+I+KL+   +LF G F  L+   +    +   S++    N TT++   L  L
Sbjct: 195  FGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTIETNALTSL 254

Query: 253  SASTWDTGESTFDSDTFVCPDTTEESWI--QSG---TTGSLTCKLPFEVAPTKIRIYNSP 307
              ST  T +   D   F+CP + ++SW    SG     G L  K+   + P+KIRIYNS 
Sbjct: 255  RYSTI-TSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSK 313

Query: 308  NEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSDT 367
               N++ LFRI+T+ +Q IMN+TYIDP + EL  CDA+CPL  ++ L+   A +  P+D 
Sbjct: 314  KNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAES-GPADV 372

Query: 368  IHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFAN 427
              L+ D    IKWT ++QEFAFINQI +  ++F+ALDSYGNNV L   +L+Q  Y  + N
Sbjct: 373  ARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVN 432

Query: 428  DTLNEPNCNXXXXXXXXXXXANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPGQY 487
             TLN+PNC            AN W  G T  +Y+S     +    P V+  P I + G Y
Sbjct: 433  STLNQPNCG-EQQLSPFSTTANIWHQGATDASYLSANVVESN---PMVNVKPVIPHSGTY 488

Query: 488  SINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSSSP 547
            ++N+YTPGC  D TC  R IVNVT+  S+GT+++ T  IYQNN  LKYD LY+G+L  +P
Sbjct: 489  TLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLM-TRWIYQNNYRLKYDPLYTGHLDPNP 547

Query: 548  RVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQISNF 607
             V +E+VS + ++     +VADR++ +IDSL+  GL  +   +    +LNGL QY     
Sbjct: 548  TVRMEWVSPINSAVNRKIMVADRVSAIIDSLD--GL--DDIRHPREKSLNGLFQY----- 598

Query: 608  STSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVV--KLNEN 665
             T +  + D  I    +N+       +  S+   +YD   +L   S G I VV  K  + 
Sbjct: 599  -TPAGSSLDNGI-QKYINKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDW 656

Query: 666  MDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSSIT 725
             D++ + +  + G+  G S YS G++  G++NLSS  +  ++Y+G F     F+ NS  +
Sbjct: 657  NDVDVTRQ-DVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSF--FDLNSETS 713

Query: 726  NVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSGAIALLD 785
            +++N+TI  +ELL+ +N+ IYN             QLS  S+ +N N D +F+G+IA + 
Sbjct: 714  SIINMTIDGSELLLFNNKFIYNTSTSQMLTSSM-FQLSALSAAANSNNDLLFTGSIADIK 772

Query: 786  YTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKTDSYSELLFSNGY-- 843
            +   +G++A+                  ++ G++LND+ + YA  + S +  + + G   
Sbjct: 773  HGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVI 832

Query: 844  SAPWSFF------EGINYMVYSSHQTMLAVASSDFNKNSELSIL-NLTTFETIANETLNV 896
              P + F        +  M+Y      L +++++        IL +L T + +A E LN 
Sbjct: 833  ETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNP 892

Query: 897  NSKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELI 956
              +IN ++ F  ++TL+VGG+F   +  C  LCLYN+    W  FA+  I+G I Q++ +
Sbjct: 893  GERINSIVLFGEDNTLLVGGSFE--KDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFV 950

Query: 957  NGTQLLLSGLFNAQNISSVNLAIMDL-STYAVSSIKMGDANILQSFATI---GDKIITWN 1012
            N   L+  G    Q+  ++     DL  +  V   +  +     S  TI   GD+ +  +
Sbjct: 951  NNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYVAED 1010

Query: 1013 GIMLESYENGAWSTIQSNFNSSTTIRSIEPIGF-GPTLQKRDGTGSADGFIINGNIYDTE 1071
            G  +  Y    W T+         I  I  +    P  Q +      +  +I+G +  +E
Sbjct: 1011 GKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELVVIHGQMNSSE 1070

Query: 1072 YGTIQAMIYNFKEWRPYY--IISSTNSQI---AGQIFMNRDDSALYNSQSVLQNPNNAXX 1126
            YG I AM YNF+ W PYY  I SS   +     GQIF+N+D S    +   L+       
Sbjct: 1071 YGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLE------- 1123

Query: 1127 XXXXXXXXXXXXXXXXXQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYI 1186
                             +P       ++K+ +G+VVLI L LAL T++LLGIIG++LAY 
Sbjct: 1124 -------VVVSDSPPTAEP-------KRKLAKGYVVLIALGLALATIALLGIIGVILAYA 1169

Query: 1187 FKDGDGSHDALNPRTNEDEMLETVPPEKLMKFL 1219
            F D + ++  L PR NEDEML+TVPPEKLMKF+
Sbjct: 1170 FGDHN-AYQPLKPRINEDEMLKTVPPEKLMKFI 1201

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/1229 (32%), Positives = 660/1229 (53%), Gaps = 45/1229 (3%)

Query: 10   LLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFT 69
            L L      S L  +++ L V   +IP L+L+ S ++  QLLG+   ++  +Y GQ+NFT
Sbjct: 12   LALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFT 71

Query: 70   TGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYI---AKITPFGSDSFIXXXXXXXXXXXXX 126
             G + G+  N LIYYSN T +++   S+ + +     I PF  D+FI             
Sbjct: 72   -GEVSGNPENALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSGAGSISGHQLS 130

Query: 127  XXXXXXXXXXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSS 186
                          IF   + +V TI  +   V+FGG+F        IHSL++WDS    
Sbjct: 131  RQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDG 190

Query: 187  TEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNSTTVDI 246
             E L FGGFG+NS +NSI+ L++ NILFAG F  +D    L     S   N  N++  ++
Sbjct: 191  VEVLPFGGFGKNSTVNSILNLDNSNILFAGNFSAVDNTQQLNNINVS---NTSNTSVPEL 247

Query: 247  GQLVPLSASTWDTGESTFDSDTFVCPDTTEESWIQSGTT-GSLTCKLPFEVAPTKIRIYN 305
            G  + L ++ W   + T D     CP T    W+++G+T G     +P E  P+K+R++N
Sbjct: 248  GHQISLQSAAW-VSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFN 306

Query: 306  SPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPS 365
            + + D QVSLFRI+T  + GIMNLTY+DP + EL  CDA+CPL S   L+   ++ + P 
Sbjct: 307  ARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDI-SSKSYPG 365

Query: 366  DTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVF 425
            D +    +N T ++W++ FQ+FAF+N + VS + F+ALDSYG++V L+  +LY++AY+V+
Sbjct: 366  DQVQYF-ENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVY 424

Query: 426  ANDTLNEPNC-NXXXXXXXXXXXANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYP 484
            AN+TLN PNC             ++ W+ G +   Y+ST+   + +  P+V F P I YP
Sbjct: 425  ANNTLNAPNCAQGSATSNALLSNSSAWDSGSSEGNYLSTS-VQDSETNPFVIFYPSIIYP 483

Query: 485  GQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLS 544
            G Y+I++ TPGC +D +C +R I+N T+ D    ++L +  IYQNN   K+D LYSG+L 
Sbjct: 484  GVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLD 543

Query: 545  SSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQI 604
            S  +VT+E+   + +   V  +VA ++ V I+  +     S   NNT    +NGLL Y  
Sbjct: 544  SEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFD----QSVFENNTSGF-INGLLHYST 598

Query: 605  SNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLNE 664
            SN S+  SE      T+  L   S+ +  K+++++A++++D+ L+L  ++G +  +KL  
Sbjct: 599  SNTSSFLSELGSYSATD--LAHYSVSKLPKHSNIFANMFEDD-LVLFTTDGEMARLKLAN 655

Query: 665  NMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSSI 724
            N+ IE     ++  + +  S YSGG++  G +N SS+      +NGTF  +  FN  S++
Sbjct: 656  NLSIEEYTFETIGKDISTISEYSGGLIIVGTFNGSSEPA-ARGFNGTFFNLTEFN--STV 712

Query: 725  TNVVNLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSGAIALL 784
                NLT+  TE+L+ D   I N            L L + S+G N   DT+F G +   
Sbjct: 713  RTFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQN 772

Query: 785  DYTDLNGSIAIGXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYA-----SKTDSYS-ELL 838
            DYT+LNGS  I                   Y   F+++S + YA     + ++S+   ++
Sbjct: 773  DYTNLNGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVM 832

Query: 839  FSNGYSAPWSFFEG-INYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVN 897
              +G +   S + G +  M  S + ++LA+   D + +S+L + N ++ E++A+   +  
Sbjct: 833  NDSGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSE 892

Query: 898  SKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELIN 957
              +N +I F  N++++VGG+F +  + CSGLCL+NY   +W  F N+SI G I +ME+ N
Sbjct: 893  ISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFN 952

Query: 958  GTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANI-LQSFATI---GDKIITWNG 1013
             + LL++G F       V+LA + L     SS  + + NI L  F ++    + ++ ++ 
Sbjct: 953  NSNLLIAGSFRLNETDGVSLASICLKD--SSSEILHEGNITLNGFVSMDGSSNNVVAFSD 1010

Query: 1014 IMLESYENGAWSTIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADGFIINGNIYDTEYG 1073
              L   E+G W  I +NF  ++  + ++      T +K+    S+   +I G++   ++G
Sbjct: 1011 TSLLQLESGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAKFG 1070

Query: 1074 TIQAMIYNFKEWRPYYI---ISSTNSQIAGQIFMNRDDSALYNSQSVLQNPNNAXXXXXX 1130
            +I A  Y+  EW P+      +S++      +F+NRD S   + +  LQ   ++      
Sbjct: 1071 SINAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFSSNTSSGT 1130

Query: 1131 XXXXXXXXXXXXXQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDG 1190
                               Q  +KKIDRGF+VLI LALALGT+++LG++G++ +Y F D 
Sbjct: 1131 SGTPSPSGSS-----PSNLQRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDS 1185

Query: 1191 DGSHDALNPRTNEDEMLETVPPEKLMKFL 1219
               +    PRT+E+EM++TVPPEKLM+F+
Sbjct: 1186 GDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1236 (34%), Positives = 668/1236 (54%), Gaps = 71/1236 (5%)

Query: 15   ILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTGIIP 74
            + Q SQ++ + N  N+T    P L+L+   +    +  D     +Y YKGQQ FT   + 
Sbjct: 17   LAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTG--LA 74

Query: 75   GSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFIXXXXXXXXXXXXXXXXXXXXX 134
                N LIYYSNNT +QL E  +   I KI P+G DSFI                     
Sbjct: 75   DERKNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHRLEHQLIYNLS 134

Query: 135  XXXIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGG 194
               I  I    +E V  IL D  +VYFGG FT  +G  + HS++ WD+T  S+  L F G
Sbjct: 135  SFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSLLPFYG 194

Query: 195  FGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNSTTVDIGQLVPLSA 254
            FG+ S++N+I+KL+D NILF G+F T+D    L     SS + + NST ++   L  L  
Sbjct: 195  FGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSS-SFLSNSTNIETNALASLRF 253

Query: 255  STWDTGESTFDSDTFVCPDTTEESW-IQSGTTGSLTCKLPFEVAPTKIRIYNSPNEDNQV 313
            S+    + T +S  FVCP+ + +SW I   T G LT ++  ++ P+KIRIYNS + +NQV
Sbjct: 254  SSL-VHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSKDSNNQV 312

Query: 314  SLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLAD 373
            +LFRI+T+ ++ IMN+TY+DPI+  L  CDA+CPL   ++LS    N+TS S       +
Sbjct: 313  NLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENSTS-SVMAAFPNN 371

Query: 374  NTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNEP 433
            N   +KWT  +QEFAF+N++ +  + F+A+DS+G+NV L   +L+Q  Y  + N+TLN+P
Sbjct: 372  NNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNTLNQP 431

Query: 434  NCNXXXXXXXXXXXAND-WEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPGQYSINIY 492
            NC+            +  W  GL  Q+Y++T++T  +   P V+ +P I YPG Y++N+ 
Sbjct: 432  NCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---PSVTLTPSIPYPGIYTLNLV 488

Query: 493  TPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSSSPRVTIE 552
            TPGC  D+TC+ R IVNVT+   +GT ++    IYQNN+ LKYD L+ GYL  SP V +E
Sbjct: 489  TPGCLTDNTCAFRGIVNVTIRAQNGTHLM-NRWIYQNNENLKYDPLFRGYLDDSPNVVLE 547

Query: 553  YVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQISNFSTSSS 612
            ++  +  +     +VADR+  +IDS+E   +  NGT+N+ +  LNGL QY  SNF+ ++ 
Sbjct: 548  WIGPIDPAAANNVMVADRVTSIIDSIEDLEM-KNGTSNSNL--LNGLFQYAASNFTNTNL 604

Query: 613  ETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNS--NGGIKVVKLNENMD--I 668
             T    + +T+++Q  +     ++S++  +Y+D TL +G+   +G  K+ +  ++ +  I
Sbjct: 605  STL---VGSTNIDQYPVRNIPHSSSLFGQIYND-TLFIGSPSIDGLAKISRRKDDWNDII 660

Query: 669  ESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSSITNVV 728
                     G   G   YS G LA   ++  + +   +++NG+ + I  F  N+   +++
Sbjct: 661  VDPQLIDTEGPVTGIFPYSNG-LALTVHSNQTNMASSLSFNGSISTI--FRSNAPSLSIL 717

Query: 729  NLTIHDTELLVIDNQAIYNVXXXXXXXXXXALQLSLWSSGSNLNRDTVFSGAIALLDYTD 788
            NLTI  +E+LV DN  +YNV           L+LSL S+G+NL  D + +G +    +  
Sbjct: 718  NLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFV 777

Query: 789  LNGSIAI-GXXXXXXXXXXXXXXXXXLYTGLFLNDSLSIYASKTDSYSELLFSNGYSAPW 847
             NG+IAI                   +Y GLF+NDS S YA  + S      S G    +
Sbjct: 778  PNGAIAIDADSNEVVTSGLPSVDDGIIYRGLFINDSSSAYAYYSKSLGS---SKGGIVVY 834

Query: 848  SFFEG---------INYMVYSSHQTMLAVASSDFNKN-SELSILNLTTFETIANETLNVN 897
               E          +N M+Y     +LAV +S  ++  + L I +L+       ET  + 
Sbjct: 835  GEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIG 894

Query: 898  SKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELIN 957
              IN ++ F  N TL+VGG FT  ++ C  LCLYNY +N W  F + +I G I Q++ ++
Sbjct: 895  EVINTMVLFGRNYTLLVGGTFT--RNGCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLD 952

Query: 958  GTQLLLSGLFNAQNISSVNLAIMDLSTYA-VSSIKMGDANILQSFATIGD---KIITWNG 1013
            G  L+++GL  + +   + L  +DLS    +S ++  +    Q   T+G+   ++I  +G
Sbjct: 953  GNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDG 1012

Query: 1014 IMLESYENGAWSTIQSNFNSSTTIRSIEPIG--FGP--TLQKRDGTGSADGFIINGNIYD 1069
              +  + +G W  I  + +  T I  +  +   F    ++ KRD  G+ +  +INGN   
Sbjct: 1013 NQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGN-ELVVINGNFSS 1071

Query: 1070 TEYGTIQAMIYNFKEWRPYY--IISSTNSQ---IAGQIFMNRDDSALYNSQSVLQNPNNA 1124
             +YG I AM Y+F  W PYY  +   +NS      GQ+F+N+D S   +SQ  L N N+ 
Sbjct: 1072 PDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDND- 1130

Query: 1125 XXXXXXXXXXXXXXXXXXXQPH-HQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVL 1183
                               +P  H+K    KK+ + FVVLI LALAL TV++LG++G++ 
Sbjct: 1131 -----------NDDTPAASEPATHEKHT--KKLAKIFVVLIALALALATVAVLGVVGVLF 1177

Query: 1184 AYIFKDGDGSHDALNPRTNEDEMLETVPPEKLMKFL 1219
            AY+F D + +++ L PR NE EML+TVPPEKLMKF+
Sbjct: 1178 AYLFGDHN-AYEPLKPRINEAEMLKTVPPEKLMKFI 1212

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1193 (33%), Positives = 635/1193 (53%), Gaps = 49/1193 (4%)

Query: 38   LNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSN 97
            LN ++S ++  QLLG I+  ++Y Y+GQQNFTT      N   LIYYSNNTL++L+    
Sbjct: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTAS-SSQNELELIYYSNNTLLRLDAVPT 60

Query: 98   DTYIAKITPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXXIEPIFNTSIEEVKTILIDDS 157
            D  +  I PF  D FI                         +PIF   +  VK+I +D+ 
Sbjct: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120

Query: 158  LVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGE 217
            +VYFGG+ T  N   +  S++ W+ST++S+  L FGGFG NS +NSI++L ++N+LF G+
Sbjct: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQ 180

Query: 218  FYTLDEPDFLIQNTTSSQNNIFNSTTVDIGQLVPLSASTWDTGESTFDSDTFVCPDTTEE 277
            F  L+   F +  T  ++N   +    ++GQ + L  +TW+   S  D D F+CP++ ++
Sbjct: 181  FAKLENNSF-VSKTNRTRNFSISMEDSEVGQQISLRQATWN-ANSNLDVDAFICPNSDQQ 238

Query: 278  SWIQSGTTGSLTCKLPFEVAPTKIRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISH 337
            +W   G+ G +TC  P  +  +KIRIYN+P  DNQ+SLFR++     GI+NLTY+DPISH
Sbjct: 239  AWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISH 298

Query: 338  ELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSS 397
            ++KHC   CPL+++  L  A  N T  SD I  + +N+T+IKW + +QEFAF+NQ+ ++S
Sbjct: 299  DIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITS 358

Query: 398  VQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNEPNC-NXXXXXXXXXXXANDWEMGLT 456
            +QFVA +SY  NV LS FQ+YQ+++ +F N++ NEPNC +            N W     
Sbjct: 359  LQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVAN 418

Query: 457  GQTYISTTYTPNQDPVPYVSFSPQIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSD 516
              +Y++ +Y PNQ   P +++   I  PG+Y +N+ TPGC +D+TCS+R IVNVT +D+ 
Sbjct: 419  DNSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNS 478

Query: 517  GTSILATELIYQNNKELKYDELYSGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLID 576
              +IL + LIYQNN  LKYD++++G L++S  V +EY SG+  +   ATVV   ++V+  
Sbjct: 479  NGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVVGVVDVVRV 538

Query: 577  SLEVPGLTSNGTNNTEIMNLNGLLQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNT 636
            S+      S+  +    ++LNG+ +Y  SNF+  +   T  KI  T L+   +  F+K  
Sbjct: 539  SISSE-FISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTG-KIDYTILDDFGVSNFNKGA 596

Query: 637  SMYADLYDDNTLLLGNSNGGIKVVKLNE-NMDIESSNEASLTGNTAGFSSYSGGILAYGE 695
            S++A +  +  L LG++NG   V +LN  N     S E +L+G   G  S   G++ +G 
Sbjct: 597  SIFA-VDQNQNLYLGSTNG--SVYELNSLNGSSVPSTENNLSGLINGMYSVEEGLVIFGS 653

Query: 696  YNLSSKITYLVNYNGTFNEIPNFNKNSSITNVVNLTIHDTELLVIDNQAIYNVXXXXXXX 755
                 +    V  N +   + +   N SI    N T+  + LLV DN  I+N+       
Sbjct: 654  IAHRGREYGAVILNKSITPL-DIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFE 712

Query: 756  XXXALQLSLWSSGSNLNRDTVFSGAIALLDYTDLNGSIAIGXXXXXXXXXX-----XXXX 810
                  L L ++G N N D +  G I       +N   AIG                   
Sbjct: 713  NTSYRNLDLRNAGKNSNDDMLLVGNI-------VNKGSAIGNESLLISSNGTYSPFSLSD 765

Query: 811  XXXLYTGLFLNDSLSIYASKTDSYSELLFSNGYSAPWSFFEGINYMVYSSHQTMLAVASS 870
               +   ++LND+ ++Y+  + + +    S+    PW++   +  + YS+ Q +L     
Sbjct: 766  NDTIEGAIYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQE 825

Query: 871  DFNKNSELSILNLTTFETIANETLNVN-SKINGLINFEHNSTLIVGGNFTILQSNCSGLC 929
            + NK S++ +++L + + I N+T N+   KIN ++NF  N+T +VGG+F++    C GLC
Sbjct: 826  NSNK-SQIVLIDLFSSQVI-NDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLC 883

Query: 930  LYNYDSNEWLTFANHSINGTIAQMELINGTQLLLSGLFNAQNISSVNLAIMDLSTYAVSS 989
            LYNY+++ W +F N+SI G I+Q++  N TQ+LLSG       + +NL  ++L++     
Sbjct: 884  LYNYNNSNWSSFLNNSITGNISQIKF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDI 942

Query: 990  IKMGDANILQSFATIGDKIITWNGIMLESYENGAWSTIQSNFNSST--TIRSIEPIGFGP 1047
            +   ++ +L  F  + + ++ WN   +       WS +   F+  T  TI  IE      
Sbjct: 943  LLYNNSVVLDDFILVRNLVVGWNSTDIFIRNVTQWSNLNI-FDDGTNATINRIENF---- 997

Query: 1048 TLQKRDGTGSADGFIINGNIYDTEYGTIQAMIYNFKEWRPYYIISSTNSQIAGQIFMNRD 1107
                  G  S    II G     +YGTI A+IY+F  W PY+ +   +       F +RD
Sbjct: 998  ------GADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTATPLFFADRD 1051

Query: 1108 DSALYNSQSVLQNPNNAXXXXXXXXXXXXXXXXXXXQPHHQKQVGRKKIDRGFVVLIGLA 1167
             S+  N++ V+ +                          H+      KI RGFVVLIGLA
Sbjct: 1052 QSSYGNTRHVVPD--------HIIVSSSHSSSAPSSSSSHKTNEKPYKIRRGFVVLIGLA 1103

Query: 1168 LALGTVSLLGIIGLVLAYIFKDG-DGSHDALNPRTNEDEMLETVPPEKLMKFL 1219
            LAL T+ +LGI G+V+A +F    +G +D +    +++     + PEKL++ L
Sbjct: 1104 LALATLIVLGITGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156

>TDEL0A06840 Chr1 complement(1196243..1197967) [1725 bp, 574 aa]
           {ON} Anc_6.271 YPL243W
          Length = 574

 Score = 35.4 bits (80), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 49/110 (44%), Gaps = 6/110 (5%)

Query: 854 NYMVYSSHQTMLAVASSDFNKNSEL-SILNLTTFET--IANETLNVNSKINGLINFEHNS 910
           N   YS+++    + S+D++K S+L  +L L   E     +E L + ++  G   F+ N 
Sbjct: 49  NTKKYSANEKYDKITSADYDKKSKLYGVLVLLHAERDLALSEMLKLRARQRG--RFKSNE 106

Query: 911 TLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQME-LINGT 959
             +VG            L     +   W+T A + I   +AQ E L+NG 
Sbjct: 107 KKVVGTRLKKAVKTSQNLVELTINEKLWITRAQYIIYARLAQAEYLLNGK 156

>ABL063C Chr2 complement(282530..283692,283760..283820) [1224 bp,
           407 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YBR078W (ECM33) and YDR055W (PST1); 1-intron
          Length = 407

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 70/143 (48%), Gaps = 16/143 (11%)

Query: 527 YQNNKELKYDELYSGY-LSSSPRVTIEYVSG---LYASNTVATVVADRLNVLIDSLEVPG 582
           Y + K+L  D + SG  LS+     +E + G   +  S+T+    AD+L  + DSL++  
Sbjct: 41  YSSCKKLSGDLVISGKQLSNGALANVEEIDGSLSIIDSSTIVNFSADKLRKIKDSLKLMD 100

Query: 583 LTSNGTNNTEIMNLNGLLQYQ----ISNFSTSSSETT-DVKITNTSLNQL-------SLE 630
           L S    +   +    ++Q+Q    ++N  TS  +T  D+ I+NT+L  +       +++
Sbjct: 101 LPSLEAASFGALEEVSMVQFQALPVVNNIVTSKLKTANDIVISNTNLRSIKEFTSLGAVQ 160

Query: 631 QFSKNTSMYADLYDDNTLLLGNS 653
           +F  N + Y    D +   +GNS
Sbjct: 161 KFDVNNNRYLRSIDASIKTVGNS 183

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 130,582,566
Number of extensions: 5978292
Number of successful extensions: 17181
Number of sequences better than 10.0: 149
Number of HSP's gapped: 17567
Number of HSP's successfully gapped: 161
Length of query: 1219
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1098
Effective length of database: 39,606,813
Effective search space: 43488280674
Effective search space used: 43488280674
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)