Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B020208.271ON90590545140.0
NCAS0B050508.271ON92392732770.0
YLR092W (SUL2)8.271ON89389929880.0
Skud_12.1608.271ON89390729730.0
Smik_12.1518.271ON89389929620.0
Suva_10.1768.271ON89390429530.0
KNAG0G020708.271ON89991429060.0
TDEL0F039808.271ON86789427870.0
CAGL0L12342g8.271ON89190627800.0
Skud_2.424na 1ON86390527460.0
Smik_2.435na 1ON86381727440.0
TPHA0J008008.271ON91794527320.0
YBR294W (SUL1)na 1ON85989127320.0
Suva_4.554na 1ON85081927020.0
Kpol_543.438.271ON86688126770.0
KAFR0B027508.271ON83488526730.0
SAKL0H16830g8.271ON86289926200.0
ZYRO0C01452g8.271ON90689025640.0
KLLA0F19338g8.271ON89189224750.0
Kwal_56.237598.271ON86189424150.0
KLTH0G13486g8.271ON90292924060.0
TPHA0A017608.271ON89390323930.0
AGR077C8.271ON84888323290.0
Ecym_42998.271ON87490020970.0
TBLA0F030508.271ON89752713361e-170
NCAS0B048008.99ON7244793165e-29
YPR003C8.99ON7544202979e-27
NDAI0B022108.99ON7064742961e-26
TPHA0H007208.99ON7875832942e-26
CAGL0L09207g8.99ON7254002899e-26
Smik_16.2418.99ON7444702852e-25
Skud_16.2868.99ON7454602844e-25
SAKL0B03124g8.99ON7444082801e-24
KNAG0D023908.99ON7164052791e-24
Suva_16.3228.99ON7424022791e-24
Kpol_467.118.99ON7444102782e-24
ZYRO0F04796g8.99ON7354082782e-24
TBLA0C052708.99ON7764052711e-23
Ecym_7084na 2ON6894302673e-23
KLTH0G16764g8.99ON7104092551e-21
KLLA0E14059g8.99ON7064202523e-21
SAKL0H08800gna 2ON6203782084e-16
TDEL0C012808.99ON7271521933e-14
Kwal_27.110398.99ON7261441907e-14
AGR213Cna 2ON6891531852e-13
CAGL0E01089g8.342ON853200771.7
TPHA0B00170singletonON41060743.3
TPHA0H028507.44ON60183743.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B02020
         (905 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271   1743   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271   1266   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...  1155   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...  1149   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...  1145   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...  1142   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...  1123   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...  1078   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...  1075   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...  1062   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...  1061   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....  1056   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...  1056   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...  1045   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...  1035   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...  1034   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...  1013   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...   992   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...   957   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   934   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...   931   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   926   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   901   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   812   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   519   e-170
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   126   5e-29
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   119   9e-27
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   118   1e-26
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   117   2e-26
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...   115   9e-26
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...   114   2e-25
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...   114   4e-25
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...   112   1e-24
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   112   1e-24
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   112   1e-24
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...   111   2e-24
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   111   2e-24
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...   108   1e-23
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   107   3e-23
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...   102   1e-21
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...   101   3e-21
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    85   4e-16
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    79   3e-14
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    78   7e-14
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    76   2e-13
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...    34   1.7  
TPHA0B00170 Chr2 complement(27065..28297) [1233 bp, 410 aa] {ON}       33   3.3  
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...    33   3.6  

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score = 1743 bits (4514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 859/905 (94%), Positives = 859/905 (94%)

Query: 1   MNQTIPFQKNENNTNDIENQYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPD 60
           MNQTIPFQKNENNTNDIENQYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPD
Sbjct: 1   MNQTIPFQKNENNTNDIENQYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPD 60

Query: 61  LETNNLDVQFSNTYNTGDKKNSIKNHQIQINTFNADSVIIPSFEEHAISFKDYYRHSLKE 120
           LETNNLDVQFSNTYNTGDKKNSIKNHQIQINTFNADSVIIPSFEEHAISFKDYYRHSLKE
Sbjct: 61  LETNNLDVQFSNTYNTGDKKNSIKNHQIQINTFNADSVIIPSFEEHAISFKDYYRHSLKE 120

Query: 121 NFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQY 180
           NFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQY
Sbjct: 121 NFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQY 180

Query: 181 GLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVL 240
           GLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVL
Sbjct: 181 GLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVL 240

Query: 241 AFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTST 300
           AFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTST
Sbjct: 241 AFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTST 300

Query: 301 YKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKF 360
           YKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKF
Sbjct: 301 YKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKF 360

Query: 361 YFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKI 420
           YFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKI
Sbjct: 361 YFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKI 420

Query: 421 APELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSR 480
           APELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSR
Sbjct: 421 APELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSR 480

Query: 481 SALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTW 540
           SALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTW
Sbjct: 481 SALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTW 540

Query: 541 NFWKMNPLDCXXXXXXXXXXXXXXXENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEV 600
           NFWKMNPLDC               ENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEV
Sbjct: 541 NFWKMNPLDCFSFIVTVFITVFSSIENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEV 600

Query: 601 VNGCVDDSFEVTDYSSNSNLSLSADTINHNXXXXXXXXXXXXXXXDQLFSDISSIQGKSK 660
           VNGCVDDSFEVTDYSSNSNLSLSADTINHN               DQLFSDISSIQGKSK
Sbjct: 601 VNGCVDDSFEVTDYSSNSNLSLSADTINHNKKLKILHIPLLKTLKDQLFSDISSIQGKSK 660

Query: 661 IRYYTKWLPFDHAYTKEXXXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQT 720
           IRYYTKWLPFDHAYTKE                YRLTDSFTYMNCSKHYDVIFEEIKKQT
Sbjct: 661 IRYYTKWLPFDHAYTKELNPNVIILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQT 720

Query: 721 KRGQLIRHRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDD 780
           KRGQLIRHRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDD
Sbjct: 721 KRGQLIRHRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDD 780

Query: 781 RPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIG 840
           RPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIG
Sbjct: 781 RPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIG 840

Query: 841 FGTINEEYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDF 900
           FGTINEEYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDF
Sbjct: 841 FGTINEEYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDF 900

Query: 901 YQWDV 905
           YQWDV
Sbjct: 901 YQWDV 905

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score = 1266 bits (3277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/927 (68%), Positives = 723/927 (77%), Gaps = 38/927 (4%)

Query: 6   PFQKNENNTNDIENQYELPSF----PNSDTSSQNLADLELEYDQYKASETNNKSNHG--- 58
           PF   E+  +   +QYE+P++    P+S  S+QNL DLELEYDQYK SETNN  +     
Sbjct: 8   PFNTRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETNNNDDVINNN 67

Query: 59  ----------PDLETN-NLDVQFSNTYNTGDKKNSIKNHQIQINTFNADSVIIPSFEEHA 107
                     P+LET  NLDVQFSNT N  + +  I      ++T N   VIIP+++E  
Sbjct: 68  NNNNNNNNNIPELETQQNLDVQFSNTTNNKENQYRI------VSTVNP--VIIPNYDEKT 119

Query: 108 ISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQS 167
           +S KDYY HS++EN +L  V++Y LSIFPI RWLPHYNL WF+SDLIAGITVGCVLVPQS
Sbjct: 120 VSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQS 179

Query: 168 MSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEA 227
           MSYAQIATLP QYGLYSSFIGAF YSLFATSKDVCIGPVAVMSLET KV+TKVLAKYP+ 
Sbjct: 180 MSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDN 239

Query: 228 DPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPAL 287
           DP ITAP++AT L+ LCG++TAG+G LRLGFLVELISLNAVTGFMTGSALNI+WGQ+P L
Sbjct: 240 DPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGL 299

Query: 288 MGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWF 347
           MGY SKVNTRT+ YKVIIE+LKHLPDTKLDAVFGLIPLF+LYLWKWWC NMGP++ DKWF
Sbjct: 300 MGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWF 359

Query: 348 ANN--EKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLK 405
             N  E+ NFY KKFYFYAQAAKNA+IIIVFTAI+WSIT+GK K +RPISILG+VPKGLK
Sbjct: 360 PKNKNERANFYFKKFYFYAQAAKNAIIIIVFTAISWSITRGKAKADRPISILGTVPKGLK 419

Query: 406 EVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLI 465
           EVGVMKLPDGL SK+APELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLI
Sbjct: 420 EVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLI 479

Query: 466 GTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVI 525
           GTFFNAYPATGSFSRSALKAKC+VRTPLSG+FTG+CVLLALYCLTG F YIPKATLSAVI
Sbjct: 480 GTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVI 539

Query: 526 IHAVSDLIASYHTTWNFWKMNPLDCXXXXXXXXXXXXXXXENGIYFAMCWSCAILVLKVA 585
           I AVSDLIASY  TWNFWKMNPLDC               ENGIYFA+CWSCAIL+LKV 
Sbjct: 540 IQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVC 599

Query: 586 FPAGKFLGRVEIAEVVNGCVDDSFE-VTDYSSNSNLSLSADTINHNXXXXXXXXXXXXXX 644
           FPAGKFLGR+E+AEV++G VD+S E  T    +S  S S+D                   
Sbjct: 600 FPAGKFLGRIEVAEVIDGYVDNSIESATTAEYSSASSPSSDNETDTKKIQKTSSISFGKD 659

Query: 645 XDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKEXXXXXXXXXXXXXXXXYRLTDSFTYMN 704
              +    S +    K+RYYTKW+PFDHAYT+E                YRLTDSFTY+N
Sbjct: 660 AKAVAVSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYIN 719

Query: 705 CSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNND 764
           CS+HYDVIF+E+K+QT+RGQL+RHRKK+DRPWNDPGEWEAP F    K L  R+ KN+ D
Sbjct: 720 CSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQF---LKNLFHRKKKNSTD 776

Query: 765 NEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHF 824
            E         S RD+RPLLK++CLDFSQVAQ+DA+A+QSLVDLRK+IN+YADRQVEFHF
Sbjct: 777 EESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHF 836

Query: 825 AGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYHLAR-IPGDDLELP-----TMRGG 878
           AGIVSPW+K+GLIN GFGTIN+E+SD SIIAGH+SYHL R +P  D +L      T    
Sbjct: 837 AGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRS 896

Query: 879 NYKVYTATGTNLPFFHIDIPDFYQWDV 905
            Y V+ ATGTNLPFFHIDIPDF +WD+
Sbjct: 897 QYHVFAATGTNLPFFHIDIPDFSKWDL 923

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score = 1155 bits (2988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/899 (63%), Positives = 677/899 (75%), Gaps = 29/899 (3%)

Query: 20  QYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDK 79
           + E+P F  ++ +  +L DLELEYDQYK +E NN + +  DLE+N++       +N  + 
Sbjct: 11  EVEIPDFQETNNTVPDLDDLELEYDQYKNNE-NNDTFNDKDLESNSV-----AKHNAVNS 64

Query: 80  KNSIKNHQIQINTFNADSVI-----IPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSI 134
              +K  +I  + FN   V      +  FEE  +S K+YY HS++ + ++K    Y  S+
Sbjct: 65  SKGVKGSKI--DYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSV 122

Query: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSL 194
           FPII WLPHYN +WF++DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSFIGA++YS 
Sbjct: 123 FPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSF 182

Query: 195 FATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFL 254
           FATSKDVCIGPVAVMSL+T KVI  V AKYP+ D  IT PVIAT LA LCG+I+A +GFL
Sbjct: 183 FATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFL 242

Query: 255 RLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDT 314
           RLGFLVELISLNAV GFMTGSA NI+WGQ+PALMGY S VNTR +TYKV+IE+LKHLPDT
Sbjct: 243 RLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDT 302

Query: 315 KLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIII 374
           KLDAVFGLIPLF+LY+WKWWCG  GPR+ D++ + N + +  +K  YFYAQA++N +III
Sbjct: 303 KLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIII 362

Query: 375 VFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLE 434
           VFT I W+IT+GK+K ERPISILGSVP GLKEVGV  +P GL SK+ P LPAS+IVLLLE
Sbjct: 363 VFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLE 422

Query: 435 HIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLS 494
           HIAI+KSFGRINDYKVVPDQELIAIGV+NL+GTFFNAYPATGSFSRSALKAKC VRTPLS
Sbjct: 423 HIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLS 482

Query: 495 GLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXX 554
           GLF+GSCVLLALYCLTG F YIPKATLSAVIIHAVSDL+ASY TTWNFWKMNPLD     
Sbjct: 483 GLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFI 542

Query: 555 XXXXXXXXXXXENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDY 614
                      E+GIYFAMCWSCA+L+LKVAFPAGKFLGRVE+AEV +  V    +V  Y
Sbjct: 543 VTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSY 602

Query: 615 SSNSNLSLSA-------DTINHNXXXXXXXXXXXXXXXDQLFSDISSIQGKSKIRYYTKW 667
            S +N  +S        D  +                  + F   SS   + +I+Y+TKW
Sbjct: 603 VSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKW 662

Query: 668 LPFDHAYTKEXXXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIR 727
           +PFDH YT+E                YRL++S+TY+NCS+HY++I EE+KK T+RGQLIR
Sbjct: 663 IPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIR 722

Query: 728 HRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVS-KRDDRPLLKV 786
           HRKKSDRPWNDPG WEAP F    K L F + + N+     + P   V  +RDDRPLLK+
Sbjct: 723 HRKKSDRPWNDPGPWEAPAF---LKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKI 779

Query: 787 LCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINE 846
           LCLDFSQVAQ DATALQSLVDLRKAIN+YADRQVEFHF GI+SPW+K+GLI+ GFGT+NE
Sbjct: 780 LCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNE 839

Query: 847 EYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905
           EYSDESI+AGHTSYH+AR+P  + E P      Y VYTA+GTNLPFFHIDIPDF +WD+
Sbjct: 840 EYSDESIVAGHTSYHVARVPQGE-ENPE----KYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1149 bits (2973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/907 (63%), Positives = 678/907 (74%), Gaps = 45/907 (4%)

Query: 20  QYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDK 79
           + E+P F ++  S  NL DLELEYDQYK +E NN      DLE+N++    +N     D 
Sbjct: 11  EVEIPDFQDNTDSVPNLDDLELEYDQYKNNE-NNGVFSDNDLESNSV----ANRNAVNDA 65

Query: 80  KNSIKNHQIQINTFNADSVI-----IPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSI 134
           K  +K  +I+   F+   V      +  FEE A+S K+YY HS++ + +LK   +Y  S+
Sbjct: 66  KG-VKGSKIEY--FDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSV 122

Query: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSL 194
           FPII WLPHYN  WF +DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSFIGA+ YS 
Sbjct: 123 FPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSF 182

Query: 195 FATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFL 254
           FATSKDVCIGPVAVMSL+T KVI +V AKYP+ D  IT PVIAT LA LCG+I+A +GFL
Sbjct: 183 FATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFL 242

Query: 255 RLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDT 314
           RLGFLVELISLNAV GFMTGSA NI+WGQ+PALMGY   VNTR +TYKV+IE+LKHLPDT
Sbjct: 243 RLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDT 302

Query: 315 KLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIII 374
           KLDAVFGLIPLF+LY+WKWWCG  GPR+ D++ + N + +  +K  YFYAQA++N +III
Sbjct: 303 KLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIII 362

Query: 375 VFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLE 434
           VFT I W+IT+GK+  ERPISILGSVP GLKEVGV  +P GL SK+ P LP+S+IVLLLE
Sbjct: 363 VFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLLLE 422

Query: 435 HIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLS 494
           HIAI+KSFGRINDYKVVPDQELIAIGV+NL+GTFFNAYPATGSFSRSALKAKC VRTPLS
Sbjct: 423 HIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLS 482

Query: 495 GLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXX 554
           GLF+GSCVLLALYCLTG F YIPKATLSAVIIHAVSDL+ASY TTWNFWKMNPLD     
Sbjct: 483 GLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFI 542

Query: 555 XXXXXXXXXXXENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDY 614
                      E+GIYFAMCWSCA+L+LKVAFPAGKFLGRVEIAEV +  V    +   Y
Sbjct: 543 VTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSY 602

Query: 615 SSNSNLSLSADTINHNXXXXXXXXXXXXXXXDQL---------FSDISSIQGKSKIRYYT 665
            S +N  +S  T+  N                +          F+  SS  G+ +I+Y+T
Sbjct: 603 VSENNNRIS--TLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHT 660

Query: 666 KWLPFDHAYTKEXXXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQL 725
           KWLPFDH YT+E                YRL++S+TY+NCS+HY++I +E+K+ T+RGQ+
Sbjct: 661 KWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQI 720

Query: 726 IRHRKKSDRPWNDPGEWEAPNF---SKLWKK----LSFRRNKNNNDNEETHIPDVPVSKR 778
           IRHRKKSDRPWNDPG WEAP F    K WKK    L F +N  NN  +         ++R
Sbjct: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSID---------AER 771

Query: 779 DDRPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLIN 838
           D+RPLLK+LCLDFSQVAQ DATALQSLVDLRKAIN+YADRQVEFHF GI+SPW+K+GLI+
Sbjct: 772 DERPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLIS 831

Query: 839 IGFGTINEEYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIP 898
            GFGTINEEYSDESI+AGHTSYH+AR+P +  E P      Y VYTA+GTNLPFFHIDIP
Sbjct: 832 RGFGTINEEYSDESIVAGHTSYHVARVPRNK-ENP----DKYSVYTASGTNLPFFHIDIP 886

Query: 899 DFYQWDV 905
           DF +WD+
Sbjct: 887 DFAKWDI 893

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1145 bits (2962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/899 (62%), Positives = 673/899 (74%), Gaps = 29/899 (3%)

Query: 20  QYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDK 79
           + E+P F ++  +  +L DLELEYDQYK +E NN +    DLE+N+  V   N    G  
Sbjct: 11  EVEIPDFQDTSNTVPDLDDLELEYDQYKNNE-NNDAFKDNDLESNS--VAKPNAVGNGKG 67

Query: 80  KNSIKNHQIQINTFNADSVI-----IPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSI 134
               K     I  FN   V      +  FEE  +S K+YY HS++ + +LK  ++Y  S+
Sbjct: 68  AKGSK-----IEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSV 122

Query: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSL 194
           FPII WLPHYN  WF++DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSFIGA++YS 
Sbjct: 123 FPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSF 182

Query: 195 FATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFL 254
           FATSKDVCIGPVAVMSL+T KVI  V AKYP+ DP IT PVIAT LA LCG+I+A IGFL
Sbjct: 183 FATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFL 242

Query: 255 RLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDT 314
           RLGFLVELISLNAV GFMTGSA NI+WGQ+PALMGY S VNTR +TYKV+IE+LKHLPDT
Sbjct: 243 RLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDT 302

Query: 315 KLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIII 374
           KLDAVFGLIPLF+LY+WKWWCG  GP + D++ + N + +  LK  YFYAQA++N VII+
Sbjct: 303 KLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIV 362

Query: 375 VFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLE 434
           VFT I W+IT+GK+K ERPISILGSVP GLKEVGV  +P GL SK+ P LPAS+IVLLLE
Sbjct: 363 VFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLE 422

Query: 435 HIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLS 494
           HIAI+KSFGRINDYKVVPDQELIAIGV+NL+GTFFNAYPATGSFSRSALKAKC VRTPLS
Sbjct: 423 HIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLS 482

Query: 495 GLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXX 554
           GLF+GSCVLLALYCLTG F YIPKATLSAVIIHAVSDL+ASY TTWNFWKMNPLD     
Sbjct: 483 GLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFI 542

Query: 555 XXXXXXXXXXXENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDY 614
                      E+GIYFAMCWSCA+L+LK+AFPAGKFLGRVEIAEV +  +  + +   Y
Sbjct: 543 VTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSY 602

Query: 615 SSNSN----LSLSADTINHNXXXXXXXXXXXXXXXD---QLFSDISSIQGKSKIRYYTKW 667
           +S +N     S   D    +               +   + F   SS+  + +++Y+TKW
Sbjct: 603 TSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKW 662

Query: 668 LPFDHAYTKEXXXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIR 727
           +PFDH YT+E                YRL++S+TY+NCS+HY++I E++K+ T+RGQLIR
Sbjct: 663 VPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIR 722

Query: 728 HRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPV-SKRDDRPLLKV 786
           HRKKSDRPWNDPG WEAP F    K L F + + ++     + PD  + ++RDDRPLLK+
Sbjct: 723 HRKKSDRPWNDPGPWEAPAF---LKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKI 779

Query: 787 LCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINE 846
           LCLDFSQVAQ DATALQSLVDLRK IN+YADRQVEFHF GI+SPW+K+GL++ GFGT+NE
Sbjct: 780 LCLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNE 839

Query: 847 EYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905
           EYSDESI+AGHTSYH+AR+P             Y VYTA+GTNLPFFHIDIPDF +WD+
Sbjct: 840 EYSDESIVAGHTSYHVARVPQSK-----ENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/904 (62%), Positives = 677/904 (74%), Gaps = 30/904 (3%)

Query: 15  NDIENQYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTY 74
           ++IE   E+P F +S T+  +L DLELEYDQYK +E N   N   DLE+N+L       +
Sbjct: 7   SNIEEVVEIPDFQDS-TTVPDLDDLELEYDQYKNNENNGAFNDN-DLESNSL-----TNH 59

Query: 75  NTGDKKNSIKNHQIQINTFNADSVI-----IPSFEEHAISFKDYYRHSLKENFSLKSVKE 129
           NT  +   +K  +++   FN   +      +  F+E  +SFK+YY HS++ + +LK+   
Sbjct: 60  NTASEAKGVKGSKVEY--FNTSDISLYDNSVSQFDEPTVSFKEYYDHSIRSHLTLKAAGN 117

Query: 130 YALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGA 189
           Y  S+FPII WLPHYN+ WF +DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSFIGA
Sbjct: 118 YLKSVFPIIYWLPHYNVNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGA 177

Query: 190 FTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITA 249
           + YS FATSKDVCIGPVAVMSL+T KVI  V A+YP+ D  IT P+IAT LA LCG+I+A
Sbjct: 178 YAYSFFATSKDVCIGPVAVMSLQTAKVIADVTARYPDGDTTITGPIIATTLALLCGIISA 237

Query: 250 GIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLK 309
            +GFLRLGFLVELISLNAV GFMTGSA NI+WGQ+PALMGY   VNTR +TYK++I+SLK
Sbjct: 238 AVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRVATYKIVIDSLK 297

Query: 310 HLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKN 369
           HLPDT LDA FGLIPLFILY WKWWCG  GPR+ D++ +   + +  +K   FYAQA++N
Sbjct: 298 HLPDTTLDAAFGLIPLFILYTWKWWCGTYGPRLNDRFNSKKPRLHKIVKWTCFYAQASRN 357

Query: 370 AVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVI 429
            +IIIVFT IAW+IT+GK+  +RPISILGSVP GLKEVGV  +P GL SK+ P LPAS+I
Sbjct: 358 GIIIIVFTCIAWAITRGKSSADRPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASII 417

Query: 430 VLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEV 489
           VLLLEHIAI+KSFGR+NDYKVVPDQELIAIGV+NL+GTFFNAYPATGSFSRSALKAKC V
Sbjct: 418 VLLLEHIAISKSFGRVNDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNV 477

Query: 490 RTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLD 549
           RTPLSGLF+GSCVLLALYCLTG F YIPKATLSAVIIHAVSDL+ASY TTWNFWKMNPLD
Sbjct: 478 RTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLD 537

Query: 550 CXXXXXXXXXXXXXXXENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCV---D 606
                           ENGIYFAMCWSCAI +LKVAFPAGKFLGRVEIAEV +  V    
Sbjct: 538 FICFIVTVLITVFSSIENGIYFAMCWSCAIFILKVAFPAGKFLGRVEIAEVTDAYVRADS 597

Query: 607 DSFEVTDYSSNSNLSLSADTINHNXXXXXXXXXXXXXXXDQL----FSDISSIQGKSKIR 662
           DS   T  ++N   +L  D +                   ++    F   S+  G+ +I+
Sbjct: 598 DSVSFTSENNNRISTLEEDGVGEKEGPTNYIINSFKKLETKVQTKGFESPSASIGQPRIK 657

Query: 663 YYTKWLPFDHAYTKEXXXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKR 722
           Y+TKWLPFDH YTKE                YRL++S+TY+NCS+HY+VI +EIKK T+R
Sbjct: 658 YHTKWLPFDHKYTKELNPDVNILPPPEGVLVYRLSESYTYINCSRHYNVITDEIKKVTRR 717

Query: 723 GQLIRHRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNN-DNEETHIPDVPVSKRDDR 781
           GQLIRHRKKSDRPWNDPG WE P F   +K L F + K  + ++ E  + +   + RDDR
Sbjct: 718 GQLIRHRKKSDRPWNDPGPWEPPTF---FKNLKFWKKKETDIESSENAVNNPTDAVRDDR 774

Query: 782 PLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGF 841
           PLLK+LCLDFSQVAQ DATALQSLVDLRKAIN+YADRQVEFHF GI+SPW+K+GLI+ GF
Sbjct: 775 PLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGF 834

Query: 842 GTINEEYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFY 901
           GT+NEEYSDESI+AGHTSYH+AR+P ++ E P      Y VYTA+GTNLPFFHIDIPDF 
Sbjct: 835 GTLNEEYSDESIVAGHTSYHVARVPQNE-ETP----DKYSVYTASGTNLPFFHIDIPDFA 889

Query: 902 QWDV 905
           +WD+
Sbjct: 890 KWDI 893

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score = 1123 bits (2906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/914 (61%), Positives = 682/914 (74%), Gaps = 40/914 (4%)

Query: 9   KNENNTNDIENQYELP-SFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPDLETNNLD 67
           + E++ N   N+Y    +  N  +S+ +L +LELEYDQYKA E + +      + +N  D
Sbjct: 9   RQEDSDNSFPNEYGAEYNNANEVSSTPDLDNLELEYDQYKADELHPQRT----ILSNQAD 64

Query: 68  VQFSNTYNTGDKKNSIKNHQI------QINTFNADS---VIIPSFEEHAISFKDYYRHSL 118
                  N   ++ S+++  I      ++  F  +S    +IPS+ E  ++  +++ HSL
Sbjct: 65  TDREKIANVFVEEQSVRDSNIPSASIEELQYFAHESDGAKVIPSYVEGNVTELEFFNHSL 124

Query: 119 KENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPP 178
           +  F+L + K Y LSIFPII WLPHYN+ WF  DLIAGITVGCVLVPQSMSYAQIATLPP
Sbjct: 125 RSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPP 184

Query: 179 QYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIAT 238
           QYGLYSSFIGAF YSLFATSKDVCIGPVAVMSLET K+I +V+ ++P  DP++  P+IAT
Sbjct: 185 QYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFPN-DPDVQGPIIAT 243

Query: 239 VLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRT 298
             A LCG I AG+GFLRLGFLVELISLNAV GFMTGSALNI+ GQ+PALMGYG  VNTRT
Sbjct: 244 TTALLCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRT 303

Query: 299 STYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLK 358
           +TYKVI+ +LKHLPDTKLDAVFGLIPLFILY W+WWC   GP++ D+++    +GNF  K
Sbjct: 304 ATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWK 363

Query: 359 KFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLAS 418
           KFYFYAQA+++ +IIIVFTAI+WSIT+     ER ISILG+VPKGLK+VG +K+P  L +
Sbjct: 364 KFYFYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPA 423

Query: 419 KIAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSF 478
           KIAPELPA+VIVLLLEHIAI+KSFGRINDYKVVPDQELIAIGVTNLIGTFF+AYP TGSF
Sbjct: 424 KIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSF 483

Query: 479 SRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHT 538
           SRSALKAKC V+TPLSGLFTGSCVLLALYCLTG F YIPKATLSAVIIH+VSDL+ASYHT
Sbjct: 484 SRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHT 543

Query: 539 TWNFWKMNPLDCXXXXXXXXXXXXXXXENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIA 598
           TWNF+KMNPLD                ENGIYFA+CWSCA+L+ KVAFPAGKFLGRVEIA
Sbjct: 544 TWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIA 603

Query: 599 EVVNGCV--DDSFEVTDYSSNS----NLSLSADTINHNXXXXXXXXXXXXXXXDQLFSDI 652
           EVV+G +  D+S  +T     S    N   S D +N                 D+L S  
Sbjct: 604 EVVDGEIINDNSVVMTTDDCVSEFGGNKEFSKDKLNGK---------SDFIVKDKLDSTA 654

Query: 653 SSIQ-GKSKIRYYTKWLPFDHAYTKEXXXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDV 711
           SS    ++K++YYTKW+PFDHAYT+E                YR++DS+TY+N S HYD+
Sbjct: 655 SSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDI 714

Query: 712 IFEEIKKQTKRGQLIRHRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIP 771
           I +EIK+ T+RGQL++HRKKSDRPWNDPGEW+ P F  L   L +R+NK  N   +    
Sbjct: 715 IIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKF--LSNVLHWRKNKKKNQTADVESL 772

Query: 772 DVPVSKRDDRPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPW 831
           +  +  RD+RP+LKVLCLDFSQVAQVD+T+LQSLVDLRKA+N YADRQVEFHFAGI+SPW
Sbjct: 773 ETGIV-RDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPW 831

Query: 832 IKKGLINIGFGTINEEYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLP 891
           IK+GL+ IGFGT+NEE+SDESIIAGH+SYHL +    D+E        Y+V TATGTNLP
Sbjct: 832 IKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIGDIE------NGYQVKTATGTNLP 885

Query: 892 FFHIDIPDFYQWDV 905
           FFHIDIPDF +WD+
Sbjct: 886 FFHIDIPDFKKWDI 899

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score = 1078 bits (2787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/894 (59%), Positives = 652/894 (72%), Gaps = 59/894 (6%)

Query: 32  SSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDKK--NSIKNHQIQ 89
           S+  L DLE EYD YKA+E          LE N + V  S   + G+KK  + +K  +++
Sbjct: 13  SAFKLDDLEAEYDLYKANE---------QLEDNEVTVNGSED-DYGNKKGIDLVKETEVR 62

Query: 90  INTFNADSVI---IPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNL 146
                    I   IP FEE  +S KDYY   ++E  +L S   Y  S+FPI++W PHYNL
Sbjct: 63  YYGSPGPEAIGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNL 122

Query: 147 AWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPV 206
            W  +DL+AGITVGCVLVPQSMSYAQIA+LPPQYGLYSSFIGAF YSLFATSKDVCIGPV
Sbjct: 123 TWGYADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPV 182

Query: 207 AVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLN 266
           AVMSL+T KVI +V AKYPE DP +TAPVIAT L+ LCG++  G+G LRLGFLVELISLN
Sbjct: 183 AVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLN 242

Query: 267 AVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLF 326
           AV GFMTGSA NI+WGQ+PALMGY SKVNTR STYKV+I+SLKHLPDTKLDAVFGL+PL 
Sbjct: 243 AVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLC 302

Query: 327 ILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKG 386
           +LYLWKWWCG  GP++AD+  A++ K    LK+FYFY+ A +NAVIIIVFTAI+W ITK 
Sbjct: 303 LLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKN 362

Query: 387 KTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRIN 446
           K K+ RPI +LG+VP GL++VGV K+P+GL +K+AP++PAS+IVLLLEHIAI+KSFGRIN
Sbjct: 363 KDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRIN 422

Query: 447 DYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLAL 506
           DYKVVPDQELIAIG TNLIGTFFNAYPATGSFSRSALKAKCEVRTP SG+FTG CVL+A+
Sbjct: 423 DYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAI 482

Query: 507 YCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXXXXXXXXXXXXXE 566
           YCLT  F +IP ATLSAVIIHAVSDL+ASY TTWNFWKMNPLDC               E
Sbjct: 483 YCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIE 542

Query: 567 NGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEV------TDYSSNSNL 620
           NGIYFAMCWSCA+L+LK AFPAG+FLGRVE+AEV+N  V +  E        + S   + 
Sbjct: 543 NGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGKSK 602

Query: 621 SLSADTINHNXXXXXXXXXXXXXXXDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKEXXX 680
           SL AD                          IS+  G S  ++++KW+   +AY +E   
Sbjct: 603 SLKADK-----------------------GAISASSG-SNYKFHSKWVAEQYAYNRELNP 638

Query: 681 XXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPG 740
                        YR++DSFTY+NCS+HYD IF+ IKK T+RGQL+  RKKSDRPWNDPG
Sbjct: 639 DVKILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPG 698

Query: 741 EWE-APNFSKLWKKLSFRRNKNNNDNEETHIPDVPV-SKRDDRPLLKVLCLDFSQVAQVD 798
           EWE +P+  K      F+  K N ++ E+   DV + + RD+RPLLK++CLDFSQV QVD
Sbjct: 699 EWEISPSIKKF-----FKLGKKNQNDIESQDEDVAIDNTRDERPLLKIICLDFSQVVQVD 753

Query: 799 ATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHT 858
           +TA+QSLVDLRKA++KYADRQVEFHF GI+S W+K+ L+++GFGT+N  YSDESIIAGH+
Sbjct: 754 STAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHS 813

Query: 859 SYHLARIPG-------DDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905
           SYH+A+           D    +    + ++Y ATGTN+PFFH+DIPDF +WD+
Sbjct: 814 SYHIAKTTKPLADDFTTDSSGSSQLQQSQEIYAATGTNMPFFHLDIPDFSKWDL 867

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score = 1075 bits (2780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/906 (60%), Positives = 652/906 (71%), Gaps = 50/906 (5%)

Query: 34  QNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDKKNSIKNHQIQINTF 93
           + L +LELEY+Q+K +E  + +N G D+E               D K   +      +T+
Sbjct: 2   EELDNLELEYNQFKNNERPSNTNAGADIEKG------------LDTKKYFERSITDNSTY 49

Query: 94  NADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDL 153
              S  IPS+EE  I+ KDYY  +L++ F+  SV +Y  S+FP++ WLP YN  WF SDL
Sbjct: 50  GKKSYSIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDL 109

Query: 154 IAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLET 213
           IAGITVG VLVPQSMSYAQIATLPP+YGLYSSFIGA  YS FATSKDVCIGPVAVMSL+T
Sbjct: 110 IAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQT 169

Query: 214 GKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMT 273
            KVI +V  K+P+ DP+IT P+IATVLAF+CG+I  G+G LRLGFLVELISLNAV GFMT
Sbjct: 170 AKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMT 229

Query: 274 GSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKW 333
           GSA NI+WGQIP LMGY  KVNTR STY V+I+SLKHLPDTKLDA FGLIPLF L+ WKW
Sbjct: 230 GSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKW 289

Query: 334 WCGNMGPRMADKWFANNE--KGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDE 391
           WC +MGP++ D++F  N   + N Y K FYFY QA++N +III+FTA+++ ITKG  KD+
Sbjct: 290 WCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDK 349

Query: 392 RPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRINDYKVV 451
           R IS+LG+VPKGL+  GVMKLP G+ + IA E+P+S+IVLLLEHIAI+KSFGR+NDYK+ 
Sbjct: 350 RRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKIN 409

Query: 452 PDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTG 511
           P+QE+IAIGV+NL+GTFFNAYPATGSFSRSALKAKC V TPLSG+F+ +CVLLA+YCLTG
Sbjct: 410 PNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTG 469

Query: 512 VFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXXXXXXXXXXXXXENGIYF 571
            F YIPKATLSAVIIHAV DLIASYHTTW+ WKMN  D                ENGIYF
Sbjct: 470 AFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYF 529

Query: 572 AMCWSCAILVLKVAFPAGKFLGRVEIAEVVN-GCVDDSFEVTDYS-SNSNLSLSADTINH 629
           A+CWSCAIL+   AFPAGKFLGR+EIAEVVN   VDD     D+S  NSN S   + I  
Sbjct: 530 AVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDD----DFSFENSNESFDDEGIYF 585

Query: 630 NXXXXXXXXXXXXXXXDQLFSDIS--SIQGK-------SKIRYYTKWLPFDHAYTKEXXX 680
           +                +  + +   SI G+       S IRYYTKW+PFDHAY+KE   
Sbjct: 586 DNSVAEDKLGTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNP 645

Query: 681 XXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPG 740
                        YRL+DS+TY+NCS+HYD+IF+EIK+ T+RGQLI+HR K DRPWNDPG
Sbjct: 646 SVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPG 705

Query: 741 EWEAPNFSKLW--KKL--SFRRNKNN-----NDNEETHIPDVPVSK---RDDRPLLKVLC 788
           EWEAP+  K +  KK    F+R   +     N+NE  HI D    K   +D+RPLL+V+C
Sbjct: 706 EWEAPDLKKFFNVKKFVSVFKRKVTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVC 765

Query: 789 LDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEY 848
           LDFSQVA  DATALQSL DLRKA+NKYADRQVEFHF GI SPWIK+GL N+GFGT NEEY
Sbjct: 766 LDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEY 825

Query: 849 SDESIIAGHTSYHLARIPG---------DDLELPTMRGGNYKVYTATGTNLPFFHIDIPD 899
           SDESIIAGH+SYHL+R            D LE     G   KV  A+GTNLPFFH+DIPD
Sbjct: 826 SDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPD 885

Query: 900 FYQWDV 905
           F +WD+
Sbjct: 886 FSKWDI 891

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score = 1062 bits (2746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/905 (59%), Positives = 650/905 (71%), Gaps = 74/905 (8%)

Query: 28  NSDTSSQNLAD---------LELEYDQYKASET-NNKSNHGPDLETNNLDVQFSNTYNTG 77
           NS  SS  + D          E EY  Y+ SE   N+ N             F N  +  
Sbjct: 6   NSHKSSTEVLDNQEDTDIEVFESEYRTYRESEAAENRDN-------------FQNGDDQS 52

Query: 78  DKKNSIKNHQI---QINTFNADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSI 134
            K N  + +++   +++    DS  IP++EE  ++ K+YY HS+K + ++KS  +Y  S+
Sbjct: 53  WKINGKQKYEVTKSEVSDVAYDS--IPAYEESTVTLKEYYDHSIKSSLTVKSAGDYLYSL 110

Query: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSL 194
           FPII+WLPHYN  W  +DL+AGITVGCVLVPQSMSYAQIA+L P+YGLYSSFIGAF YSL
Sbjct: 111 FPIIKWLPHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSL 170

Query: 195 FATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFL 254
           FATSKDVCIGPVAVMSL+T KVI +VL KYPE    +T P+IAT L FLCGV++  +G L
Sbjct: 171 FATSKDVCIGPVAVMSLQTAKVIAEVLKKYPEGQTEVTGPIIATALCFLCGVVSTALGVL 230

Query: 255 RLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDT 314
           RLGFLVELISLNAV GFMTGSA +I+WGQIPALMGY S VNTR +TYKV+I +LKHLP+T
Sbjct: 231 RLGFLVELISLNAVAGFMTGSAFSIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNT 290

Query: 315 KLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIII 374
           KLDAVFGLIPL ILY+WKWWCG  G  +AD+++ N  K    LK FYFYAQA +NAV+II
Sbjct: 291 KLDAVFGLIPLVILYVWKWWCGTFGITLADRYYRNQPKIANRLKSFYFYAQAMRNAVVII 350

Query: 375 VFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLE 434
           VFTAI+W IT+ K+  ERPISILG+VP GL EVGVMK+P+GL S ++ ELPAS+IVL+LE
Sbjct: 351 VFTAISWRITRNKSSKERPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLE 410

Query: 435 HIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLS 494
           HIAI+KSFGRINDYKV+PDQELIAIGVTNLIGTFF++YPATGSFSRSALKAKC VRTP S
Sbjct: 411 HIAISKSFGRINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFS 470

Query: 495 GLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXX 554
           G+FTG+CVLLALYCLT  F +IPKATLSAVIIHAVSDL+ SY TTW FWK NPLDC    
Sbjct: 471 GIFTGACVLLALYCLTSAFFFIPKATLSAVIIHAVSDLLTSYKTTWIFWKTNPLDCISFI 530

Query: 555 XXXXXXXXXXXENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDY 614
                      ENGIYFAMCWSCA+L+LK AFPAGKFLGRVE+AEV+N  V +       
Sbjct: 531 ATVFITVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEGINAVTS 590

Query: 615 SSNSNLSLSADTINHNXXXXXXXXXXXXXXXDQLFSDISSIQGKSKIRYYTKWLPFDHAY 674
           S+     LS                       Q+ S +  +    + ++  KW+PFDH Y
Sbjct: 591 SNELPNELS----------------------KQVKSTVDVLPAP-EYKFSVKWIPFDHDY 627

Query: 675 TKEXXXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDR 734
           ++E                YRL DSFTY+NCS+HYD+IF+ IK++T+RGQLI  RKKSDR
Sbjct: 628 SRELNRYTKVRPPPPGVIVYRLADSFTYVNCSRHYDIIFDRIKEETRRGQLISLRKKSDR 687

Query: 735 PWNDPGEWEAPN-FSKLWKKLSFRRNKNNNDNEETHIPDVPVS------KRDDRPLLKVL 787
           PWNDPGEW+ PN F  L+K   F+R     DNE      +PVS      +  ++PLLKV+
Sbjct: 688 PWNDPGEWKMPNSFKALFK---FKRKSATTDNE------LPVSSGRNNQESYEKPLLKVV 738

Query: 788 CLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEE 847
           CLDFSQVAQVD+TA+QSLVDLRKA+NKYADRQVEFHFAGI+SPWIK+ L+++ FGT NEE
Sbjct: 739 CLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEE 798

Query: 848 YSDESIIAGHTSYHLARIPGDDLELP------TMRGGNYK-VYTATGTNLPFFHIDIPDF 900
           YSD+SIIAGH+S+H+A++  DD++        +    NY+ +  ATGTNLPFFHIDIPDF
Sbjct: 799 YSDDSIIAGHSSFHVAKVLKDDVDYTEEDSRISTSYSNYETLCAATGTNLPFFHIDIPDF 858

Query: 901 YQWDV 905
            +WDV
Sbjct: 859 SKWDV 863

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score = 1061 bits (2744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/817 (62%), Positives = 625/817 (76%), Gaps = 40/817 (4%)

Query: 100 IPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITV 159
           IP++EE+ ++ KDYY H++K+N +LKS   Y  S+FPII+WLPHYN  W  +DL+AGITV
Sbjct: 76  IPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHYNFTWGYADLVAGITV 135

Query: 160 GCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITK 219
           GCVLVPQSMSYAQIA+L P+YGLYSSFIGAF YSLFATSKDVCIGPVAVMSL+T KVI +
Sbjct: 136 GCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAE 195

Query: 220 VLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNI 279
           VL KYPE    +T P+IAT L  LCG++  G+G LRLGFLVELISLNAV GFMTGSA +I
Sbjct: 196 VLKKYPEDQVEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELISLNAVAGFMTGSAFSI 255

Query: 280 MWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCGNMG 339
           +WGQIPALMGY   VNTR +TYKV+I +LKHLP+TKLDAVFGLIPL ILYLWKWWCG+ G
Sbjct: 256 IWGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYLWKWWCGSFG 315

Query: 340 PRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGS 399
            ++ D+ ++N  K    +K FYFYAQA +NAV+IIVFTAI++ IT+ K+K++RPISILG+
Sbjct: 316 IKLVDRHYSNQPKTANRIKSFYFYAQAMRNAVVIIVFTAISFRITRNKSKEKRPISILGT 375

Query: 400 VPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAI 459
           VP GL EVGVMK+PDGL S ++ ELPAS+IVL+LEHIAI+KSFGRINDYKV+PDQELIAI
Sbjct: 376 VPSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQELIAI 435

Query: 460 GVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKA 519
           GVTNLIGTFF++YPATGSFSRSALKAKC VRTP SG+FTG+CVLLALYCLT  F YIPKA
Sbjct: 436 GVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVLLALYCLTSAFFYIPKA 495

Query: 520 TLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXXXXXXXXXXXXXENGIYFAMCWSCAI 579
           TLSAVIIHAVSDL+ASY TTWNFWKMNPLDC               ENGIYFAMCWSCA+
Sbjct: 496 TLSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFSSIENGIYFAMCWSCAM 555

Query: 580 LVLKVAFPAGKFLGRVEIAEVVNGCVD---DSFEVTDYSSNSNLSLSADTINHNXXXXXX 636
           L+LK AFPAGKFLGRVE+AEV+N  +    DS    + S N                   
Sbjct: 556 LLLKQAFPAGKFLGRVEVAEVLNPTIQGHIDSIVSPNESPNE------------------ 597

Query: 637 XXXXXXXXXDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKEXXXXXXXXXXXXXXXXYRL 696
                     Q+ S + ++   S+ ++  KW+PFDHAYT+E                YR 
Sbjct: 598 -------FSKQVKSSVDALPS-SEYKFSVKWVPFDHAYTRELNSYTRVRPPPPGVIVYRF 649

Query: 697 TDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPGEWEAPN-FSKLWKKLS 755
           +DSFTY+NCS+HYDVIF+ IK++T+RGQL+  RKKSDRPWNDPGEW+ PN F  +++   
Sbjct: 650 SDSFTYVNCSRHYDVIFDRIKEETRRGQLVSLRKKSDRPWNDPGEWKLPNSFKNIFR--- 706

Query: 756 FRRNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKY 815
            +R     ++E   + D   S+  ++PLLKV+CLDFSQVAQVD+TA+QSLVDLRKA+NKY
Sbjct: 707 VKRGLATKNSELPAVNDNTNSESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKY 766

Query: 816 ADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYHLARIPGDDLELP-- 873
           ADRQVEFHFAGI+SPWIK+ L+++ FGTINEE+SD SII GH+S+H+A++  D+++    
Sbjct: 767 ADRQVEFHFAGIISPWIKRSLLSVKFGTINEEFSDTSIITGHSSFHIAKVLKDEVDYTDE 826

Query: 874 ----TMRGGNY-KVYTATGTNLPFFHIDIPDFYQWDV 905
               ++   NY  +  ATGTNLPFFHIDIPDF +WDV
Sbjct: 827 DSPISVTCSNYDTLCAATGTNLPFFHIDIPDFSKWDV 863

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/945 (57%), Positives = 658/945 (69%), Gaps = 72/945 (7%)

Query: 5   IPFQKNENNT---NDIENQYELPSFPNSDTSSQNLADLELEYDQYKASE-----TNNKSN 56
           +P  K  + T    D++N  EL S+ NS+T   +L  LE EYDQYK  E     + N  N
Sbjct: 1   MPTDKKNDTTVDNRDLDN-IELSSYSNSNTV--DLEALEEEYDQYKKEEEIEYISGNYLN 57

Query: 57  HGPDLETNNLDVQFSNTYNTGDKKNSIKNHQIQINTFNADS-VIIPSFEEHAISFKDYYR 115
             P   T N++V  +  Y    K   +      ++T   D+  +IP+  E+ I+FK+YY 
Sbjct: 58  SSP---TQNINVTSNPKYEEYKKLKHLDQSYNYVSTEYLDTDYLIPAHNENIITFKEYYN 114

Query: 116 HSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIAT 175
           HSLKE F+  + K YALSIFPII WLP YN  WF SDLIAGIT+GCVLVPQSMSYAQIAT
Sbjct: 115 HSLKEYFTFNAAKNYALSIFPIIHWLPFYNFNWFISDLIAGITIGCVLVPQSMSYAQIAT 174

Query: 176 LPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPV 235
           L PQYGLYSSFIGAF Y+LFATSKDVCIGPVAVMSLET KVI  V + + + DP++T P+
Sbjct: 175 LDPQYGLYSSFIGAFVYALFATSKDVCIGPVAVMSLETAKVIADVSSHF-QNDPDVTGPI 233

Query: 236 IATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVN 295
           IAT LA LCG I A +GFLRLGFLVELISLNAVTGFMTGSA NI+WGQ+P LMGY   VN
Sbjct: 234 IATTLALLCGGIAAAVGFLRLGFLVELISLNAVTGFMTGSAFNILWGQVPGLMGYSKLVN 293

Query: 296 TRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNF 355
           TR +TYKV+I++LKHLPDTKLDAVFGLIPLFILY+ KWWC N G ++A+K F++NE+  F
Sbjct: 294 TRQATYKVVIDTLKHLPDTKLDAVFGLIPLFILYVVKWWCTNYGLQLAEKQFSSNERYRF 353

Query: 356 YLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDG 415
           YLKKFYFY  A +NAV+II+FTAI+WSIT+ K+  ERPI++LG+VP GLK++GV K    
Sbjct: 354 YLKKFYFYTNAMRNAVVIIIFTAISWSITRNKSSSERPITVLGTVPSGLKDIGVFKPQTK 413

Query: 416 LASKIAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPAT 475
           +  KI P+LPAS+IVLLLEHIAIAKSFGRINDYK+VPDQELIAIG++NL+GTFF+AYPAT
Sbjct: 414 IVQKIGPQLPASIIVLLLEHIAIAKSFGRINDYKIVPDQELIAIGISNLVGTFFSAYPAT 473

Query: 476 GSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIAS 535
           GSFSRSAL AKC V+TPLSG+FTG CVLLALYCLTG F YIPKATLSAVIIHAVSDLIAS
Sbjct: 474 GSFSRSALNAKCNVKTPLSGIFTGGCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLIAS 533

Query: 536 YHTTWNFWKMNPLDCXXXXXXXXXXXXXXXENGIYFAMCWSCAILVLKVAFPAGKFLGRV 595
           Y TT +FW MNPLD                ENGIYFAMC+SCA+ + + AFPAGKFLGR+
Sbjct: 534 YQTTLSFWNMNPLDTLCFLVTVLITVFSSIENGIYFAMCYSCALFIFRSAFPAGKFLGRI 593

Query: 596 EIAEVVNGCVDDSFEVTDYSSNSNLSLSADTINHNXXXXXXXXXXXXXXXDQLFSDISSI 655
           EIAEV+N    D F++ +++         +T  +N               DQ +     I
Sbjct: 594 EIAEVINATPKDDFQMDNFN-------GFETSEYN-----------NFPADQSYGKF-DI 634

Query: 656 QGKSKIRY---------YTKWLPFDHAYTKEXXXXXXXXXXXXXXXXYRLTDSFTYMNCS 706
             K+  +Y         YTKW+PFDH YTKE                YRL+DSF Y+NCS
Sbjct: 635 ANKNTHKYNSPHCSKNFYTKWVPFDHTYTKELNKDVEILEPPPGVIVYRLSDSFIYLNCS 694

Query: 707 KHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNE 766
           +H+D IF+E+K++TKRG+ I + KKS RPWNDPGEWEAP +  + KK S R         
Sbjct: 695 RHFDTIFDEVKRKTKRGKFIGNIKKSQRPWNDPGEWEAPTW--MTKKFSIRNLFKRKQEA 752

Query: 767 ETHIP------DVPVSKRDD-----RPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKY 815
           E+++P      D+ +S   D     RP+L+V+CLDFSQV+Q D TALQSL DLRK++N Y
Sbjct: 753 ESNVPNEDASTDLDISNNKDIDMDHRPVLQVICLDFSQVSQTDNTALQSLFDLRKSVNSY 812

Query: 816 ADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYHLARIPG-------- 867
           ADRQVEFHF GI+SPW+K+GLI +GFGT+NE YSD S I GH SYH+ + P         
Sbjct: 813 ADRQVEFHFCGIISPWVKRGLIKLGFGTVNEAYSDASTIVGHVSYHIVKNPTFRNKSFSS 872

Query: 868 -------DDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905
                   D+ +      NY +  A+GTN PFFHIDIP+F +WDV
Sbjct: 873 HTSEDTISDMNIEAKDYNNYSIEAASGTNYPFFHIDIPNFSKWDV 917

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/891 (58%), Positives = 645/891 (72%), Gaps = 61/891 (6%)

Query: 33  SQNLADLEL---EYDQYKASET--NNKSNHGPDLETNNLDVQFSNTYNTGDKKNSIKNHQ 87
           +Q  AD+E+   EY  Y+ SE   N    H  D E   +        N+  +K  +  ++
Sbjct: 12  NQEDADIEVFESEYRTYRESEAAENRDGLHNGDEENWKV--------NSSKQKFGVTKNE 63

Query: 88  IQINTFNADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLA 147
           +    +++    IP++EE  ++ K+YY HS+K N + KS   Y +S+FPII+W PHYN  
Sbjct: 64  LSDVLYDS----IPAYEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHYNFT 119

Query: 148 WFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVA 207
           W  +DL+AGITVGCVLVPQSMSYAQIA+L P+YGLYSSFIGAF YSLFATSKDVCIGPVA
Sbjct: 120 WGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVA 179

Query: 208 VMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNA 267
           VMSL+T KVI +VL KYPE    +TAP+IAT L  LCG++  G+G LRLGFLVELISLNA
Sbjct: 180 VMSLQTAKVIAEVLKKYPEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNA 239

Query: 268 VTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFI 327
           V GFMTGSA NI+WGQIPALMGY S VNTR +TYKV+I +LKHLP+TKLDAVFGLIPL I
Sbjct: 240 VAGFMTGSAFNIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVI 299

Query: 328 LYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGK 387
           LY+WKWWCG  G  +AD+++ N  K    LK FYFYAQA +NAV+I+VFTAI+WSIT+ K
Sbjct: 300 LYVWKWWCGTFGITLADRYYRNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSITRNK 359

Query: 388 TKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRIND 447
           +  +RPISILG+VP GL EVGVMK+PDGL S ++ E+PAS+IVL+LEHIAI+KSFGRIND
Sbjct: 360 SSKDRPISILGTVPSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGRIND 419

Query: 448 YKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALY 507
           YKVVPDQELIAIGVTNLIGTFF++YPATGSFSRSALKAKC VRTP SG+FTG CVLLALY
Sbjct: 420 YKVVPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALY 479

Query: 508 CLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXXXXXXXXXXXXXEN 567
           CLT  F +IPKATLSAVIIHAVSDL+ SY TTW FWK NPLDC               EN
Sbjct: 480 CLTDAFFFIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIEN 539

Query: 568 GIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDYSSNSNLSLSADTI 627
           GIYFAMCWSCA+L+LK AFPAGKFLGRVE+AEV+N  V +  +    S+     L+    
Sbjct: 540 GIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEDIDAVISSNELPNELN---- 595

Query: 628 NHNXXXXXXXXXXXXXXXDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKEXXXXXXXXXX 687
                              Q+ S +  +    + ++  KW+PFDH Y++E          
Sbjct: 596 ------------------KQVKSTVEVLPAP-EYKFSVKWVPFDHGYSRELNINTTVRPP 636

Query: 688 XXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPGEWEAPNF 747
                 YRL DSFTY+NCS+HYD+IF+ IK++T+RGQLI  RKKSDRPWNDPGEW+ P+ 
Sbjct: 637 PPGVIVYRLGDSFTYVNCSRHYDIIFDRIKEETRRGQLITLRKKSDRPWNDPGEWKMPD- 695

Query: 748 SKLWKKLSFRRNKNNNDNEETHIPDVPVSKRD------DRPLLKVLCLDFSQVAQVDATA 801
             L     F+R+    ++      D+P+S         ++PLLKV+CLDFSQVAQVD+TA
Sbjct: 696 -SLKSLFKFKRHSATTNS------DLPISNGSSNGETYEKPLLKVVCLDFSQVAQVDSTA 748

Query: 802 LQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYH 861
           +QSLVDLRKA+N+YADRQVEFHFAGI+SPWIK+ L+++ FGT NEEYSD+SIIAGH+S+H
Sbjct: 749 VQSLVDLRKAVNRYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFH 808

Query: 862 LARIPGDDLELP------TMRGGNYK-VYTATGTNLPFFHIDIPDFYQWDV 905
           +A++  DD++        +    NY+ +  ATGTNLPFFHIDIPDF +WDV
Sbjct: 809 VAKVLKDDVDYTDEDSRISTSYSNYETLCAATGTNLPFFHIDIPDFSKWDV 859

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score = 1045 bits (2702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/819 (61%), Positives = 611/819 (74%), Gaps = 47/819 (5%)

Query: 100 IPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITV 159
           IP +EE  ++ K+YY HS+K + + KS   Y  S+FPI++WLPHYN  W  +DL+AGITV
Sbjct: 66  IPRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCYADLVAGITV 125

Query: 160 GCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITK 219
           GCVLVPQSMSYAQIA+L P+YGLYSSF+GAF YSLFATSKDVCIGPVAVMSL+T KVI +
Sbjct: 126 GCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAE 185

Query: 220 VLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNI 279
           VL KYP+    +T P+IAT L  LCG++T  +G LRLGFLVELISLNAV GFMTGSA +I
Sbjct: 186 VLKKYPQDQTEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAGFMTGSAFSI 245

Query: 280 MWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCGNMG 339
           +WGQ+PALMGY   VNTR STYKV+I +LKHLP+TKLDAVFGLIPL ILY+WKWWCG  G
Sbjct: 246 IWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYVWKWWCGTYG 305

Query: 340 PRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGS 399
             +A++ + N+ K    LK FYFYAQA +NAV+I+VFTAI+WSIT+ K  ++RPISILG+
Sbjct: 306 ITLANRHYQNHPKIANNLKSFYFYAQAMRNAVVIVVFTAISWSITRNKASEDRPISILGT 365

Query: 400 VPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAI 459
           VP GL EVGVMK+P+GL S ++ ELPAS+IVL+LEHIAI+KSFGRINDYKVVPDQELIAI
Sbjct: 366 VPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVVPDQELIAI 425

Query: 460 GVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKA 519
           GVTNL+GTFF++YPATGSFSRSALKAKC VRTP SGLFTG CVLLALYCLT  F +IPKA
Sbjct: 426 GVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLTDAFFFIPKA 485

Query: 520 TLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXXXXXXXXXXXXXENGIYFAMCWSCAI 579
           TLSAVIIHAVSDL+ SY TTW FWK NPLDC               ENGIYFAMCWSCAI
Sbjct: 486 TLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIYFAMCWSCAI 545

Query: 580 LVLKVAFPAGKFLGRVEIAEVVNGCVDDSFE--VTDYSSNSNLSLSADTINHNXXXXXXX 637
           L+LK AFPAG+FLGRVE+AE++N  + ++    V+   SN  +  + D +          
Sbjct: 546 LLLKQAFPAGRFLGRVEVAEILNPTLQNNVSAVVSLNESNKQVKTTVDVLR--------- 596

Query: 638 XXXXXXXXDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKEXXXXXXXXXXXXXXXXYRLT 697
                                S+ R+ TKW+PFDH Y++E                YRL+
Sbjct: 597 --------------------SSEYRFTTKWVPFDHEYSRELNRCAKICPPPPGVIVYRLS 636

Query: 698 DSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPGEWEAPNFSKLWKKLSFR 757
           DSFTY+NCS+HYD+IF+ +K++T+RGQL+  RKKSDRPWNDPGEW+ P  + L     F+
Sbjct: 637 DSFTYVNCSRHYDIIFDHVKEETRRGQLVNLRKKSDRPWNDPGEWKMP--TSLKTLFRFK 694

Query: 758 RNKNNNDNEETHIPDVPVSKRD-DRPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYA 816
           R K+  +NEE  + +   ++   ++PLLKV+CLDFSQVAQVD+TA+QSLVDLRKA+NKYA
Sbjct: 695 R-KSVTENEEPSVSNGSTNRGSYEKPLLKVICLDFSQVAQVDSTAIQSLVDLRKAVNKYA 753

Query: 817 DRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYHLARIPGDD------- 869
           DRQVEFHFAGI+SPWIK+ L ++ FGT+NEEYSDES+IAGH+S H+ +   DD       
Sbjct: 754 DRQVEFHFAGIISPWIKRSLSSVDFGTVNEEYSDESVIAGHSSVHVTKFSSDDDADYTDE 813

Query: 870 ---LELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905
              +  P    G   +  ATGTNLPFFHIDIPDF +WD+
Sbjct: 814 ESHISAPYSNYGT--LCAATGTNLPFFHIDIPDFSKWDI 850

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/881 (58%), Positives = 642/881 (72%), Gaps = 47/881 (5%)

Query: 43  YDQYKASETNNKSNHGPDLETNNL---------DVQFSNTYNTGDKKNSIKNHQIQINTF 93
           Y+QYK  E    S+ G     ++L         D +F    + G   +S   +++   +F
Sbjct: 15  YNQYKTVEEQGNSDVGDSSGNDDLGNAGDGLTKDSKFVFEKDLGYTDDS---NELTRESF 71

Query: 94  NADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDL 153
              S  +P + E  ++ K+YY HS++   + KS   Y +SIFPII+WLP YN  W  SDL
Sbjct: 72  LNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDL 131

Query: 154 IAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLET 213
           IAGIT+GCVLVPQSMSYAQIATLPPQYGLYSSF+GA+TYSLFATSKDVCIGPVAVMSL+T
Sbjct: 132 IAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQT 191

Query: 214 GKVITKVLAKYPEADPN-ITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFM 272
            KVI  V +   E     ITAP+IAT LA LCG+I+AG+G LRLGFLVELISLNAVTGFM
Sbjct: 192 AKVIQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFM 251

Query: 273 TGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWK 332
           TGSALNI+ GQ+PALMGY S+VNTR +TYKVII +LKHLPDTK+DA+FGLIPL ILY WK
Sbjct: 252 TGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWK 311

Query: 333 WWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDER 392
           WW  +MGP++ D+++ N+ K   Y+K FYFY  A ++ +IIIV T+I+WS+T+GK+K ER
Sbjct: 312 WWFSSMGPKLVDRYYPNS-KYKKYIKAFYFYGNAMRSGIIIIVMTSISWSVTRGKSKSER 370

Query: 393 PISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRINDYKVVP 452
           PISILG+VP GL+EVGV   P+GL +K+APELP+S+IVLLLEHIAIAKSFGR+NDYKVVP
Sbjct: 371 PISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVP 430

Query: 453 DQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGV 512
           DQELIAIG++NLIGTFFN+YP TGSFSRSALKAKC V+TPLSG+FTGSCVLLALYCLTG 
Sbjct: 431 DQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGA 490

Query: 513 FLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXXXXXXXXXXXXXENGIYFA 572
           F YIPKATLSAVIIHAVSDL+ASY TTW+FWKMNPLD                E+GIYF 
Sbjct: 491 FFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFT 550

Query: 573 MCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDY-SSNSNLSLSADTINHNX 631
           MCWS AIL+ KVAFPAGKFLG V+IAE+VN  + DS    DY    +  S+   T+  N 
Sbjct: 551 MCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDS----DYLVEKAETSVQYSTVLMNP 606

Query: 632 XXXXXXXXXXXXXXDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKEXXXXXXXXXXXXXX 691
                          QL             +Y+ KW+P+DHAYTKE              
Sbjct: 607 EKGELSYLSSKSSESQL-------------KYHIKWIPYDHAYTKEMNPNVEVTPPPDGV 653

Query: 692 XXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPGEWEAPNFSKLW 751
             YRLT+SFTY+NCS++Y+ +++++K+ T+ GQL+ H KKSDRPWNDPG+W+ P F K  
Sbjct: 654 IVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLK-- 711

Query: 752 KKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQVDATALQSLVDLRKA 811
             +++R+NKN +D   T    V     D RP+LK++CLDFSQVAQ D+TALQSL+DLR+A
Sbjct: 712 NIINWRKNKNKDDEPTTFDNKV----VDTRPILKIICLDFSQVAQTDSTALQSLLDLRRA 767

Query: 812 INKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYHLARIPGDDLE 871
           INKYADRQVEFHF+GI+SPW+KKGL+N+GFGT+N+EYSDESII GHTSYH+ +   +DLE
Sbjct: 768 INKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKT--EDLE 825

Query: 872 LPTM-------RGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905
              M       +  +Y ++  TGTN PFFHI+IPDF +W++
Sbjct: 826 NNPMTTVEEPNQNSSYYIHAGTGTNFPFFHIEIPDFSKWNI 866

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score = 1034 bits (2673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/885 (59%), Positives = 630/885 (71%), Gaps = 70/885 (7%)

Query: 31  TSSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDKKNSIKNHQIQI 90
           T   NL DLE E++QYK  E    S         N +V   ++   G    ++K+     
Sbjct: 10  TDFSNLDDLEQEFNQYKKIELTISSTR------QNEEV---DSKRQGKSDKNVKSSSFDS 60

Query: 91  NTFNADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFS 150
                    +P++EE++I+  DYY +SL+  F+ K++ +Y  S+FPI  WLPHYNL WF 
Sbjct: 61  IFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFI 120

Query: 151 SDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMS 210
           SDLIAGITVGCVLVPQSMSYAQIATL PQ+GLYSSFIGAF+YSLFATSKDVCIGPVAVMS
Sbjct: 121 SDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMS 180

Query: 211 LETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTG 270
           L+T KVI +V  K P +D +ITA  IAT LA LCG+I  G+G LRLGFLVELISLNAV G
Sbjct: 181 LQTAKVIARVQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAG 239

Query: 271 FMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYL 330
           FMTGSALNI+ GQ+P LMGY S+VNTRTSTYKVII++LKHLPDTKLDAVFGLIPLF+L+ 
Sbjct: 240 FMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFA 299

Query: 331 WKWWCGNMGPRMADKWFAN--NEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKT 388
           WKW C  +GPR+ ++ F N  N + +  +K FYFYAQ  KNA+IIIVFT I+W+IT+GKT
Sbjct: 300 WKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKT 359

Query: 389 KDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRINDY 448
            + RPIS+LGSVPKGLK+V    +P GL +K+APELPAS+IVLLLEHIAIAKSFGRINDY
Sbjct: 360 SETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDY 419

Query: 449 KVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYC 508
           K+VPDQE++AIG+TNL+GTFF+AYPATGSFSRSALKAKC VRTPLSGLF+G+CVLLALYC
Sbjct: 420 KIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYC 479

Query: 509 LTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXXXXXXXXXXXXXENG 568
           LTG F YIPKATL AVIIHAVS+LIASY  T NFWKMNPLDC               E+G
Sbjct: 480 LTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDG 539

Query: 569 IYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNG-CVDDSFEVTDYSSNSNL------S 621
           IYFAMCWS A+L+ KVAFP GKFLG++EI EV++G  V DS  +T    NS +       
Sbjct: 540 IYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDENSEILPTTKAG 599

Query: 622 LSADTI-NHNXXXXXXXXXXXXXXXDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKEXXX 680
            S + + NHN                                YYTKW+PFD +YTKE   
Sbjct: 600 YSVEVVSNHN----------------------------ENTNYYTKWVPFDFSYTKELNP 631

Query: 681 XXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPG 740
                        YR+ DSFTYMNCS+H+D++F+EIK+ TKRG+L +  +KSDRPWNDPG
Sbjct: 632 DAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPG 691

Query: 741 EWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQVDAT 800
           +WE   F K +     RR   + DN      D+     DDRP LK++CLDFSQV+Q+DAT
Sbjct: 692 KWEPRVFIKKY----LRRENYDEDNV-----DIEDRVIDDRPFLKIICLDFSQVSQIDAT 742

Query: 801 ALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSY 860
           A+Q L DLRK++NKYADRQVEFHF GI+SPWIKK L N GFGTIN EYSDESII GH+SY
Sbjct: 743 AIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSY 802

Query: 861 HLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905
           HL +    D++          +  ATGTNLPFFHIDIP+F +WD+
Sbjct: 803 HLTK----DVD---------GIKAATGTNLPFFHIDIPNFNKWDI 834

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 1013 bits (2620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/899 (57%), Positives = 643/899 (71%), Gaps = 47/899 (5%)

Query: 10  NENNTNDIENQYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQ 69
           N  ++ D+E+        +SD +  NL DLE EYD YK +E N +       E +++   
Sbjct: 8   NRGSSKDLEHN-------SSDFAEPNLDDLEAEYDNYKNAEQNPR-------EKSDVVET 53

Query: 70  FSNTYNTGDKKNSIKNHQIQINTFNADSV--IIPSFEEHAISFKDYYRHSLKENFSLKSV 127
              T +  D K    + Q  +  +   S   +IP + E  ++FKDYY  SL  N S  S 
Sbjct: 54  LPPTTHQNDAKGLKNDGQTTVELYGTTSSGGVIPGYHEDTVNFKDYYDQSLSSNISFSSF 113

Query: 128 KEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFI 187
           +EY +S+FP+IRW+PHYN AW   D++AG+TVGCVLVPQSMSYAQIA+LP QYGLYSSFI
Sbjct: 114 REYLISLFPVIRWIPHYNFAWMYGDVVAGVTVGCVLVPQSMSYAQIASLPAQYGLYSSFI 173

Query: 188 GAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVI 247
           GAF YS FATSKDVCIGPVAVMSLET KVI +V    P+ D  IT P+IAT L+ LCG I
Sbjct: 174 GAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTEHLPD-DTEITGPIIATALSLLCGAI 232

Query: 248 TAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIES 307
           T GIG LRLGFLVELISLNAV GFMTGSA +I+ GQ+PALMGY  KVNTR +TYKV+I +
Sbjct: 233 TLGIGVLRLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINT 292

Query: 308 LKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAA 367
           LKHLPDTKLDAVFGLIPL ILYLWK+ C  +GP   D+    +     + K F+FYAQA 
Sbjct: 293 LKHLPDTKLDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQAL 352

Query: 368 KNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPAS 427
           +NA +I++FT IAW IT+ K K   PIS+L +VP GLK VGVMK PD LA+ +APELPA+
Sbjct: 353 RNAFVIVLFTLIAWGITRHKKK--HPISLLNTVPSGLKNVGVMKFPDHLATNLAPELPAA 410

Query: 428 VIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKC 487
            I+LLLEHIAIAK+FGRINDYKVVPDQELIAIGVTNL+GTFFNAYPATGSFSRSALKAKC
Sbjct: 411 AIILLLEHIAIAKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKC 470

Query: 488 EVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNP 547
            VRTPLSG+FTG+CVLLALYCLT  F YIPKATLSAVIIHAVSDLIASY TTWNFWKMNP
Sbjct: 471 NVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNP 530

Query: 548 LDCXXXXXXXXXXXXXXXENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDD 607
           LDC               ENGIYFA+CWSCAIL+ K+AFP+GKFLGRVE++EV+N  V +
Sbjct: 531 LDCLCFLVTVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVRE 590

Query: 608 SFEVTDYSSNSNLSLSADTINHNXXXXXXXXXXXXXXXDQLFSDISSIQ-GKSKIRYYTK 666
              V +   + N+++++ T                     L +D SSI  G S++R++TK
Sbjct: 591 DLGVVEDFDSENINVASST----------------KPKLGLSADNSSISTGPSRVRFHTK 634

Query: 667 WLPFDHAYTKEXXXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLI 726
           W+P ++ Y +E                YR ++S+TY+NCS+ YD+IF+E+K+ T+RG ++
Sbjct: 635 WIPLENNYGREYNSGIVVQPPPPGVIVYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVL 694

Query: 727 RHRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKV 786
            H KKSDRPWNDPG+WE P F    KKL F+R K     E+   P++    RD+RP+LK+
Sbjct: 695 AHTKKSDRPWNDPGQWEPPLF---LKKL-FKRGKR---LEQELSPEL---GRDERPVLKI 744

Query: 787 LCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINE 846
           L +D+SQV Q+DAT +Q+LVDLRKAINKYADRQVEFHF+GI+SPWIK+ L+ +GFGT+N+
Sbjct: 745 LAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVND 804

Query: 847 EYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905
           E++DES+I GH+SYH+ +    D E   +  G Y +  A+GTN+PFFH+++PDF +W +
Sbjct: 805 EFADESLILGHSSYHIVKTRPQD-EENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score =  992 bits (2564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/890 (55%), Positives = 626/890 (70%), Gaps = 37/890 (4%)

Query: 35  NLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDKKNSIKNHQIQINTFN 94
           NL DLE EYDQYKA+E   +     D E           Y+   +K  +   + ++  +N
Sbjct: 35  NLDDLEQEYDQYKAAEDRERVVGRGDDE-----------YDDDLRKGKVDYKETELEYWN 83

Query: 95  ---------ADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYN 145
                    A    +PS+EE  +   D + H LK+  +L +VK Y  S FPII+WLP YN
Sbjct: 84  STNGTTNLLAPKATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAFPIIKWLPFYN 143

Query: 146 LAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGP 205
             W  +DL+AGITVGCVLVPQSMSYAQIATLPPQYGLYSSF+GAF YS FATSKDVCIGP
Sbjct: 144 WKWGYADLVAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFFATSKDVCIGP 203

Query: 206 VAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISL 265
           VAVMSLET KVI + L K+P+ D  +T P+IAT LA LCG++  G G LRLGFLVELISL
Sbjct: 204 VAVMSLETAKVIQETLEKFPKEDHEVTGPLIATALALLCGIVAMGAGVLRLGFLVELISL 263

Query: 266 NAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPL 325
           NAV GFMTGS+LNI+ GQ+PALMG+   V+TR STYK+II SLK+L  T+LDAVFGLIPL
Sbjct: 264 NAVAGFMTGSSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHTQLDAVFGLIPL 323

Query: 326 FILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITK 385
            +LY WKWWC + GP++AD+ F NN K    LK FYFYAQA ++AVIIIVFTAI++ ITK
Sbjct: 324 VLLYTWKWWCSSYGPKLADRHFKNNPKKRDILKTFYFYAQAMRSAVIIIVFTAISYGITK 383

Query: 386 GKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRI 445
           G+ K  R IS+LG VPKGLK+V VM++P+GL SK+   +P+++I+LLLEHI+IAKSFGR+
Sbjct: 384 GR-KTPR-ISVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILLLEHISIAKSFGRV 441

Query: 446 NDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLA 505
           N+YKVVPDQELIAIG TNLIGTFFNAYPATGSFSRSALKAKC VRTPLSG+F+G+CVLLA
Sbjct: 442 NNYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFSGACVLLA 501

Query: 506 LYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXXXXXXXXXXXXX 565
           LYCLT  F YIP ATLSAVIIHAVSDL ASY T+WNF+KMNP D                
Sbjct: 502 LYCLTQTFYYIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFIVTVFITVFSSI 561

Query: 566 ENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDYSSNSNL----- 620
           + GIYFAMCWS A+ +LK  F  G+FLGRVE+AEVVN  VD + E    S+ S+L     
Sbjct: 562 DYGIYFAMCWSAAMFLLKNMFAPGRFLGRVEVAEVVNAQVDPNVESVSESAGSHLDGFQA 621

Query: 621 --SLSADTINHNXXXXXXXXXXXXXXXDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKEX 678
             S+ + +   +               D    +  + Q   K+ Y+TKW+ +D +Y++E 
Sbjct: 622 QSSIESSSKKLDPLDKSAVHSNYLNGGDDGSDNNINNQIGQKLVYHTKWISYDRSYSREF 681

Query: 679 XXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWND 738
                          YR  DS+TY+NCS+HYD+I++E+++ T+RGQ+I   KK DRPWND
Sbjct: 682 NPEVPIQPPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRGQMISAVKKVDRPWND 741

Query: 739 PGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSK---RDDRPLLKVLCLDFSQVA 795
           PGEWEAP   + +KKL+ ++ K   +  ET   +   ++   +D+RPLLK++CLDFSQ +
Sbjct: 742 PGEWEAP---RWFKKLTSKK-KTAEEWAETEAQESKAAEQKLQDNRPLLKIICLDFSQCS 797

Query: 796 QVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIA 855
           Q DATA+Q+L DLRK +N+YADRQVEFH  G+ +PW+K+ L+N GFGT+NEEYSDES++A
Sbjct: 798 QTDATAIQNLTDLRKQVNRYADRQVEFHICGLYAPWVKRALVNFGFGTVNEEYSDESLLA 857

Query: 856 GHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905
           GH SYH+AR P   LE        Y VY A+GTNLPFFH++IPDF +WD+
Sbjct: 858 GHRSYHVARAP-TSLEDGLGSPAQYSVYPASGTNLPFFHVEIPDFSKWDL 906

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/892 (54%), Positives = 616/892 (69%), Gaps = 41/892 (4%)

Query: 28  NSDTSSQNLADLELEYDQYKASE------TNNKS-----NHGPDLETNNLDVQFSNTYNT 76
           N  +   +   LE EYD  K SE      +N  S      H    E  +LD    +T   
Sbjct: 23  NQYSVGPDFDQLEQEYDDLKTSEIIAPHISNGHSISSSPRHHHLYEDRHLD-SIIDTNTH 81

Query: 77  GDKKNSIKNHQI-QINT---FNADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYAL 132
           G KK+   N +   +N    +N DS+ +P++EE  +  K  Y   L+   +  ++ EY  
Sbjct: 82  GFKKHDNGNGKFADVNIEQIYNYDSLRVPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLT 141

Query: 133 SIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTY 192
           S+FP+++W+ HYN  W  +DL+AGITVGCVLVPQSMSYAQIATLP QYGLYSSF+GAF Y
Sbjct: 142 SLFPLLKWVHHYNFNWLYNDLVAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIY 201

Query: 193 SLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIG 252
           S FATSKDVCIGPVAVMSLET KVI +VL K  E +P ITAP+IAT L+ +CG +  G+G
Sbjct: 202 SFFATSKDVCIGPVAVMSLETAKVIARVLEKVGEDNPEITAPIIATTLSLICGGVALGVG 261

Query: 253 FLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLP 312
            LRLGFLVE ISLNAV GFMTGSA+NIM GQ+P LMGY   VNTR STYKVII +LKHLP
Sbjct: 262 LLRLGFLVEFISLNAVAGFMTGSAINIMSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLP 321

Query: 313 DTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNE-KGNFYLKKFYFYAQAAKNAV 371
           DTKLDAVFGLIPLFILY WK++CG +GP++ D++ A ++ K     K   FY QA +NA 
Sbjct: 322 DTKLDAVFGLIPLFILYSWKYFCGTLGPKLVDRYVARSDVKRAAAYKYILFYLQALRNAF 381

Query: 372 IIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVL 431
           +II+FT I+W IT+ K K++ PIS+LG+VP GLK VGVMKLPDGL S +A ELP+++I+L
Sbjct: 382 VIIIFTLISWGITRHKAKEDLPISLLGTVPSGLKNVGVMKLPDGLVSNLASELPSAIIIL 441

Query: 432 LLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRT 491
           +LEHIAI+K+FGR+N YKVVPDQELIAIGVTNLI TFFNAYPATGSFSRSALKAKC V+T
Sbjct: 442 VLEHIAISKAFGRVNGYKVVPDQELIAIGVTNLISTFFNAYPATGSFSRSALKAKCNVKT 501

Query: 492 PLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCX 551
           PLSG+FTG+CVLL+LYCLT  F +IPKA LSA+IIHAVSDL+ASY TTWNFW MNPLD  
Sbjct: 502 PLSGIFTGACVLLSLYCLTDAFYFIPKAALSAIIIHAVSDLVASYKTTWNFWLMNPLDFV 561

Query: 552 XXXXXXXXXXXXXXENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEV 611
                         ENGIYFA+CWSCA+L+LKV FP G+FLG VEI +V N  VD++ + 
Sbjct: 562 CFIVTVIITIFSSIENGIYFAVCWSCALLLLKVVFPTGQFLGYVEICQVSNAEVDENIDR 621

Query: 612 TDYSSNSNLSLSADTINHNXXXXXXXXXXXXXXXDQLFSDISSIQGKSKIRYYTKWLPFD 671
              S +S      D +  N               ++ F       G S+++Y+TKWLP +
Sbjct: 622 IVLSEDSQPKTIEDNVTKN-----NTAVKVGVVANESF-------GHSQLQYHTKWLPLN 669

Query: 672 HAYTKEXXXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKK 731
           + Y +E                YR ++S+TY+NCS+ YD IF+ +K+ T+ G+L++H  K
Sbjct: 670 NHYQRELNPDVVVQAPPPGVIVYRPSESWTYVNCSRQYDTIFDRVKELTRPGKLLKHVSK 729

Query: 732 SDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDF 791
            D+ WNDPGEWE P    L KKL    NK++ +  E           D+RP+LK+L +D+
Sbjct: 730 HDKMWNDPGEWEPP---FLVKKLFKLGNKHDLEGGEV---------IDERPVLKILAMDW 777

Query: 792 SQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDE 851
           SQV Q+D+T +Q+LVDLRKAINKYA+RQVEFHF+GI+SPWIK+ LIN GFGT+NEE+SDE
Sbjct: 778 SQVTQIDSTGVQNLVDLRKAINKYANRQVEFHFSGIISPWIKRSLINAGFGTVNEEFSDE 837

Query: 852 SIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQW 903
           SII GHTSY L +   D  +          ++TA G NLPFFH+++P+F++W
Sbjct: 838 SIIVGHTSYSLVKNRPDLQDPEAALPEPIALHTALGVNLPFFHLEMPEFHKW 889

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  934 bits (2415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/894 (53%), Positives = 613/894 (68%), Gaps = 64/894 (7%)

Query: 32  SSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDKKNSIKNHQIQIN 91
           +S +L DL+ EY  +K +E +++   GP        V    +   G  +N  K+      
Sbjct: 8   TSLDLDDLDAEYGHFKNTE-HSEIGGGPS-SNPGAAVGVGASTKLGQDQNGDKSGATGGG 65

Query: 92  TFNADSVII----PSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLA 147
               + + +     ++ E  ++F++YY  +++ + +  +V++Y   + P+I WLPHYN  
Sbjct: 66  NGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGR 125

Query: 148 WFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVA 207
           WF  D++AGITVGCVLVPQSMSYA IATLPPQ+GLYSSF+GA  YS FATSKDVCIGPVA
Sbjct: 126 WFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVA 185

Query: 208 VMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNA 267
           VMSL+T K ++KV+A+ P AD +ITAPV+AT LAFLCG+I+ G+G LRLGFLVELIS  A
Sbjct: 186 VMSLQTAKAVSKVMAELP-ADTDITAPVVATALAFLCGLISLGLGVLRLGFLVELISSTA 244

Query: 268 VTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFI 327
           V GFMTGSALNI+ GQ+PALMGY   VNTRTSTYKVIIE+LKHLPDTKLDAVFGLIPL +
Sbjct: 245 VAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVM 304

Query: 328 LYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGK 387
           LY WKW C + GPR+ +++     +         FY QA +NAVIIIVFTAIAWSI+  K
Sbjct: 305 LYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHK 364

Query: 388 TKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRIND 447
            K   PIS+LG VP GLK+VGVMKLPDGLA+KIAPELPASVIVLLLEHIAIAK+FGR+ND
Sbjct: 365 KK--APISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVND 422

Query: 448 YKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALY 507
           Y+VVPDQELIAIG TNL+GTFFNAYPATGSFSRSALKAKC V TPLSG+F+G+CVLLA+Y
Sbjct: 423 YRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIY 482

Query: 508 CLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXXXXXXXXXXXXXEN 567
           CLT  F YIPKATLSAVIIHAVSDLIASY TTW+ W++NPLD                EN
Sbjct: 483 CLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIEN 542

Query: 568 GIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVV-NGCVDDSFEVT----DYSSNSNLSL 622
           GIYFAMCWS A+L+ KVAFP  +FLGRVEIAE+  N  V    E      D+     +S 
Sbjct: 543 GIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFEKGKGVSY 602

Query: 623 SADTINHNXXXXXXXXXXXXXXXDQLFSDISSIQGKSKI----------RYYTKWLPFDH 672
           ++ +++                 +   +    I+G S+            ++TKW+PF+ 
Sbjct: 603 ASGSVS----------------SESFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE- 645

Query: 673 AYTKEXXXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKS 732
            YT+E                +R ++S+TY+NC++ Y+ IF+E+ + T+RG+ ++   KS
Sbjct: 646 PYTRELNPQVPVAQPPPGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKS 704

Query: 733 DRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFS 792
            RPWNDPGEW  P F + W        K  +++ E  +        DDRP+L+V+ +D+S
Sbjct: 705 GRPWNDPGEWHPPKFLRKW------FGKKYSESLEQGVVS------DDRPVLRVIAMDWS 752

Query: 793 QVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDES 852
           QVAQVD+T LQ+L DLRKA++KYADRQVEFHF+GI+SPWIK+GL+N GFGT+NEE++DES
Sbjct: 753 QVAQVDSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADES 812

Query: 853 IIAGHTSYHLAR--IPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWD 904
           ++ GH +Y +AR    GD+  L            ATG N+PFFH ++PDF +WD
Sbjct: 813 LLVGHKTYQVARGGATGDEEALLPQ--------PATGVNMPFFHAEMPDFSKWD 858

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score =  931 bits (2406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/929 (52%), Positives = 622/929 (66%), Gaps = 61/929 (6%)

Query: 3   QTIPFQKNENNTNDIENQYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPDLE 62
           Q+ P  K E++    E   EL     S+ +  +L DL+ EY Q+K +E ++ +  G DL 
Sbjct: 5   QSSPGSKRESS---FEVSREL-----SNDAPIDLDDLDAEYGQFKNAE-HSDATAGRDL- 54

Query: 63  TNNLDVQFSNTYNTGDKKNSIKNHQIQINTFNADSVI--IPS----FEEHAISFKDYYRH 116
           T+    QF+  +       S            A +    +PS    F E  ++  ++Y  
Sbjct: 55  TSEYGAQFAAEFGGEPGSGSGSGSGFPEAKPVAPAAPGNVPSALYEFHERPVTVGEFYSQ 114

Query: 117 SLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATL 176
           +L+  F+L +   Y  S+ PI+RWLPHYN  W   DL+AGITVGCVLVPQSMSYAQIATL
Sbjct: 115 NLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATL 174

Query: 177 PPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVI 236
            PQYGLYSSF+GAF YS FATSKDVCIGPVAVMSL+T K I+ V++  PE D  IT+P+I
Sbjct: 175 SPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPE-DTEITSPMI 233

Query: 237 ATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNT 296
           AT LA LCG+I+ G+G LRLGFLVELIS  AV GFMTGSALNI+ GQ+PALMGY   VNT
Sbjct: 234 ATALALLCGIISLGLGVLRLGFLVELISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNT 293

Query: 297 RTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFY 356
           RTSTYKVII SL+HLPDTKLDAVFGL+PL ILY+WKW C   GPR+  ++ +   +    
Sbjct: 294 RTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSR---M 350

Query: 357 LKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKD--ERPISILGSVPKGLKEVGVMKLPD 414
               + Y QA +NAV+I+VFTAIAW ++    K+     IS+LG+VP GLK+VGVMK+P 
Sbjct: 351 WDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPS 410

Query: 415 GLASKIAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPA 474
           GL SKIAPELPASVIVL+LEHIAI+K+FGR+NDY+VVPDQELIAIG TNLIGTFFNAYPA
Sbjct: 411 GLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPA 470

Query: 475 TGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIA 534
           TGSFSRSALKAKC V TPLSGLF+G+CVLLA+YCLT  F +IPKATLSAVIIHAVSDLIA
Sbjct: 471 TGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIA 530

Query: 535 SYHTTWNFWKMNPLDCXXXXXXXXXXXXXXXENGIYFAMCWSCAILVLKVAFPAGKFLGR 594
           SY TTW+FW+++P D                ENGIYFAMCWS A+L+ + AFPAGKFLGR
Sbjct: 531 SYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGR 590

Query: 595 VEIAE--VVNGCVDDSFEVTDYSSNSN--------------LSLSADTINHNX-XXXXXX 637
           V+IAE  V N        ++  +S                 +S+S+++++H         
Sbjct: 591 VQIAEARVTNSGAGAGVGMSSGNSAGTAVNREKERETTFTAVSVSSESLSHTAPGKAKAA 650

Query: 638 XXXXXXXXDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKEXXXXXXXXXXXXXXXXYRLT 697
                    ++   ++        R++TKW+PFD  YT+E                +R +
Sbjct: 651 NSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPFDR-YTRELNPEVFVAPPPPGVIVFRPS 709

Query: 698 DSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPGEWEAPNFSKLWKKLSFR 757
           +S+TY+NCS+ YD IF+E+ + T+RG+     K S RPWNDPGEW  P F    +KL F+
Sbjct: 710 ESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGEWHPPKF---LRKL-FK 765

Query: 758 RNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYAD 817
            +  + +N            RD+RP+L+V+ +D+SQVAQVD+T LQ+L DLRKA+NKYAD
Sbjct: 766 SSSEDLENRAV--------ARDERPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYAD 817

Query: 818 RQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYHLARI--PGDDLELPTM 875
           RQVEFHFAGI+ PW+K+GLIN GFGT+N+E++DES++ GH S H+AR   P +D E    
Sbjct: 818 RQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIARSAEPTEDEE---- 873

Query: 876 RGGNYKVYTATGTNLPFFHIDIPDFYQWD 904
              +   + ATGTNLPFFH+++PDF +WD
Sbjct: 874 ---SRLAHPATGTNLPFFHLELPDFSEWD 899

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/903 (52%), Positives = 608/903 (67%), Gaps = 47/903 (5%)

Query: 33  SQNLADLELEYDQYKASETNNKSNHGPDL--ETNNLDVQFSNTYNTGDKKNSIKNHQIQI 90
           S +L   ELEYD  K  +  +      DL  + +  +V F     +G         ++ +
Sbjct: 8   SIDLERFELEYDHGKRGDDTHDRVEARDLYSKVDIEEVTFQCDNYSG---------RLDV 58

Query: 91  NTFNADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFS 150
           N+    S+ IP + E  ++ KD+Y   + + FS+  + +Y  S+FP+++WLPHYNL W  
Sbjct: 59  NS----SLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLI 114

Query: 151 SDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMS 210
            DLIAGITVGCVLVPQSMSYAQIATL PQYGLYSSFIGAF YS FATSKDVCIGPVAVMS
Sbjct: 115 QDLIAGITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMS 174

Query: 211 LETGKVITKVLAKYPEADPNI-TAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVT 269
           L+T KVI +V +     +  I TAP+IAT LA LCG+I+ GIGFLRLGFL+E ISLNAV 
Sbjct: 175 LQTAKVIERVTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVA 234

Query: 270 GFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILY 329
           GFMTGSA NI+ GQ+PALMGY  KVNTR STY+V+I +LKHLPDTKLDAVFGLIPL ILY
Sbjct: 235 GFMTGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILY 294

Query: 330 LWKWWCGNMGPRMADKW------FANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSI 383
           L KW+  ++GP+  +K            K   YL  ++FY+ A +N V+IIVFTAI+W+I
Sbjct: 295 LCKWFFSSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAI 354

Query: 384 TKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFG 443
           T+GK+    PISILG+VPKGLKEV V K+P GL  K+AP+LP+S+I+LLLEHIAI+KSFG
Sbjct: 355 TRGKSSTSVPISILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFG 414

Query: 444 RINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVL 503
           R+NDYK+VPDQELIAIGVTNLIGTFF AYPATGSFSRSALKAKC+V+TPLSGLF+G+CVL
Sbjct: 415 RVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVL 474

Query: 504 LALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXXXXXXXXXXX 563
           LALYCLTG F YIPKATLSAVIIHAVSDL+ASY TT NF+KMNPLD              
Sbjct: 475 LALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFS 534

Query: 564 XXENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDYS---SNSNL 620
             E GIYFA+C+SCA L+ K  FP G FLG ++IAEV+N     +    DY+    +S+ 
Sbjct: 535 SIEYGIYFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLN----PTLSTNDYTILLDDSSS 590

Query: 621 SLSADTINHNXXXXXXXXXXXXXXXDQLFSDISSIQGKS-----KIRYYTKWLPFDHAYT 675
            L  +    +               ++ +S+  S +  S      + YY +W+P  + Y 
Sbjct: 591 VLGEENTKDDSVKNRLDQNENPKSSEKEYSEFKSYEMSSNSKTTNLSYYVRWVPMKNDYH 650

Query: 676 KEXXXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRP 735
           +E                YR  DSFTY+NCS+HYD+I++E+KK T++G    +++K DRP
Sbjct: 651 REVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRP 710

Query: 736 WNDPGEWEAPNFSKLWKKLSFRRN----KNNNDNEETHIPDVPVSKRDDRPLLKVLCLDF 791
           WND GEWE P   K       ++       + D  E    +   +  D++P LK++C DF
Sbjct: 711 WNDVGEWECPKSLKNLFNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDF 770

Query: 792 SQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDE 851
           SQV Q DATA+QSL DLRKA+N+Y+++Q+E+HF+GI+S W+KK LI +GFGT+N+ YSD+
Sbjct: 771 SQVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDK 830

Query: 852 SIIAGHTSYHLARIPG--DDLE-------LPTMRGGNYKVYTATGTNLPFFHIDIPDFYQ 902
           SII GH SYH+++I    D LE       L       Y + T TGTN PFFHIDIPDF  
Sbjct: 831 SIIIGHQSYHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSN 890

Query: 903 WDV 905
           W++
Sbjct: 891 WEL 893

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/883 (52%), Positives = 594/883 (67%), Gaps = 59/883 (6%)

Query: 24  PSFPNSDTS-SQNLADLELEYDQYKASETNNK--SNHGPDLETNNLDVQFSNTYNTGDKK 80
           P +P+ ++  + ++  L+ EYDQ KA E ++   + HG D+ +     Q+S     G  K
Sbjct: 18  PQWPSRNSVLNDDIEALQAEYDQLKAGEVHSAQGATHG-DIGSR----QYS-----GSGK 67

Query: 81  NSIKNHQIQINTFNADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRW 140
            + +   + +N+  A    +P +EE  +S KDYY + L+   SL + ++YALS+FP+ RW
Sbjct: 68  PAAQYLGLNVNSREA----VPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRW 123

Query: 141 LPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKD 200
           + HYN+AW  +D++AGITVGCVLVPQSMSYAQ+A+L PQYGLYSSF+GAF YS FATSKD
Sbjct: 124 IHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKD 183

Query: 201 VCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLV 260
           VCIGPVAVMSLET KVI +V    PE D NIT P+IAT L  LCG I   IG LRLGFLV
Sbjct: 184 VCIGPVAVMSLETAKVIARVTENLPE-DTNITGPIIATALTLLCGAIAMVIGILRLGFLV 242

Query: 261 ELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVF 320
           E IS+ AVTGFMTGSAL+I+ GQ+P+LMGY  KVNTR +TYKVIIESLKHL DT ++A F
Sbjct: 243 EFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAF 302

Query: 321 GLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIA 380
           GL+PL +L+LWKW CG++GPR+ D++              +FY QA +NAVII+VFTAI+
Sbjct: 303 GLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAIS 362

Query: 381 WSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAK 440
           W I++ K  ++ PIS+LG VP GLK VG ++LP+GL  K+ PELPA+ I+LLLEHIAIAK
Sbjct: 363 WGISRHKL-EKPPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAK 421

Query: 441 SFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGS 500
           SFGRIN+YKVVPDQELIAIGVTNL  TFFNAYPATGSFSRSALKAKC V+TPLSGLFTG+
Sbjct: 422 SFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGA 481

Query: 501 CVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXXXXXXXX 560
           CVLLALYCLT  F +IPKATLSAVIIHAV+DLIASY  TW FW+ NPLD           
Sbjct: 482 CVLLALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIIT 541

Query: 561 XXXXXENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDYSSNSNL 620
                E+GIYF++ WSCA+L+ KVAFP GKFLG +++AEV+      S       ++ + 
Sbjct: 542 VFSSIEHGIYFSISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDN 601

Query: 621 SLSADTINHNXXXXXXXXXXXXXXXDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKEXXX 680
           S +   I+ +                   + + S+      R++ +W+P DHAY++E   
Sbjct: 602 SATFQQIDKDGGK---------------LNTVESVLPDPHTRFHRRWIPLDHAYSRELNP 646

Query: 681 XXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPG 740
                        YR TDS+TY+NCS+H+D+I + +K+ T+ GQL+ H    +R W DPG
Sbjct: 647 EAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPG 706

Query: 741 EWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQVDAT 800
            W  P          FRR   +             +  D RP+L+VL +D+SQV+QVD+T
Sbjct: 707 PWRPPRI--------FRRFIADKRTGS--------AVADARPVLRVLAMDWSQVSQVDST 750

Query: 801 ALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSY 860
            +Q+LVDLR A+NKYADR VEFHFAGIVSPWIK+ L+N GFG      +D  +I+   SY
Sbjct: 751 GIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSY 805

Query: 861 HLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQW 903
           HL R+P D    P +  G+  V+ A GTN PFFH+D+PDF  W
Sbjct: 806 HLVRLPADP---PHIVHGHSVVF-ALGTNTPFFHLDMPDFETW 844

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/900 (47%), Positives = 586/900 (65%), Gaps = 42/900 (4%)

Query: 11  ENNTNDIENQYELPSFPNSDTSSQN---LADLELEYDQYKASETNNKSNHGPDLETNNLD 67
           E+  + I +   L +  N++   Q+   L +LE +Y ++K +E ++    G + E + +D
Sbjct: 12  ESQASTISDTQNLRTVDNNNRGLQDTSGLDELETDYTRFKTNE-DSAGYSGAENERSRID 70

Query: 68  VQFSNTYNTGDKKNSIKNHQIQINTFNADSVIIPSFEEHAISFKDYYRHSLKENFSLKSV 127
            +F +    G      K     +  F A     P + E  ++F +YY  +++        
Sbjct: 71  -KFDSV---GSSLQFAKYDGNALPDFKA-----PPYYETTVTFMEYYDRTIRSRVGRSFF 121

Query: 128 KEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFI 187
           + Y LS+FPII+W+ HYN AW  SD IAGITVGCVLVPQSMSYAQ+A L P+YGLYSSFI
Sbjct: 122 RSYFLSLFPIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFI 181

Query: 188 GAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVI 247
           GAF YS FATSKDVCIGPVAVMS++  KVI+ V+ + PE  P ITAP++A+ LA    ++
Sbjct: 182 GAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTP-ITAPMVASALALFSSIL 240

Query: 248 TAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIES 307
              IG LRLGF++ELIS+ AV GFMTGSAL+I+  Q+P+L+G   K+NTR  TY+V+I +
Sbjct: 241 VIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLPSLLGI-QKINTRVETYRVLIST 299

Query: 308 LKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAA 367
           LKHL  + ++A FGLI L +L+ WKW CG +GP++  K+   N K     + F+FYAQA 
Sbjct: 300 LKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQAL 359

Query: 368 KNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPAS 427
           +NA ++ + T ++W +  G+ K +  IS+LG+VP GLK VGV  +P GL  K+ P+LP +
Sbjct: 360 RNAFVLFLATFVSWLVI-GRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPA 418

Query: 428 VIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKC 487
           VI+LLLEHI IAKSFGRIN+YK+VPDQELIAIGVTNLIG+FFNAYPATGSFSRSALKAKC
Sbjct: 419 VIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKC 478

Query: 488 EVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNP 547
            V+TPLSGLF+G+CVLLALY LT  F YIPKA LSAVIIHAV DLIASY  ++  W  NP
Sbjct: 479 NVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNP 538

Query: 548 LDCXXXXXXXXXXXXXXXENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDD 607
            D                ENGIYFA+ +S A L++K AFP+GKFLG V+I EV N  V  
Sbjct: 539 FDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNV-- 596

Query: 608 SFEVTDYSSNSNLSLSADTINHNXXXXXXXXXXXXXXXDQLFSDISSIQGKSKIRYYTKW 667
            FE  D   N++  L  +    +                 + +  + +  K  +R++TKW
Sbjct: 597 -FEDLDSIGNNDPELPQEISKDS----------KLAKDPDVHASANLMASKLDVRFHTKW 645

Query: 668 LPFDHAYTKEXXXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIR 727
           +P D+ Y++E                YR T+S+ Y+NCS+ +D+I + +K  T+ G+L+ 
Sbjct: 646 VPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVN 705

Query: 728 HRKKSDRPWNDPGEWEAPNF-SKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKV 786
           H +KS++ W +PG+W  P F  K +KK   +  K          P+V V + D+RP+LK+
Sbjct: 706 HLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAAK----------PEV-VEQVDNRPVLKI 754

Query: 787 LCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINE 846
           L +D++QV  VD+T++QSL+DLRK IN+YADRQV FHF+GIVSPWIK+ L++ GFGTINE
Sbjct: 755 LAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINE 814

Query: 847 EYSDESIIAGHTSYHLAR-IPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905
            YS++ ++  +++YH+ + +   D E       +  +  A+GTN PFFHID+PDF +WD+
Sbjct: 815 NYSNDPLLLKYSTYHVVQNVLSADEENQQNSEISASLDVASGTNFPFFHIDMPDFTKWDI 874

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  519 bits (1336), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 262/527 (49%), Positives = 347/527 (65%), Gaps = 36/527 (6%)

Query: 103 FEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCV 162
           + E  ++  + + H +   F+ +S+K Y LS+ PI +W+ HYNL WF SD+IAGITVGCV
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 163 LVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLA 222
           LVPQSMSYAQIATL PQYGLYSS +G F Y++FATSKD+CIGPVA+MSL+T K I  V  
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVHQ 122

Query: 223 KYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWG 282
           K+P+    I A +IA+ +A +CG IT GIG LRLGF ++LI + AV GF +GSA NI+WG
Sbjct: 123 KHPD----IPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWG 178

Query: 283 QIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWC------G 336
           QIP LMGY   VNTR  TYKV++++LK LP T ++AV GLIPLF L++WK+ C      G
Sbjct: 179 QIPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCDYALRRG 238

Query: 337 NMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISI 396
           N+ P               + K+  FY  + +  ++II+ +A A+       K      +
Sbjct: 239 NLKP---------------WPKRIVFYLLSLRVTIVIIICSAAAYGAKNPSLK------V 277

Query: 397 LGSVPKGLKEVGVMKL---PDGLASKIAPELPASVIVLLLEHIAIAKSFGRINDYKVVPD 453
           LG +PKG       +L   P  L S I  E+PASVIVL+LEH++IAKSF R+N+Y+V  D
Sbjct: 278 LGKIPKGFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSAD 337

Query: 454 QELIAIGVTNLIGT-FFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGV 512
           QEL AIGV+N++G     AYP TGSFSR+ALKA+CEVRTPL  +F+G CV++A+  LT  
Sbjct: 338 QELTAIGVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSA 397

Query: 513 FLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCXXXXXXXXXXXXXXXENGIYFA 572
             +IPKATLSAVIIHAVS LI+SY  T   +KM PLDC               E G+YFA
Sbjct: 398 LAWIPKATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFA 457

Query: 573 MCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDYSSNSN 619
           +CW+C +L++++AFP G FLG V + E+    +    E  DY S ++
Sbjct: 458 VCWACFLLMIRIAFPYGAFLGYVRVREISRSSI-TMIEPMDYESGND 503

 Score =  161 bits (408), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 121/230 (52%), Gaps = 33/230 (14%)

Query: 667 WLPFDHAYTKEXXXXXXXXXXXXXXXXYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQL- 725
           W+P+ H +T+E                YR +DS TY+NCS++YD I + IK  TK G++ 
Sbjct: 688 WIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPGEID 747

Query: 726 IRHRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKR--DDRPL 783
           +       +PWN+PG WE P   K W+                  P++   KR  D RP 
Sbjct: 748 VLSDALYVKPWNNPGPWEKPKL-KFWEHAD---------------PEIARKKRMADKRPT 791

Query: 784 LKVLCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGT 843
           L++LCLDFSQVAQ+D+TALQ+L+DLR  +N Y    VE+HF GI+SPW+++ LI IGFG 
Sbjct: 792 LRILCLDFSQVAQIDSTALQALIDLRHEVNAYTCSLVEWHFCGIISPWVRRNLIEIGFGK 851

Query: 844 INEEYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFF 893
           IN+E+  +                D   +  +    Y    A G N+PFF
Sbjct: 852 INKEFFPKV--------------NDSSTVEVISDLEYNGELALGENVPFF 887

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  126 bits (316), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 126/479 (26%), Positives = 207/479 (43%), Gaps = 46/479 (9%)

Query: 62  ETNNLDVQFSNTYN--TGDKKNSIKNHQIQINTFNADSVIIPSFEEHAISFKDYYRHSLK 119
           E+  L   FSN Y+  T +  N+ ++H     + ++ S+  PS E   ++          
Sbjct: 7   ESRLLPGNFSNRYSATTPEMHNTTESHLFHRQSDSSKSLTSPS-ELQDVNSSPMRSFLTS 65

Query: 120 ENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPP 178
           E     S  +      P   WLP Y L  F  D+IAGIT+    +P ++SYA  +A + P
Sbjct: 66  EQLVKMSFYDRLKYYLPCFSWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEP 125

Query: 179 QYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIAT 238
             GLYS  I  F Y +F +   + +GP + +SL  G+ + K L  + E    I    I+ 
Sbjct: 126 LCGLYSLAITPFVYCVFGSVPQMIVGPESAISLVVGQAVEK-LVTHNEKVGTIN---ISV 181

Query: 239 VLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRT 298
           V+ FL G I    G  RLGFL  ++S   + GF++   L ++   +   +     + T  
Sbjct: 182 VVTFLSGAILLIFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVP 241

Query: 299 STYKVIIESLKHL----PDT--KLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEK 352
             Y    E ++ L    P+   K  A+  L    IL   ++    +  ++  ++      
Sbjct: 242 EHYHTPFEKVQFLFKYGPENLHKPTAILSLCSFIILMTLRF----LKKKLMKRY------ 291

Query: 353 GNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKL 412
                K   F+ +     +++IV +++  S+     KD   IS+LG         G  KL
Sbjct: 292 -----KSVIFFPE-----ILLIVISSLIISVNFNLKKD-FDISMLGDFSTS----GFDKL 336

Query: 413 PDGLAS---KIAPELPA----SVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLI 465
            + L      +  EL +      I+   E    +KS G I D  +  ++EL+A+G  NL+
Sbjct: 337 NNPLGKDNRSLCHELLSVGLMCAILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLV 396

Query: 466 GTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
           G+ F A P+ G + RS + A    +T +SG   G   L  +  L  V  Y P   LS +
Sbjct: 397 GSLFGALPSFGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVI 455

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  119 bits (297), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 111/420 (26%), Positives = 183/420 (43%), Gaps = 43/420 (10%)

Query: 117 SLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIAT 175
           S+ EN   +++  Y     P   WLP Y       D+IAGI+V    +P ++SY   IA 
Sbjct: 91  SVDENTVFETLPYY----LPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAH 146

Query: 176 LPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPV 235
           +PP  GLYS  I  F Y +  +   + +GP + +SL  G+ +  +         N++   
Sbjct: 147 VPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLH----KENVSLID 202

Query: 236 IATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVN 295
           I+TV+ F+ G I    G  R GFL  ++S   + GF++   L ++   + + +     + 
Sbjct: 203 ISTVITFVSGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLV 262

Query: 296 TRTSTYKVIIESLKHLPDTK------LDAVFGLIPLFILYLWKWWCGNMGPRMADKWFAN 349
           +    Y    E +  L D          A+F    L +L+L +                 
Sbjct: 263 SLPQHYHTPFEKILFLIDYAPAQYHIPTAIFSGCCLIVLFLTRLL--------------- 307

Query: 350 NEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGV 409
             K   Y K   F+       ++++V   I  S+ K   K    ISI+G     +     
Sbjct: 308 KRKLMKYHKSAIFFPD-----ILLVVIVTILISM-KFNLKHRYGISIIGDF--SMDNFDE 359

Query: 410 MKLP-DGLASKIAPEL-PASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNL 464
           +K P      K+ P+L  AS+IV +L   E    +KS G   +  V  ++EL+A+G  N+
Sbjct: 360 LKNPLTRPRRKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNI 419

Query: 465 IGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
           + + F A PA G + RS + A    ++ +SG+F G   L+ +  L     YIP   LS +
Sbjct: 420 VISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVI 479

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 116/474 (24%), Positives = 195/474 (41%), Gaps = 63/474 (13%)

Query: 69  QFSNTYNTGDKKNSIKNHQIQINTFNADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVK 128
           +F +T  + D   +I  H      +N + V            +D    + +   +  ++ 
Sbjct: 6   RFCDTNGSSDSAEAISQHNEDGLVYNQEDV------------QDRIAINNRSILTTSNIW 53

Query: 129 EYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFI 187
           +Y    FP   W+P+Y L  F  DL AG++V    +P ++SYA  +A + P  GLYS  I
Sbjct: 54  DYLAYYFPCFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVEPLSGLYSLAI 113

Query: 188 GAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVI 247
             F Y++F +   + +GP + +SL  G+ +  ++      D  I+   I+ V+ F+ G  
Sbjct: 114 TPFIYAIFGSVPQMIVGPESAISLVVGQAVEPMV----NHDERISTISISIVVTFISGSF 169

Query: 248 TAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIES 307
              +G  RLGFL  ++S   + GF+      ++   + + +     + T    Y    E 
Sbjct: 170 LLFLGIFRLGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATSPEHYHTPFEK 229

Query: 308 L----------KHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYL 357
           +           H P     A+  L    IL L K     +  R   KW           
Sbjct: 230 ILFLIKYGQHNYHAP----TAILSLYSFIILMLMKVMKKRLMKRF--KWVI--------- 274

Query: 358 KKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLA 417
               F  +     ++I++   I +S      K +  ISI+G      K  G   L + L 
Sbjct: 275 ----FVPE-----ILIVIVGTIMFSF-HFDIKHKFDISIIGD----FKVNGFDSLHNPLD 320

Query: 418 SK----IAPELPASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFN 470
                 + P L A ++  +L   E    +K+ G   D  V  ++EL+A+G  N++G+ F 
Sbjct: 321 KTNRLLLKPLLDAGIVCAVLGFFESTTASKALGTTYDLTVSSNRELVALGSMNIVGSLFG 380

Query: 471 AYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
           A PA G + RS + A    +T +SG+  GS  L  +     V    P   LS V
Sbjct: 381 ALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLSVV 434

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 144/583 (24%), Positives = 243/583 (41%), Gaps = 69/583 (11%)

Query: 80  KNSIKNHQIQINTFNADSVIIP-SFEEHAISFKDYYRHSLKENF-------SLKSVKEYA 131
           KN I N  I       DSV  P + ++H ++      H +++ +       +   + +Y 
Sbjct: 61  KNKISNKYI-------DSVFDPNTMDDHDMNQNITITHRIRKTYDDGENELTFYQLIQYY 113

Query: 132 LSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAF 190
           L   P +RWLP YN + F SD I+GI++    +P ++SYA  IA + P  GLYS  I   
Sbjct: 114 L---PCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYSLAITPV 170

Query: 191 TYSLFATSKDVCIGPVAVMSLETGKVITKVLAKY---PEADPNITAPVIATVLAFLCGVI 247
            Y +  +   + +GP   +SL  G+ + K+   Y    + D +I+   I+  + FL G++
Sbjct: 171 IYGILGSVPPMIVGPEGAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTITFLSGLV 230

Query: 248 TAGIGFLRLGFLVELIS-------LNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTST 300
               G LRLGFL  ++S       +++V G M   AL         L+      +T    
Sbjct: 231 LFICGLLRLGFLGSVLSKPLLRSFISSVGGVMVIDALITEMKLNCILIDNDRHYHT---A 287

Query: 301 YKVIIESLKHLPDT--KLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLK 358
           ++ I+  +K+ P+   K   V  ++   ILY  ++           K +    K   +L 
Sbjct: 288 FEKIMFIIKYAPNNFHKPTTVLSVVCFSILYFVRY---------CKKKYIIKHKSLIFLP 338

Query: 359 KFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLAS 418
           +           +I+++ T I  +      KD   ISI+G V      +    L + L+S
Sbjct: 339 EI----------LIVVISTGILSA--SYNFKDNYGISIIGDVNSNNSNLIAGNLQNPLSS 386

Query: 419 KIAPELP-------ASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNA 471
                 P       A   +   E    +KS G   +  +  ++EL+A+GV NL  +    
Sbjct: 387 SNKELFPILMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLGG 446

Query: 472 YPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSD 531
            P+ G + RS + A    +T +SG+  G   +L +  L     +IP   LS +       
Sbjct: 447 LPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGLS 506

Query: 532 LIASYHTTWNF-WKMNPL-DCXXXXXXXXXXXXXXXENGIYFAMCWSCAILVLKVAFPAG 589
           LI        F W+     +                E GI     +S   ++   A    
Sbjct: 507 LIEEAPGEVKFHWRCKGYNELIIFFMTACGTIFFSVEVGIIIGCSYSIISIIKFSAKSRI 566

Query: 590 KFLGRVEIAE-VVNGCVDDSFEVTD-YSSNSNLS-LSADTINH 629
           + LGR+  +   VN  +DD FE TD Y S ++++  S+ T+ H
Sbjct: 567 QILGRIPGSRNFVN--IDDYFEDTDNYRSGTSITKCSSSTMLH 607

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score =  115 bits (289), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 101/400 (25%), Positives = 174/400 (43%), Gaps = 35/400 (8%)

Query: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFTYS 193
            P + W+PHY+   F  DL+AGI++    +P ++SYA  IA + P  GLYS  I    Y+
Sbjct: 74  LPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYA 133

Query: 194 LFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGF 253
           +F +   + +GP + +SL    V+ +   K+   D  I+   I  ++ F+ GV+   +G 
Sbjct: 134 IFGSVPQMIVGPESAISL----VVGQATEKFSAHDSEISTVTITMMITFISGVVLFFLGS 189

Query: 254 LRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPD 313
           +RLGFL  ++S   + GF++   L ++   +   +    K+      Y   +  +  L  
Sbjct: 190 VRLGFLGNILSKALLRGFISSVGLVMIINSLIIELKLNHKLADVAGHYHTPVGKIMFLFR 249

Query: 314 ------TKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAA 367
                  K  A+  LI   +L         +  R+A K   N  +   ++ +        
Sbjct: 250 YASEYYHKPTAILSLICFLVL---------ISTRIAKKKLMNRYRFLIFVPE-------- 292

Query: 368 KNAVIIIVFTAIAWSITKGKTKDERPISILGSV-PKGLKEVG--VMKLPDGLASKIAPEL 424
              ++++V   I  S+ K   K    IS +G     G   +G  +      L S +  E 
Sbjct: 293 ---ILLVVSVTILLSL-KYDFKHSYGISTIGEFNADGFGSIGNPLSNENRALYSSLWNEG 348

Query: 425 PASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALK 484
            A  ++   E    +KS G   +     ++ELIA+G  N++G+ F A P+ G + RS + 
Sbjct: 349 LAVAMLGFFESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVN 408

Query: 485 AKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
                +T +SG   G   LL    L  +  Y P   LS +
Sbjct: 409 VFSGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVI 448

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 119/470 (25%), Positives = 205/470 (43%), Gaps = 46/470 (9%)

Query: 69  QFSNTYNTGDKKNSIKNHQIQINTFNADSVIIPSFEE--HAISFKDYYRHSLKENFSLKS 126
            FS+ +N  DK +S    +I + T N+ S + P+      +I    +      +N   ++
Sbjct: 32  SFSDNFNY-DKDSSKNKGRIYVGTSNSTSEVCPAKNSIPESIDNAGFNDGIDDDNRIFET 90

Query: 127 VKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSS 185
           +  Y     P   WLP Y  +    D+IAGI++    +P ++SY   IA +PP  GLYS 
Sbjct: 91  IPYY----LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSL 146

Query: 186 FIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCG 245
            I  F Y +F +   + +GP + +SL  G+ +  +         N++   I+ V+ F+ G
Sbjct: 147 AISPFVYGVFGSVPQMIVGPESAISLVVGQAVESITLH----KDNVSLIDISIVITFVSG 202

Query: 246 VITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVII 305
            I    G  R GFL  ++S   + GF++   L ++   + + +     + +    Y    
Sbjct: 203 AILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPF 262

Query: 306 ESLKHLPDTKL------DAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKK 359
           E +  L D          A+F    L IL+L +                   K   Y K 
Sbjct: 263 EKILFLIDYAPAQYHMPTAIFSGCCLIILFLMRLL---------------KRKLLKYHKG 307

Query: 360 FYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLAS- 418
             F+       ++++V   I  S+ K   K    I+I+G     +     +K P   +  
Sbjct: 308 AIFFPD-----ILLVVIVTILISM-KFDLKHRYGITIVGDF--SMDNFDKLKNPLTRSRR 359

Query: 419 KIAPEL-PASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPA 474
           K+ P+L  AS+IV +L   E    +KS G   +  V  ++EL+A+G  N++ + F A P+
Sbjct: 360 KLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPS 419

Query: 475 TGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
            G + RS + A    ++ +SG+F G   L+ +  L     YIP   LS +
Sbjct: 420 FGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVI 469

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 114/460 (24%), Positives = 196/460 (42%), Gaps = 43/460 (9%)

Query: 78  DKKNSIKNHQIQINTFNADSVIIPSFEEHAISFKDYYRH-SLKENFSLKSVKEYALSIFP 136
           DK +S    +  + T N+ S + P       SF     + S+ +N ++     Y L   P
Sbjct: 40  DKDSSKYQSRTHVGTSNSASEVFPVNVSRFESFNSMSNNDSVYDNNTIFETVPYYL---P 96

Query: 137 IIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFTYSLF 195
              WLP Y       D+IAGI++    +P ++SY   IA +PP  GLYS  I  F Y + 
Sbjct: 97  CFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYGIL 156

Query: 196 ATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLR 255
            +   + +GP + +SL  G+ +  +         N++   I+ V+ F+ G I    G  R
Sbjct: 157 GSVPQMIVGPESAISLVVGQAVESITLH----KDNVSLIDISVVITFVSGAILLFSGISR 212

Query: 256 LGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPD-- 313
            GFL  ++S   + GF++   L ++   + + +     + +    Y    E +  L D  
Sbjct: 213 FGFLGNVLSKALLRGFISSVGLVMIINALISELKLDKFLLSLPQHYHTPFEKVLFLIDYA 272

Query: 314 ----TKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKN 369
                K  A+F    L +L+  +     +        F  +                   
Sbjct: 273 PAQYHKPTAIFSGCCLIVLFSMRLLKKKLVKHHKSAIFFPD------------------- 313

Query: 370 AVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLP-DGLASKIAPEL-PAS 427
            ++++V  AI  S+ K   K    I+I+G     +     +K P      K+ P+L  AS
Sbjct: 314 -ILLVVIVAIFISM-KFSLKHRYGITIIGDF--SMDNFDKLKNPFTHSRRKLIPDLFSAS 369

Query: 428 VIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALK 484
           +IV +L   E    +KS G   +  V  ++EL+A+G  N++ + F A P+ G + RS + 
Sbjct: 370 LIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSKIN 429

Query: 485 AKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
           A    ++ +SG+F G   L+ +  L     YIP   LS +
Sbjct: 430 ALSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVI 469

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 101/408 (24%), Positives = 175/408 (42%), Gaps = 51/408 (12%)

Query: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFTYS 193
            P   WLP Y+L  F  D IAG+++    +P +MSYA  IA + P  GLY+     F Y+
Sbjct: 97  LPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFTPFFYA 156

Query: 194 LFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGF 253
           +F +   + +GP + +SL  G+ I  ++      DP++++  +  ++ F+ GV+    G 
Sbjct: 157 IFGSVPQMIVGPESAISLVVGQAIEPMI----RHDPSLSSLDLCVIITFISGVVLFTFGV 212

Query: 254 LRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESL----- 308
            R GFL  ++S   + GF++   + ++   +   +      +   S Y    E +     
Sbjct: 213 FRFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHYHSPFEKVLFLIK 272

Query: 309 -----KHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFY 363
                 HLP + L     LI                  M+ +         F  +   F+
Sbjct: 273 YAPANYHLPTSLLSLCCFLI-----------------LMSLRLIKKKLLKRF--RSLVFF 313

Query: 364 AQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAP- 422
            +     ++++V T I +S      K    I ++G +   + +    KL + L+    P 
Sbjct: 314 PE-----ILLVVVTVIFFSY-NFDLKHRYNIEVVGDIEASVFD----KLRNPLSKNKRPF 363

Query: 423 ---ELPASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATG 476
                 A  +V +L   E    +KS G   D  V  ++EL+A+G  NLIG+ F A P+ G
Sbjct: 364 YGDLFSAGFMVAMLGFFESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFG 423

Query: 477 SFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
            + RS + A    +T +SG   G+  +  +  L     YIP   LS +
Sbjct: 424 GYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKFIRYIPVCVLSVI 471

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 103/405 (25%), Positives = 175/405 (43%), Gaps = 45/405 (11%)

Query: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFTYS 193
            P + W+P+YN   F  D IAG+++    +P  +S+A  +A + P  GLYS  +  F Y+
Sbjct: 72  LPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAVTPFIYA 131

Query: 194 LFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGF 253
           LF +   + +GP + +SL  G+ +  + +     D ++    IAT+++F+ G+     G 
Sbjct: 132 LFGSVPHMIVGPESAISLVVGQAVETLTSH----DLSLETVDIATMISFMSGLTLLFGGI 187

Query: 254 LRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESL----- 308
            RLGFL  ++S   + GF++     ++   +   +     + T    Y    E +     
Sbjct: 188 FRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKILFLVR 247

Query: 309 -----KHLPDTKLD-AVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYF 362
                 HLP + L  AVF       L   + +   M  R+  KW               F
Sbjct: 248 YGPSNYHLPTSFLSLAVFT-----TLMTIRIFKKKMMRRI--KWIV-------------F 287

Query: 363 YAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSV-PKGLKEVG--VMKLPDGLASK 419
             +     +  IV + +         K +  IS++G     G  +    + K   GL   
Sbjct: 288 IPEILSVVIFSIVLSYMC------DLKKKYDISVIGDFNTDGFDDFRNPLSKCNRGLIPA 341

Query: 420 IAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFS 479
           +      S ++  LE I  +KS G   +     ++EL+A+G+ N IG+ F   PA G + 
Sbjct: 342 LRDVSLVSALLGFLESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGGYG 401

Query: 480 RSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
           RS + A    +T ++G+F GS  L  +  L  V  YIP   LS +
Sbjct: 402 RSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVI 446

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 103/402 (25%), Positives = 172/402 (42%), Gaps = 39/402 (9%)

Query: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFTYS 193
            P   WLP Y       D+IAGI++    +P ++SY   IA +PP  GLYS  I  F Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 194 LFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGF 253
           +  +   + +GP + +SL  G+ +  +         N++   I+ V+ F+ G I    G 
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESITLH----KDNVSLIDISIVITFVSGAILLFSGI 210

Query: 254 LRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPD 313
            R GFL  ++S   + GF++   L ++   + + +     + +    Y    E +  L D
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHTPFEKVLFLID 270

Query: 314 ------TKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAA 367
                  K  A+F      IL +          R+  K      K   +           
Sbjct: 271 YAPAQYHKPTAIFSGCCFIILIVM---------RLLKKKLMKRHKSAVFFPD-------- 313

Query: 368 KNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLA-SKIAPEL-P 425
              ++++V   I  S+ K   K    ISI+G     +     +K P   +  K+ P+L  
Sbjct: 314 ---ILLVVIVTILISM-KLSLKQRYGISIVGDF--SMDNFDKLKNPLTHSRRKLMPDLFS 367

Query: 426 ASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSA 482
           AS+IV +L   E    +KS G   +  V  ++EL+A+G  N+  + F A P+ G + RS 
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSFGGYGRSK 427

Query: 483 LKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
           + A    ++ +SG+F G   L+ +  L     YIP   LS +
Sbjct: 428 INALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVI 469

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 115/410 (28%), Positives = 190/410 (46%), Gaps = 55/410 (13%)

Query: 135 FPIIRWLPHYNLAWFS--SDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFT 191
            P   W+P Y   WF   SD +AGI++    +P ++SYA  IA + P  GLYS  I  F 
Sbjct: 89  LPCFSWIPQYT--WFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFI 146

Query: 192 YSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGI 251
           Y++F +   + +GP + +SL  G+ + ++L  +  A   I    I+ VL F+ G     +
Sbjct: 147 YAVFGSVPQMIVGPESAISLVVGQSV-ELLKSHDSALEIIN---ISVVLTFISGAALLIL 202

Query: 252 GFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGY-----GSKVNTRTSTYKVIIE 306
           G LRLGFL  ++S + + GF++   L ++   +   +       G KV+  TS  KV   
Sbjct: 203 GILRLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKLLAGLKVHCHTSFEKVQFL 262

Query: 307 SLKHLPD-----TKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFY 361
            +K+ P      T L +    + LF + L K            +W A +        ++ 
Sbjct: 263 -IKYAPTNYHKPTALLSAIAFVTLFSIRLLK-----------KRWMAKH--------RWL 302

Query: 362 FYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLAS--- 418
            +       VII ++ +  W       K +  I I+G          + KL + ++    
Sbjct: 303 AFIPEILMVVIISIYLSATWEF-----KKQYGILIVGD----FNTHAIDKLKNPISKENR 353

Query: 419 KIAPEL-PASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPA 474
           KI P+L    V++ LL   E +  +KS G   D  +  ++EL+A+G  N+I + F A P+
Sbjct: 354 KIMPQLLNTGVLISLLGFFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFGALPS 413

Query: 475 TGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
            G + RS + A    +T +SG+F GS  L+ +  L  +  YIP   LS +
Sbjct: 414 FGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLCILSVI 463

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 106/408 (25%), Positives = 180/408 (44%), Gaps = 51/408 (12%)

Query: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFTYS 193
            P   WLP+YN++    DLIAG+++    +P ++S+A  +A + P  GLYS     F Y+
Sbjct: 90  LPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAFTPFIYA 149

Query: 194 LFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGF 253
           +  +   + +GP + +SL  G+ + K+++     +P++    ++ V+ F+ G      G 
Sbjct: 150 ILGSVPQMIVGPESAISLVVGQAVEKMISH----NPDLHTLQLSAVITFISGGFLFFFGL 205

Query: 254 LRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLK---- 309
            RLGFL  ++S   + GF++   L ++   + +       +      Y    E +     
Sbjct: 206 CRLGFLGNVLSRALLRGFISSVGLVMIINSMISEFKLDKILKDLPVHYHTPFEKILFLVT 265

Query: 310 ------HLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFY 363
                 H P T L     L   FIL + K     + PR   +W               F 
Sbjct: 266 YAPNNYHGPTTALS----LSCFFILIMTKIIKKKLMPRC--RWIV-------------FV 306

Query: 364 AQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASK---I 420
                  +++++   I  SI K + K    IS +G         G+ KL + L+++   +
Sbjct: 307 PD-----ILLLIIGTIFLSI-KYRFKHNYSISTVGD----FNTKGLDKLLNPLSAENRGL 356

Query: 421 APE-LPASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATG 476
            P+ L A  I  +L   E    +KS G   D  +  ++EL+A+G  NL  +   + PA G
Sbjct: 357 IPQLLSAGFITAMLGFFESTTASKSLGSSYDLAISSNRELVALGSMNLFSSILGSLPAFG 416

Query: 477 SFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
            + RS + A    +T +SG F G  VLL +  L  +  YIP   LS V
Sbjct: 417 GYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICVLSVV 464

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 105/405 (25%), Positives = 172/405 (42%), Gaps = 45/405 (11%)

Query: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFTYS 193
            P + WLP+Y       DL+AGIT+    +P ++SYA  IA + P  GLY+  +  F Y+
Sbjct: 110 LPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYALAVSPFFYA 169

Query: 194 LFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGF 253
           +F ++  + +GP   +SL  G+ +       P+ DP +    I   +  + G I    G 
Sbjct: 170 IFGSTPQMIVGPEGAISLVIGQCVQSCKKHNPDLDPIL----IVIAVTLISGTILLISGI 225

Query: 254 LRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPD 313
            RLG+L  +++   + GF+ GS   +M                       II+SL  + +
Sbjct: 226 FRLGYLGNILNKALLHGFI-GSVGFVM-----------------------IIDSL--INE 259

Query: 314 TKLDAVFGLIP-------LFILYLWKWWCGNMGPRMADKWFANNEKGNFY--LKKFYFYA 364
            KL  +    P       L I++LWK+   N         F +          KK   + 
Sbjct: 260 LKLGDILADTPEHYNTPFLKIVFLWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHR 319

Query: 365 QAAKNAV--IIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPD---GLASK 419
                 +  I+IV T +     K    D   I ILG        +    L +   GL   
Sbjct: 320 HRWLIFIPEILIVLTTVLILSYKLDFADTYDIDILGDFKSNENSIFHNPLSNKNRGLIHV 379

Query: 420 IAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFS 479
           +      + I    E    +K+ G  ++  V  ++EL+A+G++N++ +   A P+ G + 
Sbjct: 380 VFNIGIITAIFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGALPSFGGYG 439

Query: 480 RSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
           RS + A    +T LSG+F G   +LA+  L  V  YIP   LS +
Sbjct: 440 RSKINALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVI 484

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 106/430 (24%), Positives = 190/430 (44%), Gaps = 44/430 (10%)

Query: 128 KEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFI 187
           K Y     PI++W P Y+      DL+AGI++    +P ++S + +A + P  GL+S  I
Sbjct: 41  KSYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIPFAISLSTMAHVSPYAGLFSLVI 100

Query: 188 GAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVI 247
               Y++F +   + +GP  V+SL  G+        +   D  +T  VIA       G I
Sbjct: 101 PPLIYAVFGSVPTMVVGPQTVVSLVVGQSCEA--WSHKSVDSLVTVAVIACT----SGFI 154

Query: 248 TAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQI-PALMG---YGSKV---NTRTST 300
              +G  R+GF+   IS   + GF+   A+ ++  ++ P L     Y  +V   N  T+T
Sbjct: 155 LLSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELLPELQLEDLYRDEVAQGNAGTTT 214

Query: 301 YKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKF 360
           +      LK+ P+   D+ F +   FI +     C     +   K+F   EK    L +F
Sbjct: 215 WDKFNFILKYGPEHA-DS-FSMKLSFIAFSILMVC-----KYVKKYF--TEKRGSKLCRF 265

Query: 361 YFYAQAAKNAVIIIVFTAIA----WSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGL 416
           +         +++  F  ++    WS T G         I+G++P         K+P   
Sbjct: 266 F-----PDLLLVVAGFIYLSYYNDWSSTMGT-------RIIGNLPPNKNH---FKVPITS 310

Query: 417 ASKIAPELPASVIVLLLEHIAIAKSFGRIN---DYKVVPDQELIAIGVTNLIGTFFNAYP 473
             +       S +V +L     A +F  I    D  +  ++EL+++G+ N++ + F+A P
Sbjct: 311 FKEFKELFDISFLVAILGLFDSATAFKAIGEKFDIDISSNRELVSLGLINVVSSVFSALP 370

Query: 474 ATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLI 533
           A G + RS L   C  +TP++G+      +  +  + G F Y+P   L+ +I +   +L+
Sbjct: 371 AFGGYGRSKLNILCSAQTPMAGIVVSVAAIFCMNYMMGAFHYLPLCVLAVIISYIAYNLL 430

Query: 534 ASYHTTWNFW 543
               +   F+
Sbjct: 431 EEIPSDLFFY 440

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 100/409 (24%), Positives = 170/409 (41%), Gaps = 53/409 (12%)

Query: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFTYS 193
            P   WLP Y+ +    D IAG ++    +P +MSY+  +A +PP  GL +     F Y+
Sbjct: 70  LPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYA 129

Query: 194 LFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGF 253
           +F +   + +GP + +SL  G+ I K +    + D ++    +  +L F+ G I    G 
Sbjct: 130 VFGSVPHMIVGPESAISLVVGQAIEKQM----KHDKSLDVVNLCLILTFISGAILFCFGI 185

Query: 254 LRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPD 313
           +R G+L  ++S   + GF++   L ++   +   +      N     Y        H P 
Sbjct: 186 MRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHY--------HAPF 237

Query: 314 TKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFAN----------NEKGNFYLKKFYFY 363
            KL           ++L+ +  GN     A    ++           ++ +   KK  F 
Sbjct: 238 QKL-----------IFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKVIFV 286

Query: 364 AQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPE 423
            +      I+IV   +         K    I I+G +  G        L     S  +  
Sbjct: 287 PE------ILIVVALVTLGSYHFSFKLRYNIDIVGDIEVGDTSKFRNPLSKKNLSLFSEL 340

Query: 424 LPASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSR 480
             A  +V LL   E    +KS G   +  V  ++EL+A+G  NL+G+ F A P+ G + R
Sbjct: 341 FHAGFMVALLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGYGR 400

Query: 481 SALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFL-----YIPKATLSAV 524
           S + A     T +SG+F G      + C+T +FL     +IP   LS +
Sbjct: 401 SKINAYSGAATVMSGVFMG-----LITCVTSMFLLNAIHHIPVCVLSVI 444

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 108/420 (25%), Positives = 179/420 (42%), Gaps = 48/420 (11%)

Query: 120 ENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPP 178
           E  +LK    Y L   P   W+P Y++     D IAG+++    +P +MSYA  +A +PP
Sbjct: 62  ERVTLKDTIPYYL---PCFSWIPTYSVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPP 118

Query: 179 QYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIAT 238
             GLYS       Y++  +   + +GP + +SL  G+ I   L++    DP + A  I  
Sbjct: 119 LCGLYSLVFSPAVYTVLGSVPQMIVGPESAISLILGQAIEARLSE----DPKLKAINICL 174

Query: 239 VLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRT 298
           V+ F+ G++    G LRLGFL  ++S   + GF++G  + ++   +   +       TR 
Sbjct: 175 VITFISGLVLLTGGLLRLGFLENVLSRALLRGFISGVGVIMVITSLVVELKLNHVTPTRQ 234

Query: 299 STYKVIIES----LKHLPDT--KLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEK 352
             Y    E     +K+ P+   K  A+  L+   IL         M  R+  K +     
Sbjct: 235 EHYHSPFEKVLFIMKYGPENYHKPTAILSLVAFVIL---------MSLRIFKKRYG---- 281

Query: 353 GNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKG--------L 404
                KKF +        V++ +   +++   K   K    I I+  +PK          
Sbjct: 282 -----KKFKWLVLLPDILVVVALSIFVSY---KMHLKSRYGIEIINDIPKDSMKHLKNPF 333

Query: 405 KEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNL 464
             V V    D  ++     +         E    +KS G   +  +  ++ELIA+G  N+
Sbjct: 334 SNVNVATFKDLFSTGFMVAMLG-----FFESATASKSLGTSYNLAISSNRELIALGSMNV 388

Query: 465 IGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
           +G+ F   PA G + RS + A    +T +SG F G   L  +  L  +  YIP   LS +
Sbjct: 389 VGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPIIRYIPVCILSVI 448

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 91/378 (24%), Positives = 158/378 (41%), Gaps = 43/378 (11%)

Query: 166 QSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYP 225
            S+S + +A LPP  GLYS  I    Y +  T     +GP  V+SL  G+  +     + 
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQ--SCEWWSHR 58

Query: 226 EADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIP 285
             +P  T  VI  V     G I   +G  R+GF+   +S   + GF++  AL ++  ++ 
Sbjct: 59  SLEPLSTVAVIGCV----SGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITELL 114

Query: 286 AL----------MGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWC 335
                       +  G    T    ++ I+E      DT              + W    
Sbjct: 115 PELKLEELYAHYVAQGYIGTTTWEKFRFILEKAPENSDT--------------FTWNLSL 160

Query: 336 GNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPIS 395
                 M  ++   +       KK  F+ +     ++I+V  +I  S T+ K  + + I 
Sbjct: 161 FTFILLMTIRYLKRHLAEKCGWKKCIFFPE-----ILIVVVGSITLSNTQ-KWSELKGIK 214

Query: 396 ILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLL---EHIAIAKSFGRINDYKVVP 452
           I+G +P     +   K+P    S+       S ++ +L   E   + KS    ++     
Sbjct: 215 IIGDIPPNSDHI---KVPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNSNVDASS 271

Query: 453 DQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGV 512
           ++EL+++GV NL+ + F+A PA G + RS +   C  +T  SG+F     ++ +  L   
Sbjct: 272 NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNA 331

Query: 513 FLYIPKATLSAVIIHAVS 530
           F ++P   L AVII  V+
Sbjct: 332 FHHLPICIL-AVIISTVA 348

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 79/152 (51%), Gaps = 8/152 (5%)

Query: 123 SLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPPQYG 181
           S + V  Y L   P   W+P Y  + F  DL+AGIT+    +P ++SYA  +A + P  G
Sbjct: 73  SFRDVLPYYL---PCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCG 129

Query: 182 LYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLA 241
           LYS     F Y++F +   + +GP + +SL  G+ + K+ A   E    I+   I+ ++ 
Sbjct: 130 LYSLAFTPFIYAIFGSVPQMIVGPESAISLVVGQAVEKLRAHNHE----ISTMSISVLVT 185

Query: 242 FLCGVITAGIGFLRLGFLVELISLNAVTGFMT 273
           F+ G+     G  R GFL  ++S   + GF++
Sbjct: 186 FISGMFLFVFGICRFGFLGNVLSRALLRGFIS 217

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 419 KIAPELP-ASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPA 474
           ++AP L  A  IV +L   E    AKS G   ++ +  ++EL+A+G  NL  +   A PA
Sbjct: 347 ELAPNLMNAGFIVAILGFFESTTAAKSLGSAYEFAISSNRELVALGSMNLCASVLGALPA 406

Query: 475 TGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
            G + RS + +    +T +SG+  G  VLL +        YIP   LS +
Sbjct: 407 FGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQIRYIPVCILSVI 456

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 76/144 (52%), Gaps = 5/144 (3%)

Query: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFTYS 193
            P   WLP Y+   F  DLIAG ++    +P +MSY+  +A +PP  GL +       Y+
Sbjct: 85  LPCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 194 LFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGF 253
           +F +   + +GP + +SL  G+ I K L K+ +A  N+T   +  VL F+ G I    G 
Sbjct: 145 VFGSVPHMIVGPESAISLVVGQAIEK-LTKH-DASLNVTN--LCVVLTFISGSILFSFGL 200

Query: 254 LRLGFLVELISLNAVTGFMTGSAL 277
           +R GFL  ++S   + GF++   L
Sbjct: 201 MRFGFLDSVLSRALLRGFISAVGL 224

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 3/102 (2%)

Query: 426 ASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSA 482
           A  +V LL   E    +KS G   D  +  ++EL+A+G  NL+G+ F A P+ G + RS 
Sbjct: 358 AGFLVALLGFFESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSK 417

Query: 483 LKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAV 524
           + A     T +SG+F G   L+    L     +IP   LS +
Sbjct: 418 INAYSGAATVMSGVFMGLITLITSKFLLNAIRHIPICVLSVI 459

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 76/153 (49%), Gaps = 6/153 (3%)

Query: 128 KEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFI 187
           K Y     PI+RWLP Y+    + D++AG+T+    +P ++S   +A + P  GLY+  I
Sbjct: 41  KSYVSYYLPILRWLPEYSWGKMAKDMLAGLTLTSFQIPLAISLTTMAHVSPYAGLYALVI 100

Query: 188 GAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVI 247
               Y++F +   + +GP  V SL  G+       K    +P +T  VI  +     GV+
Sbjct: 101 PPLIYAVFGSVPTMVVGPQTVASLVVGQSCDAWAHK--SLEPLMTVAVIGCI----SGVL 154

Query: 248 TAGIGFLRLGFLVELISLNAVTGFMTGSALNIM 280
              +G  RLGF+   IS   + GF +  A+ ++
Sbjct: 155 VFAMGIFRLGFIDNAISKAFLKGFTSALAVVML 187

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 3/103 (2%)

Query: 426 ASVIVLLLEHIAIAKSFGRIN---DYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSA 482
           AS +V +L     A +F  I+   D  V  ++EL+++G+ N++G+ F++ PA G + RS 
Sbjct: 320 ASFLVAILGLFESATAFKSISATFDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSK 379

Query: 483 LKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVI 525
           L   C  +TP++G+F     +  +  L GVF Y+P   L+ +I
Sbjct: 380 LNIFCGAQTPMAGIFVSLSAIFCMRFLMGVFHYLPLCILAVII 422

>CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON}
           similar to uniprot|Q03770 Saccharomyces cerevisiae
           YDR160w SSY1
          Length = 853

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 85/200 (42%), Gaps = 40/200 (20%)

Query: 8   QKNENNTNDIENQYELPS---FPNSDTSSQNLA-DLELEYDQYKASETNNKSNHGPDLET 63
            KN +  NDI N ++  S   +   + S  N+A D  ++Y+  K S + + + H      
Sbjct: 188 SKNAHTNNDIRNNFDNMSSRTYVIDNASDGNVAIDENIDYETMKRSVSIDGNVH------ 241

Query: 64  NNLDVQFSNTYNTGDKKNSIKNHQIQINTFNADSVIIPSFEEHAISFKDYYRHSLKENFS 123
                  SN Y++  +K   +    +IN +  DS                 R+ L+ N  
Sbjct: 242 -------SNFYDSDQEKKGKRYIHEKINKYLHDST--------------RRRNQLQRNLK 280

Query: 124 LKSVKEYA----LSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQ 179
           ++ ++  A    LS    +     +++A     L+  I  G V++   MS+A++ATL P 
Sbjct: 281 VRHIQMLAISACLSAGIFMTSGKAFSIAGPFGCLLGFIITGTVVIATMMSFAELATLIPV 340

Query: 180 ----YGLYSSFI-GAFTYSL 194
                GL S F+  AF ++L
Sbjct: 341 SSGFSGLASRFVEDAFGFAL 360

>TPHA0B00170 Chr2 complement(27065..28297) [1233 bp, 410 aa] {ON} 
          Length = 410

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 4/60 (6%)

Query: 843 TINEEYSDESIIAGHTSYHLARIPGDDLELPTMRGG----NYKVYTATGTNLPFFHIDIP 898
           TIN+ Y   S     T   L  +  DD+E    R       + +Y+ATG  +PF H+ IP
Sbjct: 290 TINQLYQCASKTEESTLLQLVTLSIDDIEEANRRDNVKIVGFLLYSATGKEVPFLHMVIP 349

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa]
          {ON} Anc_7.44 YOR348C
          Length = 601

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 10/83 (12%)

Query: 12 NNTNDIENQYELPSFPNSDTSSQNLADLELEY--------DQY--KASETNNKSNHGPDL 61
          NN   +   YEL   P+S    + L D+E +         D++  K S  N       D 
Sbjct: 3  NNRGQVTYNYELEDIPSSKNELKELGDMEAQQMNLDDSLDDRFNKKDSGLNKVLTVSSDT 62

Query: 62 ETNNLDVQFSNTYNTGDKKNSIK 84
           TN+L+  ++NT   G K   ++
Sbjct: 63 STNSLEEDYTNTLKQGLKSRHVQ 85

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,668,473
Number of extensions: 4416287
Number of successful extensions: 17387
Number of sequences better than 10.0: 176
Number of HSP's gapped: 17595
Number of HSP's successfully gapped: 202
Length of query: 905
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 786
Effective length of database: 39,836,145
Effective search space: 31311209970
Effective search space used: 31311209970
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)