Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B020108.266ON28126213730.0
NCAS0B050408.266ON2732595697e-72
TDEL0F039308.266ON2802554044e-47
SAKL0H16940g8.266ON3032963856e-44
Kwal_56.237778.266ON2672753756e-43
KLTH0G13596g8.266ON2672263634e-41
KAFR0B027408.266ON2562553006e-32
Suva_10.1758.266ON2992502783e-28
YLR091W (GEP5)8.266ON2932702773e-28
ZYRO0C01562g8.266ON2772612763e-28
Kpol_392.48.266ON2812582511e-24
Smik_12.1508.266ON2922762493e-24
AGR082C8.266ON2662142263e-21
Skud_12.1598.266ON2942702259e-21
KLLA0F19228g8.266ON3052302205e-20
Ecym_43048.266ON2892722152e-19
KNAG0G020608.266ON2862622082e-18
TPHA0J007608.266ON2492301172e-06
CAGL0L12320g8.266ON27850702.0
Kwal_56.230923.196ON63758684.0
CAGL0D04774g3.463ON322125667.0
Kpol_332.1singletonON420162669.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B02010
         (281 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...   533   0.0  
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...   223   7e-72
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   160   4e-47
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   152   6e-44
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...   149   6e-43
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...   144   4e-41
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...   120   6e-32
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...   111   3e-28
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...   111   3e-28
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...   110   3e-28
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...   101   1e-24
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...   100   3e-24
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...    92   3e-21
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...    91   9e-21
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...    89   5e-20
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...    87   2e-19
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    85   2e-18
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    50   2e-06
CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weak...    32   2.0  
Kwal_56.23092 s56 (398220..400133) [1914 bp, 637 aa] {ON} YBR007...    31   4.0  
CAGL0D04774g Chr4 complement(467712..468680) [969 bp, 322 aa] {O...    30   7.0  
Kpol_332.1 s332 complement(1..12603) [12603 bp, 4201 aa] {ON} co...    30   9.2  

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/262 (100%), Positives = 262/262 (100%)

Query: 20  PLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYHTY 79
           PLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYHTY
Sbjct: 20  PLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYHTY 79

Query: 80  FEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKIDSKKNSIILTWNKSSNSKNMLRELLSH 139
           FEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKIDSKKNSIILTWNKSSNSKNMLRELLSH
Sbjct: 80  FEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKIDSKKNSIILTWNKSSNSKNMLRELLSH 139

Query: 140 LNYTQSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCSNGKRLPSPIVEIPMNAMGYDIPKK 199
           LNYTQSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCSNGKRLPSPIVEIPMNAMGYDIPKK
Sbjct: 140 LNYTQSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCSNGKRLPSPIVEIPMNAMGYDIPKK 199

Query: 200 RINNLLRSKIARTWNYLAITNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSYV 259
           RINNLLRSKIARTWNYLAITNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSYV
Sbjct: 200 RINNLLRSKIARTWNYLAITNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSYV 259

Query: 260 IKNEDDNNIEFQKSKKLNWLNF 281
           IKNEDDNNIEFQKSKKLNWLNF
Sbjct: 260 IKNEDDNNIEFQKSKKLNWLNF 281

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score =  223 bits (569), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 163/259 (62%), Gaps = 6/259 (2%)

Query: 20  PLHSNTLAQLERKCLTRNIKATK-SFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYHT 78
           PLH  TL  LERK  T N K+T+ SFK+PLL L+  YE+       +   K LESI Y+T
Sbjct: 17  PLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQEDKRGIEKVLESIAYNT 76

Query: 79  YFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKIDSKKNSIILTWNKSSNSKNMLRELLS 138
           YF W N + SHL+ FQ+    L  +WP +YH  +D+K++SII+ W KS+N   +L+  ++
Sbjct: 77  YFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGMDTKRDSIIVQWAKSNNGDALLKGTMN 136

Query: 139 HLNYTQSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCSNGKRLPSPIVEIPMNAMGYDIPK 198
           H+    S      +  ++FKKI+QHYIFL+LN  + SN KRL  P+V +PMN+MG  IP+
Sbjct: 137 HIQPGAS-----AEELLMFKKIFQHYIFLTLNARITSNAKRLQPPLVGVPMNSMGETIPQ 191

Query: 199 KRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSY 258
            R+ NL R K++ T N L   NP+LN+EN   LDEIIN      SR LR+LY+RA  N++
Sbjct: 192 VRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEIINADYENTSRSLRRLYQRASKNAH 251

Query: 259 VIKNEDDNNIEFQKSKKLN 277
           VI  E   +I+F  +K L+
Sbjct: 252 VIAGESPESIQFAIAKDLH 270

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  160 bits (404), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 143/255 (56%), Gaps = 16/255 (6%)

Query: 20  PLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYHTY 79
           PLHS TL  L  K     +K   +  IPL  L+++ E ++A  Q     K LESIIYHT+
Sbjct: 17  PLHSKTLDLLACKLKGDELK---TVIIPLAKLVSNLESSRAETQRI---KALESIIYHTH 70

Query: 80  FEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKI----DSKKNSIILTWNKSSNSKNMLRE 135
           F W + L  HLK FQ  Y+ +L  WP+  H  I      +  S+   W  SS +   + E
Sbjct: 71  FVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDSSKTVLSMAE 130

Query: 136 LLSHLNYTQSLVPQKKDF---QVIFKKIYQHYIFLSLNPSLCSNGKRLPSPIVEIPMNAM 192
              +     +++ +K       ++F  ++ HY+FL  NP LC+NG+ LP PIVEIPM  +
Sbjct: 131 YSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNGRNLPIPIVEIPMRPL 190

Query: 193 GYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIINGSSAIKSRQLRKLYRR 252
           G DI   RI NL +SK+A T+  LAI NP+L+  +E  L EII+ +S   SR+ R+LY+ 
Sbjct: 191 GNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISDAS---SRKQRRLYQA 247

Query: 253 ACSNSYVIKNEDDNN 267
           +C  +YV++ +D  +
Sbjct: 248 SCKRAYVMEYDDGEH 262

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  152 bits (385), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 103/296 (34%), Positives = 155/296 (52%), Gaps = 54/296 (18%)

Query: 20  PLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYHTY 79
           PL + TL  LE            + K+    L+++ E+     Q+  ++K+LE I+Y+TY
Sbjct: 15  PLDTRTLDLLE-----------GTVKLCSSALLDTLEQKLFDYQANENSKSLEWIVYNTY 63

Query: 80  FEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKIDS----KKNSIILTWNKSSNSKNMLRE 135
           F W N    H++ F++ Y  L   WP+  H  + S    ++ SI   WN   N+K +L  
Sbjct: 64  FHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWN--DNNKKVLSS 121

Query: 136 L------------LSHLNY--------TQSLVPQKK--------------DFQVIFKKIY 161
           +            L  LN          Q+L  +K               +  ++F +I+
Sbjct: 122 MRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEIF 181

Query: 162 QHYIFLSLNPSLCSNGKRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNP 221
           QHY+FL  NP LC  GK+LP PIVEIPM  +G DIP  RI NL + K A TW  LA  NP
Sbjct: 182 QHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAEENP 241

Query: 222 ILNLENEAQLDEII---NGSSAIKSRQLRKLYRRACSNSYVIKNEDDNNIEFQKSK 274
           +L+LENEA L +II   + S+++ +R++++LY+RAC +SYVI  +    ++FQ SK
Sbjct: 242 VLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDRSIGLDFQISK 297

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score =  149 bits (375), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 96/275 (34%), Positives = 141/275 (51%), Gaps = 40/275 (14%)

Query: 20  PLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYHTY 79
           PL   TL  +E++     ++  +S +   L L   YE       +K   KTLE+II+HTY
Sbjct: 12  PLDVRTLKLIEKR-----LERAESLR--FLELARQYE-------AKKDYKTLENIIHHTY 57

Query: 80  FEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKI----DSKKNSIILTWNKSSNSKNMLRE 135
           F W N++  H+K F+  Y+ L  FWP+  H  I      K  SI   W+ + N +     
Sbjct: 58  FSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWS-AGNPR----- 111

Query: 136 LLSHLNYT----------QSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCSNGKRLPSPIV 185
           +L+ + Y           + L   ++  +  F +I+QH++FL   P LC N K L  PIV
Sbjct: 112 VLAAMRYGSYGWNREGGGERLTELERTLR--FHEIFQHFLFLQRRPQLCKNRKHLSVPIV 169

Query: 186 EIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIING----SSAI 241
           EIPM  +G +I   RI NL + K+A  W  LA+ NP L+ ENE+ L +II          
Sbjct: 170 EIPMKPLGQNIADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQT 229

Query: 242 KSRQLRKLYRRACSNSYVIKNEDDNNIEFQKSKKL 276
            SR L++LY+RAC  +YVIK      +E ++SK L
Sbjct: 230 SSRMLKRLYQRACRGAYVIKPHPTLGLEIEESKIL 264

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score =  144 bits (363), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 128/226 (56%), Gaps = 16/226 (7%)

Query: 67  SNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKIDS----KKNSIILT 122
           S+K+LESI++ TYF W N+ A H+K F+  Y+ L   WP+ +H  I S    K  SI   
Sbjct: 45  SSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFL 104

Query: 123 WNKSSNSKNMLRELLSHLNY---TQSLVPQKKDFQ--VIFKKIYQHYIFLSLNPSLCSNG 177
           W  SSNS  +L ++ S+  Y   T+    +  + Q  V F +++QH++FL   P LC   
Sbjct: 105 W--SSNSPKVLSKM-SYEKYAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKTR 161

Query: 178 KRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIING 237
           K L  PIVEIPM  +G +IP+ R+ NL + KIA  W  LA+ +P L+ +NE  L +II+ 
Sbjct: 162 KGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIIDS 221

Query: 238 ----SSAIKSRQLRKLYRRACSNSYVIKNEDDNNIEFQKSKKLNWL 279
                     R+L++LY+RAC  +Y I+      +E ++SK L  L
Sbjct: 222 PQLPEDVSSKRELKRLYQRACRGAYTIEQHPVLGLEIKESKLLKRL 267

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score =  120 bits (300), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 88/255 (34%), Positives = 132/255 (51%), Gaps = 33/255 (12%)

Query: 20  PLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYHTY 79
           PLH  TL QL+       +K   +  IPLL  + SYE    +G+SK     LESIIY  Y
Sbjct: 28  PLHQKTLLQLQD-----TLKRNDALAIPLLRDVVSYE---TTGKSKF----LESIIYRLY 75

Query: 80  FEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKIDSKKNSIILTWNKSSNSKNMLRELLSH 139
           F+W N++ SHLKP   QY  L + WP   H K  + +   I   N        +R   + 
Sbjct: 76  FQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKNAEPEAISLRNA------WMRNKATA 129

Query: 140 LNYTQSLVPQKKDFQVIFKKIYQHYIFLSLNPS-LCSNGKRLPSPIVEIPMNAMGYDIPK 198
           ++ + S          + K I  H+ +L +N   LC   K++  PI+E+P+N  G +IP+
Sbjct: 130 VDLSTS--------DGVIKPILNHFRYLRVNEDRLCK--KKVGLPILEVPLNVFGTEIPE 179

Query: 199 KRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSY 258
            R+NNLL+ +IA     L   NP+L+ + E  L  IIN S    +R L+++Y R+CS +Y
Sbjct: 180 CRVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSIINDSK--NTRALKRVYLRSCSRAY 237

Query: 259 VIKN--EDDNNIEFQ 271
             ++  +D +NI F 
Sbjct: 238 TGESNPKDSSNITFH 252

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score =  111 bits (278), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 80/250 (32%), Positives = 118/250 (47%), Gaps = 26/250 (10%)

Query: 42  KSFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLL 101
           K   +PL   +  YEKAQ +   + S K LESI+Y T+F+W N    H   FQ+ Y  LL
Sbjct: 40  KEIAVPLTESLQVYEKAQRAQDLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLL 99

Query: 102 TFWPHIYH-SKID-------------SKKNSIILTWNKSSNSKN-----MLRELLSHLNY 142
           + WP   H S +D             SK N +   W      KN             L+ 
Sbjct: 100 SHWPFENHRSLVDSIPAQNGKLISLTSKGNWLKADWTTLFQVKNPWVRTPPPPPSPSLSL 159

Query: 143 TQSLVPQKKDFQV----IFKKIYQHYIFLSLNPSLCSNGKRLPSPIVEIPM-NAMGYDIP 197
            Q+ + +   F      + K +  HY FL  N  L  N K+ PSP+V+IP+ NA+G   P
Sbjct: 160 AQNSIAELDAFTAERTFLVKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISP 219

Query: 198 KKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNS 257
            K+I+ L   ++A+ +  L + NP L+  NE  L  + +  +    R+  +LY RAC+ +
Sbjct: 220 PKQISKLFARQLAQIYTSLFVENPPLSTANELALMTVFDDGTL--ERRHTRLYMRACARA 277

Query: 258 YVIKNEDDNN 267
           Y I N D +N
Sbjct: 278 YTIANADSDN 287

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score =  111 bits (277), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 128/270 (47%), Gaps = 31/270 (11%)

Query: 21  LHSNTLAQLERKCLTRNIKATKS---FK---IPLLTLINSYEKAQASGQSKLSNKTLESI 74
           + S  L Q+ +  LT  + + +S   FK   +PL   +  YEKAQ     + S K LESI
Sbjct: 13  IESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQDLRASLKALESI 72

Query: 75  IYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKI-------DSKKNS-------II 120
           IY T+F+W N L  H   FQ+ Y  LLT WP   H  +       + K NS       + 
Sbjct: 73  IYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGKLNSTSSRSVWLK 132

Query: 121 LTWNKSSNSKNMLREL---LSHLNYT--QSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCS 175
             W    N KN   +    L  L+ T   +  P++     +   +  HY FL  N  L  
Sbjct: 133 ADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERI---FLINSLGNHYKFLIANSHLSY 189

Query: 176 NGKRLPSPIVEIPM-NAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEI 234
           N K+ PSP V+IP+ NA+G   P K+I  L   +++  +  L I NP L+ ENE  L  +
Sbjct: 190 NHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPLSPENELALTAV 249

Query: 235 INGSSAIKSRQLRKLYRRACSNSYVIKNED 264
               +    R+LR+LY RAC+ +Y   N D
Sbjct: 250 FYDETV--ERRLRRLYMRACARAYTTTNAD 277

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score =  110 bits (276), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 86/261 (32%), Positives = 125/261 (47%), Gaps = 29/261 (11%)

Query: 20  PLHSNTLAQLERKCLTRNIKATKSFKIPLLTL-INSYEKAQASGQSKLSNKTLESIIYHT 78
           PLH  T   LE  C  RN     S+K  L+   I+ +EK          +K LE++I  T
Sbjct: 21  PLHIETQKVLEFYC--RN----SSYKSLLVAQDISEFEKHN-------DHKYLEALIQKT 67

Query: 79  YFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKI----DSKKNSIILTWNKSS----NSK 130
           +F W N L   LK FQ  +  L   WP+ Y   +    + +K S    W        ++ 
Sbjct: 68  HFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELALSNL 127

Query: 131 NMLRELLSHLNYTQSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCSNGKRLPSPIVEIPMN 190
              +   +  N  + L P++     +   I+  Y FL  +  LC N +++P PIVEIP+ 
Sbjct: 128 RFEKHRWADENIIERLSPEQGT--QLLHSIFHQYFFLKSHARLCYNNRKIPVPIVEIPLR 185

Query: 191 AMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIINGSSAIKSRQLRKLY 250
            MG D+   RI NL + K A  WN LA  N  L+  NE  L EII  S   ++R +R+LY
Sbjct: 186 PMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITKS---ETRSMRRLY 242

Query: 251 RRACSNSYVIKNE--DDNNIE 269
           +RA   +YV+ NE  D N ++
Sbjct: 243 QRASRRAYVVTNEGKDPNGLQ 263

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score =  101 bits (251), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/258 (27%), Positives = 127/258 (49%), Gaps = 17/258 (6%)

Query: 20  PLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYHTY 79
           PLH  TL  LER+    ++   + +    + ++N YE ++ + + +  ++ LE I+  T+
Sbjct: 23  PLHKPTLDILERRIHVADLPFMEEY----VGILNEYEISKINSKVENESRALEKIVKKTH 78

Query: 80  FEWTND-LASHLKPFQRQYSTLLTFWPHIYHSKI-----DSKKNSIILTWNKSSNSKNML 133
             W ND   +HL+ F+  Y  LL  WP+ +HS +         + I L  N      N  
Sbjct: 79  IVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLCLNNDDRFFNFY 138

Query: 134 RELLSH--LNYTQSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCSNGKRLPSPIVEIPMNA 191
           +  +++   N         +    I+  I++   FL  + ++    K +  PIVE+P+  
Sbjct: 139 KSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTISEVNKNM-VPIVEVPLKP 197

Query: 192 MGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIINGSSAIKSRQLRKLYR 251
           +G DIP  RI NL   K+   W  L++++P ++L +E  +  I+  +    +R++ +LYR
Sbjct: 198 IGCDIPACRIKNLFNKKVDYIWKLLSLSSPAISLSHEKIIMNILEDTK--DNRRINRLYR 255

Query: 252 RACSNSYVIKNEDDNNIE 269
           R+  NSYV   +D N IE
Sbjct: 256 RSLKNSYVF--DDTNPIE 271

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score =  100 bits (249), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 88/276 (31%), Positives = 126/276 (45%), Gaps = 43/276 (15%)

Query: 21  LHSNTLAQLERKCLTRNIKATKS---FK---IPLLTLINSYEKAQASGQSKLSNKTLESI 74
           + S  L Q+ +  L   +  T+S   FK   +PL  L+  +EKAQ     + + K LESI
Sbjct: 13  IQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQDLRTALKALESI 72

Query: 75  IYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHS-KIDS------KKNSII--LTWNK 125
           IY T+F+W N    H   FQ+ Y  LLT WP   H   +DS      K NSI    TW K
Sbjct: 73  IYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNSIPSKTTWLK 132

Query: 126 SS----------------NSKNMLRELLSHLNYTQSLVPQKKDFQVIFKKIYQHYIFLSL 169
           +                   KN+    L       +  P++     +   +   Y FL  
Sbjct: 133 ADWATLFQVKNPWVQTPPTPKNLSETDLD------AFTPERA---FLVNSLGNQYKFLIA 183

Query: 170 NPSLCSNGKRLPSPIVEIPM-NAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENE 228
           N  L  N K+ PSP V+IP+ NA+G   P K+I+ L   ++A  +  L   NP L+  N+
Sbjct: 184 NSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSPAND 243

Query: 229 AQLDEIINGSSAIKSRQLRKLYRRACSNSYVIKNED 264
             L  I N  +    R+ ++LY RAC+ +Y I N D
Sbjct: 244 IALMAIFNDKTM--DRRFKRLYMRACARAYTITNAD 277

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score = 91.7 bits (226), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 98/214 (45%), Gaps = 25/214 (11%)

Query: 65  KLSNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKI----DSKKNSII 120
           K  ++ L+ +++H +F+       HL+  +R    L  FWP+  H  +    D +  S+ 
Sbjct: 50  KGGHQGLQRLVFHVHFQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLALSDVRSQSLR 109

Query: 121 LTWNKSSNSKNMLRELLSHLNYT------QSLVPQKKDF-----QVIFKKIYQHYIFLSL 169
             W           E+L  + Y       +  VP++        + +  +++  Y+FL  
Sbjct: 110 RLWEDGQE------EVLQQMQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQ 163

Query: 170 NPSLCSNGKRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEA 229
            P+L S  +RLP P+VEI M  +G+DIP  R++ L + K       L   +P L    E 
Sbjct: 164 RPALWSV-RRLPIPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEE 222

Query: 230 QLDEIINGSSAIKSRQLRKLYRRACSNSYVIKNE 263
            +  II   +   +R +R++Y RAC  +YV+  +
Sbjct: 223 DMLRII---AECPTRAMRRIYLRACRRAYVLDAD 253

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score = 91.3 bits (225), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 122/270 (45%), Gaps = 31/270 (11%)

Query: 20  PLHSNTLAQLERKCLTRNIKATKSFK---IPLLTLINSYEKAQASGQSKLSNKTLESIIY 76
           PLH  T   L    +   I++   FK   +PL   +  YEKAQ     + S K LESII+
Sbjct: 17  PLHRITKTALTTTLV--GIQSDYKFKEIAVPLTESLQVYEKAQRRQDLRTSLKALESIIF 74

Query: 77  HTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYH-SKIDS------KKNSII--LTWNKSS 127
            T+F+W N    H   FQ+ +  LL+ WP   H S +DS      K NS+    TW K+ 
Sbjct: 75  QTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGKLNSMASKGTWLKAD 134

Query: 128 -----NSKNMLREL-------LSHLNYTQSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCS 175
                  KN   +          H          ++ F V    +  HY FL  N  L  
Sbjct: 135 WTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLV--NSLGNHYKFLVANSHLSY 192

Query: 176 NGKRLPSPIVEIPM-NAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEI 234
           N K+ P P V+IP+ NA+G     K+I  L   ++ + +  L + NP L+ +NE  L  +
Sbjct: 193 NHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPPLSADNELALMAV 252

Query: 235 INGSSAIKSRQLRKLYRRACSNSYVIKNED 264
            +  S    R+ ++LY RAC+ +Y   N D
Sbjct: 253 FHDDSL--DRRHKRLYMRACARAYTTVNSD 280

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score = 89.4 bits (220), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 109/230 (47%), Gaps = 40/230 (17%)

Query: 67  SNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPH-IYHSKI---DSKKNSIILT 122
           + KTLE ++Y  +F   ND   H+   ++  + L  FWP+ + HS +   D    S  + 
Sbjct: 49  TRKTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTIL 108

Query: 123 WNKSSNSKNML--------------------RELLSHLNYTQSL----------VPQKKD 152
           W  S N+K+ L                     EL+  +     L          +P +K 
Sbjct: 109 W--SRNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEK- 165

Query: 153 FQVIFKKIYQHYIFLSLNPSLCSNGKRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIART 212
            +   ++I++HY FL  NP LC+  K+L +PIVEI M   G+DI   RI+NL + K+   
Sbjct: 166 IKETLRQIFEHYYFLKTNPKLCAT-KKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLI 224

Query: 213 WNYLAITNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSYVIKN 262
            + L   NP+L  + E+ L  I+N      +R+ ++LY+   S SY+ K+
Sbjct: 225 SDLLYSQNPVLTSDAESILTSIVNDPDL--NRRTKRLYKNVASRSYLFKD 272

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 121/272 (44%), Gaps = 45/272 (16%)

Query: 20  PLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYHTY 79
           PLH++T     +K +  N+ +    +   + +I    +   SG+       L  +I+  Y
Sbjct: 16  PLHAHT-----KKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVSY----LRRVIFDVY 66

Query: 80  FEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKIDSK----KNSIILTWNKSSNSKNMLRE 135
           F   N  A H++ F+R    L  FWP+  HS + S     K+S    W++++     +  
Sbjct: 67  FRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAKVLDIMR 126

Query: 136 LLSHL-----------------NYTQSL--VPQKKDFQ--------VIFKKIYQHYIFLS 168
              HL                  +TQ L  +  +KD           + K I+ HY+F+ 
Sbjct: 127 YDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIFSHYLFVK 186

Query: 169 LNPSLCSNGKRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENE 228
             P+LC + K LP PIVE+ M+ +G D+P  RI+NL R +   T   L    P L+ E E
Sbjct: 187 SRPTLCGH-KNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPLSREVE 245

Query: 229 AQLDEIINGSSAIKSRQLRKLYRRACSNSYVI 260
           + L  II        R + +LY+ +C+ +Y +
Sbjct: 246 SLLHSIIKEC----DRSMGRLYKWSCNGAYTM 273

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 121/262 (46%), Gaps = 31/262 (11%)

Query: 20  PLHSNTLAQLERKCLTRNIKATKSFKIPLL-----TLINSYEKAQASGQSKLSNKTLESI 74
           PLHS TLA+L     +R++ ATKS  IP L     TL N ++       ++   K L ++
Sbjct: 16  PLHSLTLARL-----SRHVAATKS--IPRLKHVAETLQNFHDVPSTKKHTQY--KILTTL 66

Query: 75  IYHTYFEWTND------LASHLKPFQRQYSTLLTFWPHIYHSKI-DSKKNSIILTWNKSS 127
           +   Y +W N       L  HL PF++ +  L+  WP   H  +  S K    L     +
Sbjct: 67  LLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGHATLKHAWVT 126

Query: 128 NSKNMLRELLSHLNYTQSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCSNGKRLPSPIVEI 187
           N+K+ L+  +S      +      + +   ++I  HY  L  N  +    K L  P+ EI
Sbjct: 127 NNKHALQ--MSFDAAAANPTSGNIELRGSLRQILSHYQLLYNNMRMFGKIK-LQVPVAEI 183

Query: 188 PMNAMGYDIPKKRINNLLRSKIARTWNYLAITNPIL-NLENEAQLDEIINGSS-AIKS-- 243
           P+N  G +IP  R  NLL+ K+      L    P L N E  A+L  II G   A +S  
Sbjct: 184 PLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAIIAGDGPAARSGN 243

Query: 244 ---RQLRKLYRRACSNSYVIKN 262
              RQLR+LYRRA +  Y + +
Sbjct: 244 YSPRQLRRLYRRAFAGCYTLAS 265

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 104/230 (45%), Gaps = 55/230 (23%)

Query: 20  PLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYHTY 79
           PLH NTL  L+++  T+  K ++     L+ L+  Y  A  + Q     K L+ II+ T+
Sbjct: 29  PLHPNTLDLLQKQVHTKLTKNSE-----LIELLFDYNNAFINKQKPGQLKCLQRIIFKTH 83

Query: 80  FEWTNDLAS--HLKPFQRQYSTLLTFWPHIYHSKIDSKKNSIILT------WNKSSNSKN 131
             + N   +  HLK F+ +Y+ L   WP+  H  + +   ++  T      WN + NS N
Sbjct: 84  LIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYLWN-NCNSDN 142

Query: 132 M-------LREL--------LSHLNYTQSLVPQKKDFQV---------------IFKKIY 161
           +       ++E+        ++  +Y    + ++ + ++               +F +++
Sbjct: 143 LAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIEINLFGELF 202

Query: 162 Q--HYIFLSLNPSLCSNGKRLPSPIVEIPMNAMGYDIPKKRINNLLRSKI 209
           +  HYI         +   +L  PIV +P+NA+G  IPK R+ N  + K+
Sbjct: 203 KQLHYI---------NTINKLQIPIVILPLNALGLKIPKSRLYNKFKKKL 243

>CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q12393 Saccharomyces cerevisiae
           YLR091w
          Length = 278

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 65  KLSNKTLESIIYHTY--FEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKI 112
           +LS + L  ++ H +      N+L +HL+ +Q +Y  L+  WP +   +I
Sbjct: 49  RLSTRNLLRLVTHVHHVLAPMNELPAHLRQYQSEYHALVASWPTVTERQI 98

>Kwal_56.23092 s56 (398220..400133) [1914 bp, 637 aa] {ON} YBR007C -
           Hypothetical ORF [contig 183] FULL
          Length = 637

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 220 NPILNLENE-AQLDEIINGSSAIKSRQLRKLYRRACSNSYVIKNEDDNNIEFQKSKKL 276
           +P++N+ NE  + D+I         R   +L+R  C  SY+++ E DNN EF   + L
Sbjct: 116 HPLMNIINELPEKDKI-----KFAKRSEVELHRPKCRYSYLVEEESDNNEEFDMDRNL 168

>CAGL0D04774g Chr4 complement(467712..468680) [969 bp, 322 aa] {ON}
           similar to uniprot|Q06497 Saccharomyces cerevisiae
           YPR128c
          Length = 322

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 55/125 (44%), Gaps = 26/125 (20%)

Query: 68  NKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKIDSKKNSIILTWNKSS 127
           + +L+++I   Y E   DL +  K F+   + +L+  P I +     K  S+ILT    S
Sbjct: 154 DASLKAVIKQIYEESNGDLTAFWKGFK--VALVLSTNPAITYGSYQ-KLKSMILTAKGLS 210

Query: 128 NSKNMLRELLSHLNY-------------TQSLVPQK----------KDFQVIFKKIYQHY 164
            S+ +  +L +  N+             TQ L+  K          K FQ + + IYQ+ 
Sbjct: 211 GSQKISTQLSAGENFLLGMFSKMISTFVTQPLIVAKITLQGKGSKFKTFQEVLQHIYQNE 270

Query: 165 IFLSL 169
            FLSL
Sbjct: 271 GFLSL 275

>Kpol_332.1 s332 complement(1..12603) [12603 bp, 4201 aa] {ON}
           complement(1..12603) [12603 nt, 4201 aa]
          Length = 4201

 Score = 30.0 bits (66), Expect = 9.2,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%)

Query: 55  YEKAQASGQSKLSNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKIDS 114
           Y +   SG   L+  TL + + +TY+     +   + P   Q+ST LT W   Y S   +
Sbjct: 671 YSQGTVSGTQTLTYSTLTTKLGNTYYFSYQIIYFVILPLNPQFSTSLTEWHDDYVSTFST 730

Query: 115 KK 116
           +K
Sbjct: 731 QK 732

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,258,374
Number of extensions: 1366926
Number of successful extensions: 5206
Number of sequences better than 10.0: 51
Number of HSP's gapped: 5362
Number of HSP's successfully gapped: 53
Length of query: 281
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 173
Effective length of database: 41,097,471
Effective search space: 7109862483
Effective search space used: 7109862483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)