Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B020008.264ON43343322050.0
NCAS0B050308.264ON43343813700.0
ZYRO0C01606g8.264ON43245611261e-151
TDEL0F039108.264ON42941111101e-149
TPHA0A017908.264ON4394479701e-128
Kpol_543.408.264ON4144309551e-126
SAKL0H16984g8.264ON4354509491e-124
KLTH0G13640g8.264ON4144459071e-118
Ecym_43068.264ON4344398931e-116
Kwal_56.237828.264ON4144478691e-113
Smik_12.1498.264ON4604518681e-112
KNAG0G020508.264ON4324208551e-110
AGR084C8.264ON4274498431e-109
Suva_10.1748.264ON4564478271e-106
YLR090W (XDJ1)8.264ON4594318241e-105
Skud_12.1588.264ON4554268191e-105
KLLA0F19184g8.264ON5124548051e-102
CAGL0L12276g8.264ON4524587101e-88
KLLA0F03333g2.243ON4094384841e-55
KAFR0J009402.243ON4113764841e-55
CAGL0J09966g2.243ON4074434788e-55
TBLA0E038102.243ON4104464753e-54
NDAI0D010302.243ON4113764711e-53
Suva_14.2772.243ON4093764692e-53
Smik_14.2632.243ON4093774641e-52
KNAG0I019002.243ON4093754622e-52
Skud_14.2682.243ON4103774595e-52
YNL064C (YDJ1)2.243ON4093794571e-51
Kwal_23.48302.243ON4113754553e-51
TPHA0C031102.243ON4073764526e-51
Kpol_1003.122.243ON4084424526e-51
NCAS0G030002.243ON4104434492e-50
ADL257C2.243ON4103754465e-50
KLTH0G09394g2.243ON4113744465e-50
SAKL0E08734g2.243ON4113764432e-49
TDEL0C046002.243ON4113744395e-49
Ecym_32812.243ON4093744352e-48
ZYRO0A01496g2.243ON4123764343e-48
KLTH0G08756g2.218ON4623863857e-41
Kwal_23.30612.218ON4584383752e-39
SAKL0E09306g2.218ON4613853673e-38
Ecym_62368.730ON3743653457e-36
KAFR0A041608.730ON3783683371e-34
TDEL0C043502.218ON4623873366e-34
ZYRO0A06226g8.730ON3773683239e-33
TDEL0B037908.730ON3733643193e-32
SAKL0H05258g8.730ON3683643184e-32
AER427W2.218ON4703783154e-31
KNAG0M020202.218ON4603993102e-30
TPHA0G006308.730ON3933753054e-30
NDAI0E008708.730ON3763643001e-29
CAGL0F03729g8.730ON3613492894e-28
YMR214W (SCJ1)8.730ON3773712895e-28
Kwal_26.90248.730ON3753632887e-28
Kpol_1064.408.730ON3873822887e-28
Suva_13.3978.730ON3753692852e-27
Smik_13.4228.730ON3783682791e-26
KLLA0C07260g8.730ON3683632762e-26
KLTH0D12496g8.730ON3753832753e-26
NCAS0B005308.730ON3753802692e-25
Skud_13.3838.730ON3753672675e-25
AER346W8.730ON3673582631e-24
KNAG0G028808.730ON3783832604e-24
ZYRO0C15048g2.218ON4912542582e-23
Ecym_53842.218ON5033112573e-23
NCAS0G028502.218ON4942572475e-22
Kpol_1002.1222.218ON5032612423e-21
KLLA0E07899g2.218ON4953382389e-21
TBLA0B034908.730ON3843752332e-20
YNL077W (APJ1)2.218ON5282562263e-19
Suva_14.2622.218ON5362572183e-18
Smik_14.2492.218ON5332712167e-18
TBLA0E036602.218ON4483992131e-17
Skud_14.2532.218ON5322602122e-17
TBLA0C014801.398ON353681942e-15
NDAI0C026101.398ON340681913e-15
TPHA0C029802.218ON5542301917e-15
NDAI0F024502.218ON5302961918e-15
CAGL0J10296g2.218ON4792601882e-14
TPHA0D005508.61ON4862771872e-14
TPHA0B037601.398ON355681852e-14
KAFR0H031501.398ON359681852e-14
NDAI0G042501.398ON363681843e-14
AAL008W1.398ON349681833e-14
KLLA0D04818g1.398ON354681834e-14
CAGL0H03707g1.398ON349681791e-13
Kwal_0.2071.398ON353681782e-13
Suva_14.1162.15ON600641793e-13
Skud_14.1102.15ON596641793e-13
Kpol_457.151.398ON357681763e-13
KNAG0J018408.698ON650741784e-13
ZYRO0E04598g1.398ON357681754e-13
KLTH0H12100g1.398ON350681754e-13
YNL007C (SIS1)1.398ON352681745e-13
Smik_9.2037.157ON432701756e-13
KLTH0B08338g2.15ON590661766e-13
SAKL0D08778g1.398ON348681736e-13
YMR161W (HLJ1)2.350ON224691696e-13
YNL227C (JJJ1)2.15ON590641767e-13
TDEL0B059601.398ON369681729e-13
Smik_14.3211.398ON366681721e-12
TPHA0L007907.157ON446691731e-12
Skud_14.3201.398ON368681721e-12
KNAG0H016801.398ON363681711e-12
TDEL0H022907.217ON387691721e-12
Suva_14.3411.398ON359681711e-12
Skud_13.3232.350ON224691661e-12
Smik_14.1062.15ON593641731e-12
TBLA0J018707.157ON470671712e-12
Suva_13.3402.350ON225691652e-12
Kpol_529.212.15ON622661722e-12
Smik_13.3612.350ON224691652e-12
KNAG0F008602.15ON626641713e-12
Ecym_12921.398ON347681683e-12
KNAG0G011308.61ON500681693e-12
SAKL0E14234g2.15ON678661704e-12
Skud_9.1817.157ON421691684e-12
Ecym_43727.217ON579671685e-12
NDAI0F038002.15ON638661686e-12
NCAS0G013602.15ON616661687e-12
ZYRO0D10934g8.698ON663741687e-12
KAFR0A079502.15ON551641677e-12
TDEL0G028002.350ON225681608e-12
YIR004W (DJP1)7.157ON432691668e-12
NCAS0G036101.398ON327681648e-12
NDAI0A028207.157ON482671668e-12
ABL194C2.15ON552661661e-11
YOR254C (SEC63)8.698ON663741661e-11
NCAS0C048901.398ON367681631e-11
Skud_15.4208.698ON665741651e-11
CAGL0J01936g7.157ON425671641e-11
CAGL0J07370g2.15ON623641651e-11
Suva_9.2137.157ON431691632e-11
KLLA0D19602g2.15ON620681642e-11
NCAS0A132107.157ON414671622e-11
ZYRO0D16390g7.217ON398691622e-11
NCAS0E029307.217ON387671603e-11
KLTH0F09944g2.350ON233681563e-11
KNAG0I007407.157ON425681614e-11
KAFR0B047807.157ON423671604e-11
TDEL0H032107.157ON411691604e-11
Smik_6.638.61ON5103021614e-11
TDEL0A064308.698ON666741615e-11
Suva_8.3038.698ON664741615e-11
Kpol_1072.48.698ON661721605e-11
AFR507W8.61ON474681605e-11
ZYRO0F15400g2.15ON525641605e-11
NCAS0D009602.350ON224681545e-11
KLLA0D06402g1.297ON631681606e-11
TPHA0I011101.297ON666681606e-11
KAFR0H023108.698ON655741606e-11
Smik_15.4378.698ON663741606e-11
Ecym_56262.350ON243681548e-11
KNAG0I008602.350ON219701528e-11
TBLA0B093802.350ON227681538e-11
SAKL0E06050g2.350ON232691539e-11
TPHA0G014808.698ON660721599e-11
Kwal_23.3578singletonOFF85611439e-11
TBLA0E024907.217ON366691561e-10
CAGL0L00957g7.217ON373691561e-10
KAFR0L007407.217ON364691561e-10
NDAI0H031802.350ON229681521e-10
SAKL0F04444g7.157ON429671571e-10
TBLA0G001702.15ON659641571e-10
ZYRO0A07502g2.350ON238681521e-10
ADR015W7.157ON436671561e-10
KLLA0E01629g2.350ON231691511e-10
KLLA0D07656g8.61ON4713101561e-10
AFL190C2.350ON235681511e-10
Kwal_55.209657.157ON421671561e-10
TPHA0C045902.350ON233681512e-10
TPHA0C012607.217ON380691552e-10
Kwal_26.88798.698ON656741562e-10
Kwal_23.44202.15ON592661562e-10
TBLA0B037308.698ON693741562e-10
Kpol_526.62.350ON228691493e-10
CAGL0J02750g7.217ON382691533e-10
TDEL0E005002.15ON581641543e-10
ZYRO0F03652g8.61ON4624111534e-10
TBLA0A011007.157ON434691524e-10
SAKL0H05984g8.698ON658741534e-10
NCAS0C012208.698ON669721535e-10
CAGL0H04499g2.350ON232681476e-10
KLTH0A03740g7.217ON395691506e-10
YJL073W (JEM1)1.297ON645691517e-10
KLLA0C09823g8.698ON669721517e-10
KAFR0B048902.350ON220681457e-10
KAFR0A016201.297ON665681517e-10
Kpol_1070.227.217ON380671497e-10
Suva_6.1481.297ON642691518e-10
NDAI0E045607.217ON394691498e-10
TPHA0O019402.15ON598641518e-10
Ecym_44697.157ON433671491e-09
Skud_10.1691.297ON644691501e-09
TBLA0D042407.217ON389691481e-09
SAKL0D06226g1.297ON615691491e-09
KLTH0D11770g8.698ON652741491e-09
KLLA0E04423g7.217ON428671481e-09
KNAG0L013307.217ON396691472e-09
Suva_5.1507.217ON391691472e-09
Smik_10.1681.297ON649691482e-09
KLTH0F13398g7.157ON419671472e-09
Kpol_499.307.157ON408691462e-09
Suva_12.1851.113ON168641383e-09
CAGL0G07469g8.698ON668741463e-09
Skud_5.1587.217ON391691443e-09
Smik_5.1737.217ON391691443e-09
SAKL0F08052g7.217ON393671444e-09
YER048C (CAJ1)7.217ON391691434e-09
TBLA0C027201.297ON715691455e-09
Kpol_1027.131.297ON641681445e-09
KNAG0B052401.297ON668681436e-09
KLLA0D13464g7.157ON433671401e-08
ZYRO0G03850g7.157ON418691401e-08
Kwal_47.181337.217ON393691391e-08
Ecym_23748.698ON661741411e-08
Kwal_14.24521.297ON607681402e-08
KLTH0H10032g1.297ON607681402e-08
NDAI0G032808.61ON5521091382e-08
KAFR0C031608.61ON4982091383e-08
SAKL0H00858g5.4ON432701373e-08
CAGL0H02827g1.297ON656671374e-08
NCAS0I028301.185ON491641364e-08
NCAS0A093201.297ON635691374e-08
TDEL0D016401.297ON604681374e-08
AAL103W8.698ON669721374e-08
SAKL0B02068g8.61ON5102001365e-08
YJL162C (JJJ2)1.185ON583641365e-08
KLTH0A02882g8.61ON4732251355e-08
CAGL0J04224g8.61ON5222291355e-08
ADR124C1.297ON611691366e-08
ZYRO0G21230g1.297ON584691357e-08
TBLA0A055601.92ON312701337e-08
NCAS0C039508.61ON519731348e-08
Suva_6.448.61ON5072721331e-07
SAKL0C02904g1.92ON281741301e-07
Kwal_33.138601.185ON578641331e-07
KAFR0C024507.217ON373671302e-07
SAKL0B01276gna 1ON292571282e-07
KNAG0B018901.92ON370721292e-07
Kwal_47.179578.61ON478731302e-07
KNAG0E012205.4ON434701293e-07
Skud_10.3191.113ON168641223e-07
TDEL0C008708.61ON470731293e-07
YGR285C (ZUO1)5.4ON433701284e-07
Kwal_26.94955.4ON428701284e-07
TPHA0A028101.185ON492651284e-07
TDEL0C036801.185ON556641284e-07
SAKL0C05456g1.185ON583641285e-07
TBLA0C071605.4ON430701275e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B02000
         (433 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    853   0.0  
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    532   0.0  
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   438   e-151
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   432   e-149
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   378   e-128
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   372   e-126
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   370   e-124
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   353   e-118
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   348   e-116
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   339   e-113
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   338   e-112
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   333   e-110
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   329   e-109
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   323   e-106
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   322   e-105
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   320   e-105
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   314   e-102
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   278   1e-88
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   191   1e-55
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   191   1e-55
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   188   8e-55
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   187   3e-54
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   186   1e-53
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   185   2e-53
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   183   1e-52
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   182   2e-52
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   181   5e-52
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   180   1e-51
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   179   3e-51
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   178   6e-51
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   178   6e-51
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   177   2e-50
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   176   5e-50
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   176   5e-50
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   175   2e-49
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   173   5e-49
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   172   2e-48
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   171   3e-48
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   152   7e-41
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   149   2e-39
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   145   3e-38
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   137   7e-36
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   134   1e-34
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   134   6e-34
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...   129   9e-33
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...   127   3e-32
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...   127   4e-32
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   125   4e-31
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   124   2e-30
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...   122   4e-30
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...   120   1e-29
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...   115   4e-28
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...   115   5e-28
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...   115   7e-28
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....   115   7e-28
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...   114   2e-27
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...   112   1e-26
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   110   2e-26
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...   110   3e-26
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730      108   2e-25
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...   107   5e-25
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...   105   1e-24
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...   104   4e-24
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...   103   2e-23
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...   103   3e-23
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218    100   5e-22
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...    98   3e-21
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...    96   9e-21
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    94   2e-20
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    92   3e-19
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    89   3e-18
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    88   7e-18
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    87   1e-17
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...    86   2e-17
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    79   2e-15
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               78   3e-15
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    78   7e-15
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    78   8e-15
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...    77   2e-14
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    77   2e-14
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    76   2e-14
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    76   2e-14
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    75   3e-14
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    75   3e-14
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    75   4e-14
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    74   1e-13
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    73   2e-13
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    74   3e-13
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    74   3e-13
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    72   3e-13
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    73   4e-13
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    72   4e-13
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    72   4e-13
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    72   5e-13
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    72   6e-13
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    72   6e-13
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    71   6e-13
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    70   6e-13
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    72   7e-13
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    71   9e-13
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    71   1e-12
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    71   1e-12
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    71   1e-12
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    70   1e-12
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    71   1e-12
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    70   1e-12
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    69   1e-12
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    71   1e-12
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    70   2e-12
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    68   2e-12
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    71   2e-12
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    68   2e-12
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    70   3e-12
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    69   3e-12
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    70   3e-12
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    70   4e-12
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    69   4e-12
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    69   5e-12
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      69   6e-12
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    69   7e-12
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    69   7e-12
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    69   7e-12
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    66   8e-12
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    69   8e-12
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      68   8e-12
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    69   8e-12
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    69   1e-11
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    69   1e-11
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     67   1e-11
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    68   1e-11
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    68   1e-11
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    68   1e-11
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    67   2e-11
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    68   2e-11
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    67   2e-11
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    67   2e-11
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     66   3e-11
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    65   3e-11
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    67   4e-11
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               66   4e-11
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    66   4e-11
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    67   4e-11
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    67   5e-11
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    67   5e-11
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    66   5e-11
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    66   5e-11
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    66   5e-11
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    64   5e-11
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    66   6e-11
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    66   6e-11
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    66   6e-11
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    66   6e-11
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    64   8e-11
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    63   8e-11
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    64   8e-11
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    64   9e-11
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    66   9e-11
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    60   9e-11
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    65   1e-10
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    65   1e-10
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    65   1e-10
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      63   1e-10
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    65   1e-10
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    65   1e-10
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    63   1e-10
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    65   1e-10
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    63   1e-10
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    65   1e-10
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    63   1e-10
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    65   1e-10
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    63   2e-10
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    64   2e-10
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    65   2e-10
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    65   2e-10
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    65   2e-10
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    62   3e-10
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    64   3e-10
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    64   3e-10
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    64   4e-10
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    63   4e-10
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    64   4e-10
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     64   5e-10
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    61   6e-10
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    62   6e-10
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    63   7e-10
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    63   7e-10
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    60   7e-10
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    63   7e-10
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    62   7e-10
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    63   8e-10
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             62   8e-10
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    63   8e-10
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    62   1e-09
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    62   1e-09
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    62   1e-09
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    62   1e-09
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    62   1e-09
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    62   1e-09
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    61   2e-09
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    61   2e-09
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    62   2e-09
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    61   2e-09
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    61   2e-09
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    58   3e-09
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    61   3e-09
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    60   3e-09
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    60   3e-09
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    60   4e-09
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    60   4e-09
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    60   5e-09
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    60   5e-09
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    60   6e-09
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    59   1e-08
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    59   1e-08
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    58   1e-08
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    59   1e-08
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    59   2e-08
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    59   2e-08
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    58   2e-08
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    58   3e-08
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    57   3e-08
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    57   4e-08
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    57   4e-08
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    57   4e-08
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    57   4e-08
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    57   4e-08
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    57   5e-08
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    57   5e-08
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    57   5e-08
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    57   5e-08
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    57   6e-08
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    57   7e-08
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    56   7e-08
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    56   8e-08
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    56   1e-07
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    55   1e-07
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    56   1e-07
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    55   2e-07
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    54   2e-07
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    54   2e-07
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    55   2e-07
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    54   3e-07
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    52   3e-07
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    54   3e-07
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    54   4e-07
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    54   4e-07
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    54   4e-07
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    54   4e-07
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    54   5e-07
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    54   5e-07
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    54   6e-07
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    54   7e-07
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    53   7e-07
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    53   7e-07
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    53   8e-07
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    53   8e-07
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    53   9e-07
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    50   9e-07
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    53   9e-07
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    53   9e-07
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    50   1e-06
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    53   1e-06
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    52   1e-06
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    52   1e-06
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    52   1e-06
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    52   1e-06
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    52   1e-06
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    52   1e-06
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    52   2e-06
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    52   2e-06
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    52   2e-06
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    52   2e-06
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    52   2e-06
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    50   2e-06
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    52   2e-06
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    51   2e-06
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    50   2e-06
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    50   3e-06
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    49   3e-06
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    50   3e-06
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    51   4e-06
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    51   4e-06
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    51   4e-06
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    50   5e-06
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    51   5e-06
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    51   5e-06
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    49   5e-06
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    49   6e-06
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    48   7e-06
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    49   7e-06
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    50   7e-06
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    50   9e-06
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    47   1e-05
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    48   1e-05
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         49   1e-05
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    49   1e-05
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    49   2e-05
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    49   2e-05
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       49   3e-05
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    46   3e-05
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    45   5e-05
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    44   1e-04
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    44   1e-04
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    44   2e-04
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    45   2e-04
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    44   2e-04
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    44   2e-04
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    45   3e-04
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    45   3e-04
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    44   3e-04
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    43   3e-04
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    44   3e-04
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    44   3e-04
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    44   5e-04
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    44   5e-04
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    42   6e-04
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    43   0.001
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    42   0.001
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    42   0.002
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    41   0.003
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    41   0.003
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    41   0.004
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    40   0.006
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    40   0.008
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    40   0.010
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    39   0.013
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    39   0.021
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    37   0.024
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    39   0.024
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    38   0.026
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    38   0.041
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    37   0.050
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    37   0.055
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    37   0.057
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    37   0.088
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    36   0.10 
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    36   0.13 
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    36   0.14 
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    36   0.14 
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...    36   0.17 
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    36   0.18 
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    35   0.21 
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    35   0.25 
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    35   0.28 
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    35   0.28 
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    35   0.32 
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    35   0.37 
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    35   0.38 
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    34   0.44 
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    34   0.48 
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    34   0.48 
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    34   0.53 
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    33   0.90 
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    33   1.0  
Kpol_478.10 s478 complement(46401..47603) [1203 bp, 400 aa] {ON}...    33   1.3  
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    32   1.9  
Suva_12.16 Chr12 (21243..22130) [888 bp, 295 aa] {ON} YFR041C (R...    32   1.9  
Kwal_33.13451 s33 complement(229605..230468) [864 bp, 287 aa] {O...    32   2.2  
Kpol_1028.19 s1028 (53068..53628) [561 bp, 186 aa] {ON} (53068.....    32   2.3  
TPHA0N01720 Chr14 complement(367614..369305) [1692 bp, 563 aa] {...    32   2.4  
KAFR0A02900 Chr1 complement(602619..603515) [897 bp, 298 aa] {ON...    32   2.5  
KAFR0F03210 Chr6 complement(634603..635160) [558 bp, 185 aa] {ON...    31   3.2  
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    32   3.2  
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    31   5.7  
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    30   5.7  
Kpol_1025.42 s1025 (112594..113172) [579 bp, 192 aa] {ON} (11259...    30   6.6  
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    31   7.1  
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    30   7.4  
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    30   7.9  
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...    31   8.1  
TPHA0A03760 Chr1 (821355..824855) [3501 bp, 1166 aa] {ON} Anc_3....    31   8.4  
NCAS0A01690 Chr1 (330511..331077) [567 bp, 188 aa] {ON} Anc_4.10...    30   9.9  

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/433 (96%), Positives = 416/433 (96%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60
           MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD
Sbjct: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60

Query: 61  EEKRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDNDKSKDVKIPLKLSIQEL 120
           EEKRAHYDLYGDA                 TDQPDYDSYAFDNDKSKDVKIPLKLSIQEL
Sbjct: 61  EEKRAHYDLYGDANENEYNNQNANDFFNFETDQPDYDSYAFDNDKSKDVKIPLKLSIQEL 120

Query: 121 YNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRMLIPGFV 180
           YNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRMLIPGFV
Sbjct: 121 YNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRMLIPGFV 180

Query: 181 TTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDTIRIEN 240
           TTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDTIRIEN
Sbjct: 181 TTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDTIRIEN 240

Query: 241 EADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDKFLSKS 300
           EADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDKFLSKS
Sbjct: 241 EADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDKFLSKS 300

Query: 301 LDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWFSEKSD 360
           LDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWFSEKSD
Sbjct: 301 LDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWFSEKSD 360

Query: 361 IQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILEELPDTLNESNNRSAYDTGDQSDA 420
           IQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILEELPDTLNESNNRSAYDTGDQSDA
Sbjct: 361 IQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILEELPDTLNESNNRSAYDTGDQSDA 420

Query: 421 NYDREGPPQCSQQ 433
           NYDREGPPQCSQQ
Sbjct: 421 NYDREGPPQCSQQ 433

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/438 (59%), Positives = 329/438 (75%), Gaps = 10/438 (2%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPN--DREENEIKFKEITSAYEIL 58
           M DLY++LGV S+ATDS+IKKAYRKLALQ+HPDKV++ N  DRE +EIKFKEI++AYEIL
Sbjct: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60

Query: 59  SDEEKRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYD--SYAFDNDKSKDVKIPLKLS 116
           SDE+KRAHYDLYG                     + D +   +  D  +S DVKIPLK++
Sbjct: 61  SDEDKRAHYDLYGSEEEQQRQQRQYDPFESFFNFEQDEEPSRHYEDPKRSPDVKIPLKMT 120

Query: 117 IQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRMLI 176
           IQELYNGKTFKF+ KRN+IC  CEGLGWRRRKNG VT+P E+ECK C G G+ E+ RML 
Sbjct: 121 IQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLA 180

Query: 177 PGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDTI 236
           PGF T +K +C+ C GKG+ YAK NSEKNKCK CHG+GL +E+K L VSVPRGL++ DTI
Sbjct: 181 PGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTI 240

Query: 237 RIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDKF 296
           ++ NEADQE+GK KTGD+I  IEED   P DV   RKG++F+  L++SLAEALTGFKDKF
Sbjct: 241 KVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKDKF 300

Query: 297 LSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWFS 356
           ++K+ DGRIL LS+P GKVIRPGNIIKI+QEGWP+N +A+KFGDLY+ + IEFPPDNWF+
Sbjct: 301 VTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPPDNWFT 360

Query: 357 EKSDIQLLRNVLPSGINGMMNSWKI-DDPLNTETVTTFDILEELPDTLNESNNRSAYDTG 415
           EKSD+  ++N+LP   +   +  K+ DDPLNTE +  F++LE LPDTL E  ++   +  
Sbjct: 361 EKSDLTQIKNILPRSTS---DKTKLSDDPLNTELLLKFEVLETLPDTLKEGQDQG--ENN 415

Query: 416 DQSDANYDREGPPQCSQQ 433
            +S   Y  EG PQC+QQ
Sbjct: 416 AESHGEYRGEGSPQCAQQ 433

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  438 bits (1126), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 225/456 (49%), Positives = 296/456 (64%), Gaps = 52/456 (11%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY  LGV+  AT  EIKKAYRKLALQ+HPDKV D + REE+E++FKEIT+AYE+LSDEEK
Sbjct: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN-------------------- 103
           R+ YD YGD                   D PD++  +F N                    
Sbjct: 63  RSKYDTYGDT-----------------ADGPDFEDESFMNFFTQFNSGFGFNGGGGGGFP 105

Query: 104 ------DKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHE 157
                 D+S DV++PLK+S+ + YNGK FKFQSKR I+C +CEG GWRRR  G    P +
Sbjct: 106 GAQPGDDRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWRRRSGGP---PPQ 162

Query: 158 IECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLS 217
             CK C G GYKE+ R + PG V    + C  CHGKG+  +KP SEKN+CK C G+G++ 
Sbjct: 163 TNCKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIE 222

Query: 218 ENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDF 277
           E K L VS+PRG ++ D I  E EADQE+GKSKTGD+I +++E T  P  V   R+G D 
Sbjct: 223 EAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDL 282

Query: 278 VMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASK 337
           +  +S+SLAEA+TG  D+ L+K+LDGR+L LS P+GKVI PG IIK++QEGWP+N  A+K
Sbjct: 283 ITNISISLAEAITGL-DRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATK 341

Query: 338 FGDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILE 397
           FGDLYV++ I FP DNWF+EKSD+  +RN+LPS      N  K  DP NTE V+   +++
Sbjct: 342 FGDLYVLVDIVFPRDNWFAEKSDLLKIRNILPS--EAANNDVKA-DPGNTEQVSDMKLVD 398

Query: 398 ELPDTLNESNNRSAYDTGDQSDANYDREGPPQCSQQ 433
           +LPD +  + ++ A++ G  S A  D +G PQC+QQ
Sbjct: 399 QLPDYMGSNGDQYAHE-GHASGAFPD-DGTPQCAQQ 432

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  432 bits (1110), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 219/411 (53%), Positives = 281/411 (68%), Gaps = 16/411 (3%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60
           M+ LY ILGV   AT  EIKKAYRK ALQ+HPDKV D + REE+E++FKEI +AYE+L D
Sbjct: 1   MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGD 60

Query: 61  EEKRAHYDLYGDAXXXXXXXXXXXXXXXXXTD---------QPDYDSYAFDN-DKSKDVK 110
           EEKRA YD YGDA                  +         Q  YD Y     D+S DV+
Sbjct: 61  EEKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADVQ 120

Query: 111 IPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKE 170
           +PL +S+ + YNGK+FKFQSKR ++C +C G GWRRR N +V  P ++ECKKC G G+K+
Sbjct: 121 VPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRR-NDHVVPPPQVECKKCGGQGFKQ 179

Query: 171 RTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGL 230
           R R L PGF TT+ I C  C GKG+  +KPN++KNKCK C G G+ +E+K L VS+PRG 
Sbjct: 180 RIRRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVSLPRGS 239

Query: 231 QNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALT 290
           +  D I ++ EADQE+GKS+TG+++  I+E T  P  V   R G D + +L+LSLAEA+T
Sbjct: 240 RQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAIT 299

Query: 291 GFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFP 350
           GF  K L+K+LDGRIL L +P GKVIRPGNII+I  EGWP++   S  GDLYV++ IEFP
Sbjct: 300 GFS-KTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS--GDLYVVVHIEFP 356

Query: 351 PDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILEELPD 401
           PDNWFSE+SD+  ++NVLP   N   N+   DDP NTETVT  +I+EE+PD
Sbjct: 357 PDNWFSERSDLTQVKNVLPGETNN--NAAVEDDPGNTETVTNINIVEEIPD 405

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  378 bits (970), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 206/447 (46%), Positives = 285/447 (63%), Gaps = 34/447 (7%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDRE-----ENEIKFKEITSAYEI 57
           DLY+IL V  + T  E+KK YRKLAL+YHPDKV   +  E     E E+KFKEI SAYEI
Sbjct: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70

Query: 58  LSDEEKRAHYDL---YGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDNDKSKDVKIPLK 114
           LSDEEKR  YDL   + DA                 +D  D  + AF N  SKD+ IPLK
Sbjct: 71  LSDEEKRKQYDLQKNFRDANQG--------------SDYGDGINTAFGNQTSKDISIPLK 116

Query: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174
           ++I++LYNGK  ++  KRN+IC +C GLGWR RKNG   +P   ECK C+G GYK+  + 
Sbjct: 117 VTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQ 176

Query: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234
           + PGF T   + C++C GKG  Y KP S KN C  C+GKG++  ++ + V++PRG  +KD
Sbjct: 177 IAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKD 236

Query: 235 TIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKG-TDFVMYLSLSLAEALTGFK 293
           TI I+N+ADQE+GK KTGD+I V+EE           R G  D +  L++SLA+A+TGFK
Sbjct: 237 TIIIDNKADQELGKFKTGDLIFVLEE--IDDEQTALKRYGDKDLITELTISLADAITGFK 294

Query: 294 DKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDN 353
           +K + K+LDGR+L LS+P GKVIR G+I+K++ EGWP+N  A++ GDLY+   IEFP DN
Sbjct: 295 EKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPADN 354

Query: 354 WFSEKSDIQLLRNVLPSGING---MMNSWKIDD----PLNTETVTTFDILEELPDTLNES 406
           W SE +DI  +RN+LP+  +    ++     DD     +N+E ++ +D +++LPD ++ S
Sbjct: 355 WNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKDLPDIIDTS 414

Query: 407 NNRSAYDTGDQSDANYDREGPPQCSQQ 433
           +N  A    +   AN+     P+CSQQ
Sbjct: 415 HNNGAEYGHNGDSANFTE--MPECSQQ 439

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  372 bits (955), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 197/430 (45%), Positives = 263/430 (61%), Gaps = 28/430 (6%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y ILGV   AT  EIKK YRKLALQYHPDK +D   +  NEIKFK+IT+AY+ LSDE+
Sbjct: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDED 71

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDNDKSKDVKIPLKLSIQELYN 122
           KR  YD                       +  D +  +    +SKD+K+ L L   ELYN
Sbjct: 72  KRNEYD---------NKKNFEPYFESDFANNHDGNYNSRYRSRSKDIKVELSLKTSELYN 122

Query: 123 GKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRMLIPGFVTT 182
           GKT KF + RN IC  C GLGWR +K+G   +P EIEC+KCNG GYK     L PGF TT
Sbjct: 123 GKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTT 182

Query: 183 DKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDTIRIENEA 242
             + C  C G G+ Y KPNS KN CK+C+GK L+  +  ++VS+PRG  N D I ++ EA
Sbjct: 183 QNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEA 242

Query: 243 DQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLD 302
           D+E+GK   GD+I  I E     +D+   R G   + +  +SLAEA+TGF++KF+ K+ D
Sbjct: 243 DEELGKKNAGDLIFEINEIIDSNNDLE--RYGNHLINHTHISLAEAITGFENKFIVKTFD 300

Query: 303 GRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWFSEKSDIQ 362
            R L LS P GKVIRPG+I+++K EGWP++   + FG+LYVI++IEFPPDNW +EK+DI 
Sbjct: 301 DRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINEKNDII 360

Query: 363 LLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILEELPDTLNESNNRSAYDTGDQSDANY 422
            +RN+LP   N       I DP+N+E ++TF+I++ LP    E   ++ +DT        
Sbjct: 361 KIRNILP---NEKTKRNNIVDPINSEYISTFEIVKSLPQE--EGEEQTEHDTN------- 408

Query: 423 DREGPPQCSQ 432
                P C+Q
Sbjct: 409 -----PSCAQ 413

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  370 bits (949), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 202/450 (44%), Positives = 281/450 (62%), Gaps = 32/450 (7%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60
           M  LY +LGV   A+ +EIKKAYRKLALQ+HPDKV D   REE+E+KFKEIT+AYEILSD
Sbjct: 1   MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSD 60

Query: 61  EEKRAHYDLYGDAXXXXXXXXXXXXXXXXXT------------DQPD--YDSYAFDNDKS 106
           E+ R  YD+YGD                               D+P   Y      + ++
Sbjct: 61  EDSRKKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDEPRQPYPEEENRSVRT 120

Query: 107 KDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGL 166
            D +IPLKLS++ELYNGKTFKF+SKRN++C +C+G G R++   +   P  + C+ C G 
Sbjct: 121 SDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKP--VVCQSCEGH 178

Query: 167 GYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSV 226
           G+KER + +  GFV  + ++CE C+GKG     P   ++ CK CHGK ++SE K L V +
Sbjct: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRT--TPTKPEDHCKKCHGKCVISEEKTLTVYI 236

Query: 227 PRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLA 286
           PRG +N D +++E EADQE  K  TGD++ VIEE+    +++   R+G D    L +SL+
Sbjct: 237 PRGSRNGDIVKLEGEADQEPDKV-TGDLLFVIEENPETSTNLE--RRGDDLHTRLKISLS 293

Query: 287 EALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIK 346
           EA+TGF +K ++ +LD RIL L +P GKVIRPGN I+++ EGWP++   +KFGD+YV + 
Sbjct: 294 EAITGF-EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVH 352

Query: 347 IEFPPDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDIL---EELPDTL 403
           IEFPPDNWFSEKSD+++LR +LP   N  +      D  NTETV  + ++   +ELPD L
Sbjct: 353 IEFPPDNWFSEKSDVEVLRTLLPEVPNARVAD--TGDLNNTETVIDYSVVKSADELPDYL 410

Query: 404 NESNNRSAYDTGDQSDANYDREGPPQCSQQ 433
             S  +  Y   +Q    ++    PQC+QQ
Sbjct: 411 --SYEKGEYQGQEQEYGAFEE---PQCAQQ 435

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  353 bits (907), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 192/445 (43%), Positives = 271/445 (60%), Gaps = 46/445 (10%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y  LGV   AT  EIKKAYR+LALQ+HPDKV D + R+E+EIKFKE+ +AYE+LS+EE
Sbjct: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61

Query: 63  KRAHYDLYGD--------AXXXXXXXXXXXXXXXXXTDQPDYDSYAFDNDKSKDVKIPLK 114
           KR +YD YGD        +                   Q +Y++ +  + ++ D  +P++
Sbjct: 62  KRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDDAHVPIR 121

Query: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174
           L++QELYNGKT +FQ+KRN++C +CEG G RRR        H   C +C G G K+R R 
Sbjct: 122 LTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRAR------HASACSQCEGHGVKQRLRR 175

Query: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234
           L PGFVT + ++C+ C G G    K    ++ CK CHGK +  E+K L V +PRG ++ D
Sbjct: 176 LGPGFVTREIVQCDKCKGLG----KNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGD 231

Query: 235 TIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKD 294
            + ++ EAD+E GK   GD++  I E++   S     R+G+D    +++SL++ALTGF +
Sbjct: 232 RVVLKGEADEEPGKI-PGDLVFDIAENSASSS---LERRGSDLYAKITISLSDALTGF-E 286

Query: 295 KFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNW 354
           K +  +LDGR+L L VP G+V+RPGN ++I  EGWP++ Q SKFGD+YV I IEFPPD+W
Sbjct: 287 KEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHW 346

Query: 355 FSEKSDIQLLRNVLPSGINGMMNS---WKIDDPLNTETVTTFDIL---EELPDTLNESNN 408
           FSE+SD++ L+N+LP  ++    S       DP NTET   F I+   EELP  L+E + 
Sbjct: 347 FSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEES- 405

Query: 409 RSAYDTGDQSDANYDREGPPQCSQQ 433
                           E  PQC+QQ
Sbjct: 406 ----------------EPGPQCAQQ 414

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  348 bits (893), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 190/439 (43%), Positives = 282/439 (64%), Gaps = 33/439 (7%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           DLYS+LG+ S+AT+ E+K+AYR LAL YHPDK+ D + R E+E KFKEI++AY+ILSDE+
Sbjct: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63

Query: 63  KRAHYDLYG--------------DAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDNDKSKD 108
           KR+ YD YG              D                    Q + D+    + K+KD
Sbjct: 64  KRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYE-DAEQKTSQKTKD 122

Query: 109 VKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGY 168
             +PLKLS ++LY GKTF+F+ KRN++C +CEGLG R+R      +P  ++C  C+G G+
Sbjct: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKR--AAHCMP--MKCGICDGRGF 178

Query: 169 KERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPR 228
           KER   + PGF++ +++ C++C GKG V ++  S+   CK CHGK ++ EN  L + VPR
Sbjct: 179 KERVSRISPGFISRERVPCDECDGKGTVVSRDPSD--NCKKCHGKCVIVENSILTLYVPR 236

Query: 229 GLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEA 288
           G ++ DTIRI+ +AD E GK +TGD++  I+E T    D    RKGTD    +++SLAEA
Sbjct: 237 GHRHADTIRIDGQADMEAGK-ETGDLVFEIDEITD--PDAELERKGTDLHCSITISLAEA 293

Query: 289 LTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIE 348
           LTGF  + ++++ D R+L +++PSGKV+RPGN +K   EGWP+N   S+FGDLYV + IE
Sbjct: 294 LTGFT-RLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPIN-NGSRFGDLYVKVNIE 351

Query: 349 FPPDNWFSEKSDIQLLRNVLPSGINGMMNSWK--IDDPLNTETVTTFDILEE---LPDTL 403
           FP DNW +EKS+++ ++++LP G+    NS +   DDP NTE + ++ ++++   LPD L
Sbjct: 352 FPKDNWLNEKSELEAIKHILP-GLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYL 410

Query: 404 -NESNNRSAYDTGDQSDAN 421
             E   RS    G+++ A+
Sbjct: 411 AQEGQQRSNQQYGERNTAS 429

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  339 bits (869), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/447 (43%), Positives = 268/447 (59%), Gaps = 50/447 (11%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y  LGV   AT  EIKKAYR+LALQ+HPDKV D + REE+EIKFKE+ +AYE+LS+EE
Sbjct: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61

Query: 63  KRAHYDLYGDAXXXXX----------XXXXXXXXXXXXTDQPDYDSYAFDNDKSKDVKIP 112
           KR +YD YGD                             D+ D+ ++A    ++ D  + 
Sbjct: 62  KRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHA--RPRTDDAHVS 119

Query: 113 LKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERT 172
           L+L++Q+LYNGKT +FQS RN++C +CEG G R+R        H   C  C G G K+R 
Sbjct: 120 LRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRAR------HASACTHCEGHGVKQRL 173

Query: 173 RMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQN 232
           R L PGFVT + ++C  C G G    K    ++ CK CHGK +  E K L V +PRG ++
Sbjct: 174 RRLGPGFVTRETVQCTKCRGLG----KNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRH 229

Query: 233 KDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGF 292
            D I +E EAD+E GK  TGD++  I ED+T  +     R+G+D    + +SL++ALTGF
Sbjct: 230 NDRIVLEGEADEEPGKL-TGDLVFDISEDSTTSN---LERRGSDLHTKIIISLSDALTGF 285

Query: 293 KDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPD 352
            +K +  +LDGR L L +P+G+VIRPGN I +K EGWP++ +  KFG++YV I IEFPPD
Sbjct: 286 -EKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPD 344

Query: 353 NWFSEKSDIQLLRNVLPSGINGMMNSWKID---DPLNTETVTTFDIL---EELPDTLNES 406
           +W+SE+ +I+ LRN++P   +    S       DP+NTE + TFDIL   EELP+ L + 
Sbjct: 345 HWYSERGEIEALRNIIPQSTSSSAASSSASAEPDPVNTE-MPTFDILKSAEELPNYLPD- 402

Query: 407 NNRSAYDTGDQSDANYDREGPPQCSQQ 433
                       DA    +G PQCSQQ
Sbjct: 403 ------------DAE---QGGPQCSQQ 414

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  338 bits (868), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/451 (42%), Positives = 273/451 (60%), Gaps = 36/451 (7%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY +LGVTS A+  EIK AYRKLAL++HPDK +D N +E NEIKFKEIT+AYEILSD EK
Sbjct: 10  LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69

Query: 64  RAHYDLYGDAXXXXXXXXX---------------XXXXXXXXTDQP-DYDSYAFDNDKS- 106
           ++HYDLYGD                                  D P +YD+Y  D  KS 
Sbjct: 70  KSHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPREYDTYEEDKCKSS 129

Query: 107 KDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGL 166
           KD+ I + L++++LY GK  KF+ KR I+C+ C G GW+ +K  +VT  HE+EC+ C G 
Sbjct: 130 KDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVT--HEVECESCGGK 187

Query: 167 GYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSV 226
           G KER +   PG V +  + CE CHGKG+   +P + KN C +C G GL S+ + + V+V
Sbjct: 188 GSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNV 247

Query: 227 PRGLQNKDTIRIENEADQEIGKSKTGDI-ILVIEEDTTMPSDVHFIR-----KGTDFVMY 280
             G    D I I+  AD+E+ KS  GD+   ++E+   +     F++        D    
Sbjct: 248 APGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTS 307

Query: 281 LSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV--NPQASKF 338
            ++SL+EALTGF +KFL+++ D R+LTLS+  G+VIRPG++IKI  EGWP+  +P+  + 
Sbjct: 308 ATISLSEALTGF-EKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMDDPRGQR- 365

Query: 339 GDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPSG----INGMMNSWKID-DPLNTETVTTF 393
           GDLYV I IEFPPDNWF+EKS++  ++ +LPS          N+ + D +P+N ET++ F
Sbjct: 366 GDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISNF 425

Query: 394 DI--LEELPDTLNESNNRSAYDTGDQSDANY 422
            I  +EELP+ +   N+ S      ++ ++Y
Sbjct: 426 QIINMEELPEGMKIFNSESQNSAHQKAKSSY 456

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  333 bits (855), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 176/420 (41%), Positives = 257/420 (61%), Gaps = 11/420 (2%)

Query: 1   MADL--YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEIL 58
           MA L  Y ILGV   +TD EI+KAYRKLAL++HPDKV+DP ++  NE+KFKEIT+AYEIL
Sbjct: 1   MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60

Query: 59  SD--EEKRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDNDKSKD--VKIPLK 114
           S+    +    +  G                      P    +    D+S +   +I ++
Sbjct: 61  SNGEYVEEMEEEYEGQGYGFNFGDDFMNFFNEGRNAHP-MGGHPQREDESTNEATQIEIE 119

Query: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174
           +++++LYNGK  KFQ  RN+IC  C+G  WRRRKNG++  P  + C KC G GY ER   
Sbjct: 120 VTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVG 179

Query: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234
             P F    +I C  C GKGE  AKP S+KNKCK CHG+GL+ E +QLLV++PRG +N +
Sbjct: 180 DSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSN 239

Query: 235 TIRIENEADQEIGKSKTGDIILVI---EEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTG 291
           TI  + + D+++   + GDI+  +   +E      D+   ++GTD  M + + L EA++G
Sbjct: 240 TIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISG 299

Query: 292 FKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPP 351
            + +FL+K+ D R+L L++P GKV+RPG+ I IK EGWP  P  ++FGD++V + +EFPP
Sbjct: 300 TQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPP 359

Query: 352 DNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILEELPDTLNESNNRSA 411
           DNW SE++DI  L NVLP+G +   ++ +  D  N E V  ++IL+   +    SN ++A
Sbjct: 360 DNWISERNDITTLTNVLPAGKSDDGHA-QTGDANNAEFVKDYEILKATDEGTRSSNTKTA 418

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  329 bits (843), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 175/449 (38%), Positives = 265/449 (59%), Gaps = 43/449 (9%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           DLY +LG+ SSA++ E+K+AYR+LAL+YHPDK+ D ++RE +E KFKEI++AY +LSDE+
Sbjct: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63

Query: 63  KRAHYDLYGDAXXXXXXX-------------XXXXXXXXXXTDQPDYDSYAFDNDKSKDV 109
           KRA YD +G                                 ++ D++       ++ D 
Sbjct: 64  KRAEYDQFGTVDGGYGHDEFGHGDDDFMNFFRYGAGRHGYQHEEDDFEEVG----RTADS 119

Query: 110 KIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYK 169
            +PLKL+ ++LY GKTF+F+++R ++C +C G G R+R      I     C+ C G GYK
Sbjct: 120 TVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMI----RCEGCEGQGYK 175

Query: 170 ERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRG 229
           ER   + PG ++ +++ C DC GKG+    P +  + CK C GK ++ E   + V VPRG
Sbjct: 176 ERISRIGPGLISRERVSCADCGGKGKRI--PTTAADNCKKCTGKCVVQEESIISVYVPRG 233

Query: 230 LQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEAL 289
            Q+ D +R   ++D E GK +TGD++ VI+E T + S +   RKGTD    + +SLAEAL
Sbjct: 234 SQHGDRLRYPGQSDMEPGK-ETGDLVFVIDEQTDVSSSLE--RKGTDLYCTMKISLAEAL 290

Query: 290 TGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEF 349
           TGF  + ++++ D R+L +++P GKV+RPGN +K   EGWP+    ++FGD+YV + IEF
Sbjct: 291 TGFT-RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIE-DGARFGDMYVQVLIEF 348

Query: 350 PPDNWFSEKSDIQLLRNVLPSGINGMMN--SWKIDDPLNTETVTTFDILEE---LPDTLN 404
           P DNWF+EK+++  +RN+LP    G+ +  S K +DP NTE V  + I+     LPD L+
Sbjct: 349 PKDNWFNEKAELDAIRNILP----GLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYLD 404

Query: 405 ESNNRSAYDTGDQSDANYDREGPPQCSQQ 433
             N       G     +    G P+C  Q
Sbjct: 405 RENQ------GYSRQQHESTAGTPECPMQ 427

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  323 bits (827), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 182/447 (40%), Positives = 268/447 (59%), Gaps = 32/447 (7%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY +LGVT  A+  EIK AYRKLAL++HPDK +D + +E NE KFKEIT+AYEILSD EK
Sbjct: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69

Query: 64  RAHYDLYGDAXXXXXXXXXXXXX------------XXXXTDQPDYDSYAFDND--KSKDV 109
           ++HYDLYGD                               D P+       N+   SKD+
Sbjct: 70  KSHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYEGNETTSSKDI 129

Query: 110 KIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYK 169
            I L  ++++LY GK  KF+ KR IIC +C+G GW+ +K  +VT  HE+EC+ C G G K
Sbjct: 130 DIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVT--HEMECESCGGKGSK 187

Query: 170 ERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRG 229
           ER +   PG V +  + CE CHGKG+   +P + KN C +C   GL  + + + V+VP G
Sbjct: 188 ERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPG 247

Query: 230 LQNKDTIRIENEADQEIGKSKTGDIIL-VIEEDTTMPSDVHFIRKG-----TDFVMYLSL 283
               D + ++  AD+EI K+  GD+I  ++E+   +      ++K       D  + +++
Sbjct: 248 HHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITV 307

Query: 284 SLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV--NPQASKFGDL 341
           SL+EALTGF +KFL+++ D R+LTLS+  GKVIRPG+IIKI  EGWP+  +P+  + GDL
Sbjct: 308 SLSEALTGF-EKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDHPRG-QCGDL 365

Query: 342 YVIIKIEFPPDNWFSEKSDIQLLRNVLPSGI----NGMMNSWKIDDPLNTETVTTFDIL- 396
           YV + IEFPPDNWF+EKS++  ++  LPS      N  +N+   + P+N+ETV+ F I+ 
Sbjct: 366 YVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIH 425

Query: 397 -EELPDTLNESNNRSAYDTGDQSDANY 422
            ++LP+ +   N +       ++ ++Y
Sbjct: 426 SDDLPEGMKTFNPKPQTSAHQKASSSY 452

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  322 bits (824), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 179/431 (41%), Positives = 259/431 (60%), Gaps = 35/431 (8%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY +LGVT  AT  EIK AYRKLAL++HPDK +D + +E NEIKFKEIT+AYEILSD EK
Sbjct: 10  LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQP----------------DYDSYAFDND-KS 106
           ++HYDLYGD                   +                  +YD+Y   N   S
Sbjct: 70  KSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYEEGNSTSS 129

Query: 107 KDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGL 166
           KD+ I + L++++LY GK  KF  KR +IC++C G GW+ ++  +VT  H++EC+ C G 
Sbjct: 130 KDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVT--HDVECESCAGK 187

Query: 167 GYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSV 226
           G KER +   PG V +  + CE C+GKG+   +P + KN C +C G GLLS+ + + V+V
Sbjct: 188 GSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNV 247

Query: 227 PRGLQNKDTIRIENEADQEIGKSKTGDI-ILVIEEDTTMPSDVHFIR-----KGTDFVMY 280
             G    D I ++  AD+EI K+  GD+   + E+   +     F++      G D    
Sbjct: 248 APGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTS 307

Query: 281 LSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV--NPQASKF 338
           +++SL+EALTGF +KFL+K+ D R+LTLSV  G+V+RPG+ IKI  EGWP+  NP   + 
Sbjct: 308 ITISLSEALTGF-EKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHG-RC 365

Query: 339 GDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPS----GINGMMNSWKIDDPLNTETVTTFD 394
           GDLYV + IEFPPDNWF+EKS++  ++  LPS      +  +N+    +  N ET++ F 
Sbjct: 366 GDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFR 425

Query: 395 IL--EELPDTL 403
           I+  ++LP+ +
Sbjct: 426 IIHTDDLPEGI 436

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  320 bits (819), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 179/426 (42%), Positives = 253/426 (59%), Gaps = 29/426 (6%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY +LGVT  A   EIK AYRKLAL++HPDK +D + ++ NEIKFKEIT+AYEILSD EK
Sbjct: 10  LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69

Query: 64  RAHYDLYGD-------AXXXXXXXXXXXXXXXXXTDQPDYDSYAFDND----------KS 106
           ++HYDLYGD                          +   ++   F N+           S
Sbjct: 70  KSHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKMYEDNDSASS 129

Query: 107 KDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGL 166
           KD+ I + L++++LY GK  +F  KR ++C++C G GW+ +K  +VT  HE+EC+ C G 
Sbjct: 130 KDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVT--HEVECESCGGK 187

Query: 167 GYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSV 226
           G KER +   PG V +  + CE CHGKG+    P + KN C +C G GL S+ + + V V
Sbjct: 188 GSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIV 247

Query: 227 PRGLQNKDTIRIENEADQEIGKSKTGDIILVIEE--DTTMPSDVHFIRKG----TDFVMY 280
             G    D I IE  AD+EIGK+  GD+   + E  +      V     G     D  + 
Sbjct: 248 APGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVS 307

Query: 281 LSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQA-SKFG 339
           +++SL+EALTGF +KFL+K+ D R+LTLS+  G+VIRPG+++KI  EGWP+   A  + G
Sbjct: 308 VTISLSEALTGF-EKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCG 366

Query: 340 DLYVIIKIEFPPDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDIL--E 397
           DLYV I IEFPPDNWF+EKS++  ++  LPS  +    S   +D +N ETV+ F I+  +
Sbjct: 367 DLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCASGDANDLINNETVSNFQIIHTD 426

Query: 398 ELPDTL 403
           +LP+ +
Sbjct: 427 DLPEGV 432

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  314 bits (805), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/454 (41%), Positives = 259/454 (57%), Gaps = 40/454 (8%)

Query: 5   YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
           Y +LGV   AT+ EI+KAYRKLAL+YHPDK++D  +RE +E  FKE+T+AYEILSD E +
Sbjct: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133

Query: 65  AHYDLYGDAXX-----------XXXXXXXXXXXXXXXTDQPDYDSYAF-------DNDKS 106
           + YD+YGD+                                 + SY+        ++ ++
Sbjct: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193

Query: 107 KDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGL 166
            D +I  K++ ++LY GKT  FQ KR  +C  C G G R++   +   P EI C  CNG 
Sbjct: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKK---HFQKP-EISCTSCNGQ 249

Query: 167 GYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSV 226
           G+KER   L  G++  D   C+ C GKG    K  S  + CK+C GKGL++E K   V +
Sbjct: 250 GFKERITRLAGGYMVKDHTVCDACKGKGRYRKK--SASDTCKHCSGKGLINEEKSQTVYI 307

Query: 227 PRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLA 286
           PRG ++ D  R+   AD E GK +TGD+I+VI+ED+   S  H  RK  D    L++SL 
Sbjct: 308 PRGSRHGDEFRLPQMADMEYGK-ETGDVIIVIDEDS---SKSHLERKSNDLHTTLNISLV 363

Query: 287 EALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIK 346
           +ALTGF    + ++ D R L ++VP+GKVIRPGN  K K EGWP++     FGD+YV I 
Sbjct: 364 DALTGF-STIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLS-NGDSFGDMYVQIN 421

Query: 347 IEFPPDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDIL---EELPDTL 403
           IEFP DNWF+EKS+I  LRN+LP G+       K  DPLNTE V ++ +L   +ELPD L
Sbjct: 422 IEFPKDNWFNEKSEITALRNILP-GLKS--KDTKDPDPLNTEDVLSYSVLHSHDELPDYL 478

Query: 404 NESN---NRSAYDTGDQSDANYD-REGPPQCSQQ 433
            E     NR   +    S  + D  + P +C+ Q
Sbjct: 479 AEEKEKYNRKQQEEPHASAFDNDYTQMPSECATQ 512

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  278 bits (710), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 168/458 (36%), Positives = 252/458 (55%), Gaps = 34/458 (7%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREEN-----EIKFKEITSAYEI 57
           D Y +LGV   A+  EIK+AYRKLAL++HPDK       E++     ++ FKE+T+AY++
Sbjct: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61

Query: 58  LSDEEKRAHYD--LYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDND------KSKDV 109
           LSD   RA YD  L  +A                    P + S  FD+       KS D+
Sbjct: 62  LSDASLRAEYDQKLAFEAQPYGDDDFMNFFSGFNGGSHPGHRS-GFDSGRGARRYKSDDI 120

Query: 110 KIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRR----KNGNVTIPHEIECKKCNG 165
           +I LK+   ELY GK   F  KR   C +C+G GW+      K         + C+ C G
Sbjct: 121 EIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFFWNV-CEGCEG 179

Query: 166 LGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGK---GLLSENKQL 222
            G ++R R L PGFVTT+ I C  C GKG++   P SEKNKC +C      G++ ENK +
Sbjct: 180 QGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVV 239

Query: 223 LVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLS 282
            +++ +G  + D I ++ EAD+++  ++ GD+++ I+E      D+  +R G D ++   
Sbjct: 240 TINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDI--VRNGYDLIIKKQ 297

Query: 283 LSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQAS------ 336
           + LA+A+ GF +K L ++ DGR+L  S   GKVIRP +I++I+ EGWP    A+      
Sbjct: 298 IDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLL 357

Query: 337 KFGDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDIL 396
           K GDLYVI+ I FPPDNW  E +D + +RN++PS IN   +S   +  LN E +   +I+
Sbjct: 358 KNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENINVSEIV 417

Query: 397 EELPDTLNESNNRSAYD-TGDQSDANYDREGPPQCSQQ 433
           +E+P+       +  YD T D+ ++ +     P CSQQ
Sbjct: 418 KEIPNCDELPKFQDTYDNTNDKGESPF---WTPNCSQQ 452

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  191 bits (484), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 142/438 (32%), Positives = 217/438 (49%), Gaps = 43/438 (9%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY +LGV+  A D++IKKAYRK AL++HPDK    N  EE   KFKEITSAYEILSD +K
Sbjct: 7   LYDLLGVSPGADDNQIKKAYRKSALKFHPDK----NPSEEAAEKFKEITSAYEILSDSQK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN--------DKSKDVKIPLKL 115
           R  YD +G                       D  S  F           K +D++  +  
Sbjct: 63  REVYDQFG---LEGLSGQGAGGPGGFGGFGEDLFSQFFGGGSSRPRGPQKGRDIRHEIPA 119

Query: 116 SIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRML 175
           ++++L+ G+T K    + +IC  CEG G    K G+V      +C  C+G G+K  TR +
Sbjct: 120 TLEQLFKGRTAKLALNKQLICKSCEGRGG---KEGSVK-----KCTACSGQGFKFVTRQM 171

Query: 176 IPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDT 235
            P  +   ++ CE CHG GE+       K +CK C GK +++E K L V++  G+++   
Sbjct: 172 GP-MIQRFQVECESCHGAGEII----DPKGRCKVCSGKKVVNERKVLEVNIEPGMKDGQR 226

Query: 236 IRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDK 295
           I  + EADQ  G    GD++ V+ E    P  V F R G D      + L  A+ G   +
Sbjct: 227 IVFQGEADQSPG-IIPGDVVFVVSE---QPHPV-FKRDGNDLHYDAEIDLLSAIAG--GQ 279

Query: 296 FLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWF 355
           F  K + G  L + +  G+VI PG++  I+ +G P+ P+   +G+L +   I+FPP + F
Sbjct: 280 FAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPI-PKYGGYGNLLIKFNIKFPPAH-F 337

Query: 356 SEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILEELPDTLNESNNRSAYDTG 415
           ++   ++ L  +LP      + S   D  +    +  FD  +           +S YD+ 
Sbjct: 338 TDDETLKKLEEILPP---RNVPSIPADAEVEDCVLADFDSSKHGARAGGNGRGQS-YDSD 393

Query: 416 DQSDANYDREGPPQCSQQ 433
           D+ D ++  EG  QC+ Q
Sbjct: 394 DE-DGHHGAEG-VQCASQ 409

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  191 bits (484), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 131/376 (34%), Positives = 194/376 (51%), Gaps = 37/376 (9%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY ILGV+ +A+DSEIKKAYRK AL+YHPDK    N  EE   KFKE +SAYE+LSD EK
Sbjct: 7   LYDILGVSPTASDSEIKKAYRKQALKYHPDK----NPSEEAAEKFKEASSAYEVLSDSEK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN---------DKSKDVKIPLK 114
           R  YD +G                    +  D  S  F            + +D+K  + 
Sbjct: 63  RDIYDQFGQDGLSGNGGMPGGAGGFGFGE--DLFSQFFGGAGASRPRGPQRGRDIKHEIS 120

Query: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174
           +S++ELY GKT K    + I+C  CEG G ++   G V      +C  CNG G K  TR 
Sbjct: 121 VSLEELYKGKTSKLALNKQILCKTCEGRGGKK---GAVK-----KCSSCNGQGIKFVTRQ 172

Query: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234
           + P  +   +  C+ CHG G++       K++CK+CHGK + +E K L V+V  G++N  
Sbjct: 173 MGP-MIQRFQTECDVCHGTGDII----DAKDRCKDCHGKKIANERKILQVNVDPGMKNGQ 227

Query: 235 TIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKD 294
            +  + EADQ       GD+I VI E        HF R G D +    + L  A+ G   
Sbjct: 228 KVVFKGEADQAP-DIIPGDVIFVISEKPHK----HFQRVGDDLIYEAEIDLLTAVAG--G 280

Query: 295 KFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNW 354
           +F  + + G  L +S+  G+VI P     ++ +G P+  +   +G+L +   I+F P+N 
Sbjct: 281 EFALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQ-KYGGYGNLIIKFSIKF-PENH 338

Query: 355 FSEKSDIQLLRNVLPS 370
           F+++  ++ L  +LP+
Sbjct: 339 FADEDTLKKLEEILPA 354

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  188 bits (478), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 149/443 (33%), Positives = 221/443 (49%), Gaps = 55/443 (12%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY  LGV+  A+D+EIKKAYRK AL+YHPDK    N  EE   KFKE++SAYEILSD +K
Sbjct: 7   LYDTLGVSPGASDAEIKKAYRKSALKYHPDK----NPSEEAAEKFKEVSSAYEILSDSQK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN---------DKSKDVKIPLK 114
           R  YD +G+                      D  S  F            + +D+K  + 
Sbjct: 63  REVYDQFGE---EGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGRPRGPQRGRDIKHEMA 119

Query: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174
            S++ELY G+T K    + I+C  CEG G    K G V      +C  CNG G K  TR 
Sbjct: 120 ASLEELYKGRTAKLALNKQILCKSCEGRGG---KEGAVK-----KCSSCNGQGIKFVTRQ 171

Query: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234
           + P  +   +  C+ CHG G++       K++CK+C+GK + +E K L V +  G+++  
Sbjct: 172 MGP-MIQRFQTECDVCHGTGDII----DAKDRCKSCNGKKVDNERKILEVRIEPGMKDGQ 226

Query: 235 TIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKD 294
            I  + EADQ       GD++ VI E        HF R G D +    + L  AL G   
Sbjct: 227 KIVFKGEADQAP-DVIPGDVVFVISEKPHK----HFQRAGDDLIYEAEIDLLTALAG--G 279

Query: 295 KFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNW 354
           +F  + + G  L + +  G+VI PG    ++ +G P+  +   +G+L +   I+F P+N 
Sbjct: 280 QFALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQ-KYGGYGNLLIKFNIKF-PENH 337

Query: 355 FSEKSDIQLLRNVLP--SGINGMMNSWKIDDPLNTETVTTFDILEELPDTLNESNNRSA- 411
           F+ + +++ L  +LP    IN +    ++DD + +E    FD     P    +SN RS  
Sbjct: 338 FTSEENLKKLEEILPPRRQIN-IPAKAQVDDCVLSE----FD-----PSKFGQSNGRSGA 387

Query: 412 -YDTGDQSDANYDREGPPQCSQQ 433
            YD+ D+ DA +  EG  QC+ Q
Sbjct: 388 NYDSDDE-DA-HGGEG-VQCASQ 407

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  187 bits (475), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 140/446 (31%), Positives = 213/446 (47%), Gaps = 58/446 (13%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
            Y ILGV+ +A++SEIKK YRK AL+YHPDK    N   E   KFKE ++AYE+LSD EK
Sbjct: 7   FYDILGVSPTASESEIKKGYRKAALKYHPDK----NPTAEAAEKFKECSAAYEVLSDPEK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN---------DKSKDVKIPLK 114
           R  YD YG+                      D  S  F            K +D+K  + 
Sbjct: 63  RDVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQRPRGPQKGRDIKHEIA 122

Query: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174
            +++ELY G+T K    + I+C  CEG G +             +C  C G G K  T+ 
Sbjct: 123 ATLEELYKGRTAKLALNKQILCKSCEGRGGKADAVK--------KCSSCGGQGIKFVTKQ 174

Query: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234
           + P  +   +  C+ CHG G++       K +CK+CHGK + +E K L V +  G+++  
Sbjct: 175 MGP-MIQRFQTECDVCHGTGDII----DPKGRCKSCHGKKIANERKILEVKIEPGMKDGQ 229

Query: 235 TIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKD 294
            I  + E+DQ       GD++ V+ E        HF R G D V    + L  A+ G   
Sbjct: 230 RIVFKGESDQAP-DIIPGDVVFVVNEKPHK----HFQRSGNDLVYLAEIDLLTAIAG--G 282

Query: 295 KFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNW 354
           +F  + + G  L +++ +G+VI PG    I+ +G P+  +   +G+L +   I+F P+N 
Sbjct: 283 EFALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPI-LKYGGYGNLIIQFNIKF-PENH 340

Query: 355 FSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILEEL------PDTLNESNN 408
           F+++S+++ L  +LP              P N  T+     +EE       P     SN 
Sbjct: 341 FTDESNLKKLEEILP--------------PRNKVTIPAKAEVEECVLADYDPAKYRTSNG 386

Query: 409 RS-AYDTGDQSDANYDREGPPQCSQQ 433
           R  +YD+ D+ DA+   EG  QC+ Q
Sbjct: 387 RGQSYDSDDE-DAHGGAEG-VQCASQ 410

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  186 bits (471), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 127/376 (33%), Positives = 189/376 (50%), Gaps = 36/376 (9%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
            Y ILGV+ SA+ SEIKKAYRK AL+YHPDK    N  EE   KFKE ++AYE+LSD+EK
Sbjct: 7   FYDILGVSPSASSSEIKKAYRKFALKYHPDK----NPSEEAAEKFKEASAAYEVLSDDEK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSY----------AFDNDKSKDVKIPL 113
           R  YD +G                        +  +               + +D+K  L
Sbjct: 63  REMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRGRDIKHEL 122

Query: 114 KLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTR 173
             +++ELY G+T K    + I+C  CEG G ++   G V      +C  CNG G K  TR
Sbjct: 123 SATLEELYKGRTAKLALNKQILCKTCEGRGGKK---GAVK-----KCSSCNGQGVKFVTR 174

Query: 174 MLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNK 233
            + P  +   +  CE CHG G++       K++CK C+ K + +E K L V +  G+++ 
Sbjct: 175 QMGP-MLQRFQAECEVCHGTGDII----DPKDRCKTCNAKKVTNERKILEVHIEPGMKDG 229

Query: 234 DTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFK 293
             +  + EADQ       GD+I V+ +    P + HF R G D V    + L  A+ G  
Sbjct: 230 QKVVFKGEADQ-APDIIPGDVIFVVSQK---PHE-HFQRAGDDLVYEAEIDLLTAIAG-- 282

Query: 294 DKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDN 353
            +F  K + G  L +++  G+VI PG    I  +G P+ P+   +G+L V   I+FPP N
Sbjct: 283 GEFAIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPI-PKYGGYGNLIVKFNIKFPP-N 340

Query: 354 WFSEKSDIQLLRNVLP 369
            F+++  ++ L  +LP
Sbjct: 341 HFTDEESLKKLEEILP 356

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  185 bits (469), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 132/376 (35%), Positives = 191/376 (50%), Gaps = 38/376 (10%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
            Y ILGV+ +ATD EIKKAYRK AL++HPDK    N  EE   KFKE +SAYE+LSD EK
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKFHPDK----NPSEEAAEKFKEASSAYEVLSDSEK 62

Query: 64  RAHYDLYG-DAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN---------DKSKDVKIPL 113
           R  YD +G D                   D  D  S  F            + +D+K  +
Sbjct: 63  REVYDQFGEDGLSGAGGAGGFPGGGFGFGD--DIFSQFFGAGGAQRPKGPQRGRDIKHEI 120

Query: 114 KLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTR 173
             S++ELY G+T K    + I+C +CEG G    K G V      +C  CNG G K  TR
Sbjct: 121 SASLEELYKGRTAKLALNKQILCKECEGRGG---KKGAVK-----KCTGCNGQGIKFVTR 172

Query: 174 MLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNK 233
            + P  +   +  C+ CHG G++       K++CK+C+GK + +E K L V V  G+++ 
Sbjct: 173 QMGP-MIQRFQTECDACHGTGDIV----DPKDRCKSCNGKKIENERKILEVHVEPGMKDG 227

Query: 234 DTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFK 293
             I  + EADQ       GD++ ++ E        HF R G D V    + L  A+ G  
Sbjct: 228 QKIVFKGEADQAP-DVIPGDVVFLVSERPHK----HFKRDGDDLVYEAEIDLLTAIAG-- 280

Query: 294 DKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDN 353
            +F  + + G  L + +  G+VI PG    I+ +G PV P+   +G+L V   I+F P+N
Sbjct: 281 GEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPV-PKYGGYGNLIVKFTIKF-PEN 338

Query: 354 WFSEKSDIQLLRNVLP 369
            F+ + +++ L  +LP
Sbjct: 339 HFTTEENLKKLEEILP 354

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  183 bits (464), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 128/377 (33%), Positives = 189/377 (50%), Gaps = 34/377 (9%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
            Y ILGV+ +ATD EIKKAYRK AL+YHPDK    N  EE   KFKE +SAYEILSD EK
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDK----NPSEEAAEKFKEASSAYEILSDSEK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN--------DKSKDVKIPLKL 115
           R  YD +G+                       +  +             + KD+K  +  
Sbjct: 63  REVYDQFGEEGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEISA 122

Query: 116 SIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRML 175
           S++ELY G+T K    + I+C  CEG G    K G V      +C  CNG G K  TR +
Sbjct: 123 SLEELYKGRTAKLALNKQILCKGCEGRGG---KKGAVK-----KCSSCNGQGIKFVTRQM 174

Query: 176 IPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDT 235
            P  +   +  C+ CHG G++       K++CK+C+GK + +E K L V V  G+++   
Sbjct: 175 GP-MIQRFQTECDVCHGTGDII----DPKDRCKSCNGKKVENERKILEVHVEPGMKDGQR 229

Query: 236 IRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDK 295
           I  + EADQ       GD++ ++ E        +F R G D V    + L  A+ G   +
Sbjct: 230 IVFKGEADQAP-DVIPGDVVFIVSERPHK----NFKRDGDDLVYEAEIDLLTAIAG--GE 282

Query: 296 FLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWF 355
           F  + + G  L + +  G+VI PG    I+ +G P+ P+   +G+L +   I+F P+N F
Sbjct: 283 FALEHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPI-PKYGGYGNLVIKFTIKF-PENHF 340

Query: 356 SEKSDIQLLRNVLPSGI 372
           + + +++ L  +LP  I
Sbjct: 341 TTEENLKKLEEILPPRI 357

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  182 bits (462), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 128/375 (34%), Positives = 190/375 (50%), Gaps = 37/375 (9%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY +LGV+ +ATD EIKKAYRK+AL++HPDK    N  EE   KFKE +SAYE+LSD +K
Sbjct: 7   LYDVLGVSVTATDVEIKKAYRKMALKFHPDK----NPSEEAAEKFKEASSAYEVLSDADK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN---------DKSKDVKIPLK 114
           R  YD +G                    D  D  S  F            + +D+K  + 
Sbjct: 63  RDTYDQFGLEGLSGAGGMGGAGGGFGFGD--DIFSQFFGGAGAQRPRGPQRGRDIKHEIN 120

Query: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174
           ++++ELY GKT K    + I+C  CEG G    K G V      +C  CNG G K  TR 
Sbjct: 121 VTLEELYRGKTSKLALNKQILCKTCEGRGG---KKGAVK-----KCSSCNGQGIKFVTRQ 172

Query: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234
           + P  +   +  C+ CHG G++       K++CK+C+GK + SE K L V V  G++N  
Sbjct: 173 MGP-MIQRFQTECDVCHGAGDIV----DPKDRCKSCNGKKVASERKILEVHVDPGMKNGQ 227

Query: 235 TIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKD 294
            +  + EADQ       GD++ VI E        HF R G + V    + L  A+ G   
Sbjct: 228 KVVFKGEADQAP-DVIPGDVVFVINEKPHK----HFQRSGDNLVYEAEVDLLTAIAG--G 280

Query: 295 KFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNW 354
           +F  + + G  L +++  G+VI PG    I  +G PV  +   +G+L +   ++F P+  
Sbjct: 281 EFAIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPV-AKYGGYGNLIIKFTVKF-PEPH 338

Query: 355 FSEKSDIQLLRNVLP 369
           F+ + +++ L  +LP
Sbjct: 339 FTTEENLKKLEEILP 353

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  181 bits (459), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 132/377 (35%), Positives = 189/377 (50%), Gaps = 39/377 (10%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
            Y ILGV+ +ATD EIKKAYRK AL+YHPDK    N  EE   KFKE +SAYEILSD EK
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDK----NPSEEAAEKFKEASSAYEILSDSEK 62

Query: 64  RAHYDLYG-DAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN----------DKSKDVKIP 112
           R  YD +G D                   D  D  S  F             + KD+K  
Sbjct: 63  RDVYDQFGEDGLSGAGGAGGFPGGGFGFGD--DIFSQFFGGAGGAQRPRGPQRGKDIKHE 120

Query: 113 LKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERT 172
           +  S++ELY G+T K    + I+C  CEG G    K G V      +C  CNG G K  T
Sbjct: 121 ISASLEELYKGRTAKLALNKQILCKGCEGRGG---KKGAVK-----KCSSCNGQGIKFVT 172

Query: 173 RMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQN 232
           R + P  +   +  C+ CHG G++       K++CK+C+GK + +E K L V V  G+++
Sbjct: 173 RQMGP-MIQRFQTECDVCHGTGDIV----DPKDRCKSCNGKKVENERKILEVHVEPGMKD 227

Query: 233 KDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGF 292
              I  + EADQ       GD++ ++ E         F R G D V    + L  A+ G 
Sbjct: 228 GQRIVFKGEADQAP-DVIPGDVVFLVSERPHK----SFKRDGDDLVYEAEIDLLTAIAG- 281

Query: 293 KDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPD 352
             +F  + + G  L + +  G+VI PG    I+ +G PV P+   +G+L +   ++F P+
Sbjct: 282 -GEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPV-PKYGGYGNLIIKFTVKF-PE 338

Query: 353 NWFSEKSDIQLLRNVLP 369
           N F+ + +++ L  +LP
Sbjct: 339 NHFTAEENLKKLEEILP 355

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  180 bits (457), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 132/379 (34%), Positives = 190/379 (50%), Gaps = 38/379 (10%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
            Y ILGV  +ATD EIKKAYRK AL+YHPDK    N  EE   KFKE ++AYEILSD EK
Sbjct: 7   FYDILGVPVTATDVEIKKAYRKCALKYHPDK----NPSEEAAEKFKEASAAYEILSDPEK 62

Query: 64  RAHYDLYG-DAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN---------DKSKDVKIPL 113
           R  YD +G D                   D  D  S  F            + KD+K  +
Sbjct: 63  RDIYDQFGEDGLSGAGGAGGFPGGGFGFGD--DIFSQFFGAGGAQRPRGPQRGKDIKHEI 120

Query: 114 KLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTR 173
             S++ELY G+T K    + I+C +CEG G    K G V      +C  CNG G K  TR
Sbjct: 121 SASLEELYKGRTAKLALNKQILCKECEGRGG---KKGAVK-----KCTSCNGQGIKFVTR 172

Query: 174 MLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNK 233
            + P  +   +  C+ CHG G++       K++CK+C+GK + +E K L V V  G+++ 
Sbjct: 173 QMGP-MIQRFQTECDVCHGTGDII----DPKDRCKSCNGKKVENERKILEVHVEPGMKDG 227

Query: 234 DTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFK 293
             I  + EADQ       GD++ ++ E         F R G D V    + L  A+ G  
Sbjct: 228 QRIVFKGEADQAP-DVIPGDVVFIVSERPHK----SFKRDGDDLVYEAEIDLLTAIAG-- 280

Query: 294 DKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDN 353
            +F  + + G  L + +  G+VI PG    I+ +G P+ P+   +G+L +   I+F P+N
Sbjct: 281 GEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPI-PKYGGYGNLIIKFTIKF-PEN 338

Query: 354 WFSEKSDIQLLRNVLPSGI 372
            F+ + +++ L  +LP  I
Sbjct: 339 HFTSEENLKKLEEILPPRI 357

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  179 bits (455), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 128/375 (34%), Positives = 187/375 (49%), Gaps = 35/375 (9%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
            Y +LGV+  A D++IKKAYRK AL++HPDK    N  EE   KFKE+T AYEILSD +K
Sbjct: 7   FYDLLGVSPDANDAQIKKAYRKQALKFHPDK----NPSEEAADKFKELTVAYEILSDSQK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN---------DKSKDVKIPLK 114
           R  YD  G+                      D  S  F            K +D+K  + 
Sbjct: 63  RDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQRPRGPQKGRDIKHEMS 122

Query: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174
            S++ELY G+T K    + I+C  CEG G    K G V      +C  CNG G K  TR 
Sbjct: 123 ASLEELYKGRTAKLALNKQILCKTCEGRGG---KAGAVK-----KCSSCNGQGIKFITRQ 174

Query: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234
           + P  +   +  C+ C G G++       K++CK+C+GK + +E K L V +  G+++  
Sbjct: 175 MGP-MIQRFQAECDVCSGTGDII----DPKDRCKSCNGKKIDNERKILEVHIEPGMKDGQ 229

Query: 235 TIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKD 294
            I  + EADQ  G    GD++ VI +        HF RKG D +    + L  A+ G   
Sbjct: 230 KIVFQGEADQAPG-IIPGDVVFVISQRPHK----HFERKGDDLLYQAEVDLLSAIAG--G 282

Query: 295 KFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNW 354
           +F  + + G  L +S+  G+VI PG    I+ +G P+  +   +G+L V  KI F P N 
Sbjct: 283 EFAIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQ-KYGGYGNLIVTFKINF-PTNH 340

Query: 355 FSEKSDIQLLRNVLP 369
           F+++  ++ L  +LP
Sbjct: 341 FADEESLKKLEEILP 355

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  178 bits (452), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 129/376 (34%), Positives = 190/376 (50%), Gaps = 37/376 (9%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
            Y +LGV+ +A+++EIKK YRK AL+YHPDK    N  EE   KFKE ++AYE+LSD +K
Sbjct: 7   FYDLLGVSPNASETEIKKGYRKQALKYHPDK----NPSEEAAEKFKECSAAYEVLSDSQK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN---------DKSKDVKIPLK 114
           R  YD YG+                   D  D  S  F            + +D+K  ++
Sbjct: 63  REVYDQYGEEGLNGGGAGGFPGGGFGFGD--DIFSQFFGGAGAQRPSGPQRGRDIKHEIQ 120

Query: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174
            +++ELY G+T K    + I+C  CEG G    K G V      +C  CNG G K  TR 
Sbjct: 121 NTLEELYKGRTAKLALNKQILCKTCEGRGG---KAGAVK-----KCTSCNGQGIKFVTRQ 172

Query: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234
           + P  +   +  C+ CHG G++       K++CK+C GK + +E K L V V  G++   
Sbjct: 173 MGP-MIQRFQTECDVCHGSGDII----DPKDRCKDCKGKKIANERKVLEVHVEPGMREGQ 227

Query: 235 TIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKD 294
            I  + EADQ       GD+I V+ E        HF R G D +    + L  A+ G   
Sbjct: 228 KIVFKGEADQ-APDVIPGDVIFVVVEKPHK----HFKRAGDDLLYEAEIDLLTAIAG--G 280

Query: 295 KFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNW 354
           +F  + + G  L +S   G+VI  G    I+ +G PV P+   +G+L V  KI+FP +N 
Sbjct: 281 EFAIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPV-PKYGGYGNLIVTFKIKFPENN- 338

Query: 355 FSEKSDIQLLRNVLPS 370
           F+ +  ++ L N+LP+
Sbjct: 339 FATEDKLKELENILPA 354

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  178 bits (452), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 142/442 (32%), Positives = 214/442 (48%), Gaps = 52/442 (11%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
            Y +LGV+ +A++SEIKK YRK AL+YHPDK    N  +E   KFKE + AYE+LSD +K
Sbjct: 7   FYDLLGVSPNASESEIKKGYRKAALKYHPDK----NPTDEAAEKFKECSGAYEVLSDSQK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN---------DKSKDVKIPLK 114
           R  YD YG+                   D  D  S  F            + KD++  ++
Sbjct: 63  REIYDQYGEEGLSGGGPGAGFGGFGGFGD--DIFSQFFGGAGASRPRGPQRGKDIRHEIQ 120

Query: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174
            +++ELY G+T K    + I+C  CEG G    K G V      +C  C G G K  TR 
Sbjct: 121 NTLEELYKGRTAKLALNKQILCKGCEGRGG---KEGAVK-----KCSSCGGQGVKFVTRQ 172

Query: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234
           + P  +   +  C+ CHG G++       K++CK C G  + +E K L V V  G++   
Sbjct: 173 MGP-MIQRFQTECDVCHGSGDII----DPKDRCKECKGNKVANERKVLEVHVEPGMREGQ 227

Query: 235 TIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKD 294
            +  + EADQ       GD+I V+ E        HF R G D +    + L  A+ G   
Sbjct: 228 KVTFKGEADQAP-DIIPGDVIFVVTEKPHK----HFKRSGDDLLYEAEVDLLTAIAG--G 280

Query: 295 KFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNW 354
            F  + + G  L +++  G+VI PG    I  +G PV  +   +G+L +  KI+F P+N 
Sbjct: 281 DFAIEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQ-KYGGYGNLIITFKIKF-PENH 338

Query: 355 FSEKSDIQLLRNVLPSGIN-GMMNSWKIDDPLNTETVTTFDILEELPDTLNESNNR--SA 411
           F++++ ++ L ++LP      +     IDD + TE    FD     P     +NNR   +
Sbjct: 339 FADEAKLKALEDILPPRTEVKIPPKAHIDDCVLTE----FD-----PVKYGNNNNRRGQS 389

Query: 412 YDTGDQSDANYDREGPPQCSQQ 433
           YD+ D+   ++  EG  QC+ Q
Sbjct: 390 YDSDDED--HHGGEG-VQCASQ 408

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  177 bits (449), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 141/443 (31%), Positives = 212/443 (47%), Gaps = 52/443 (11%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY +LGV+ +A DSEIKKAYRK AL+YHPDK    N  EE   KFKE+++AYEILSD EK
Sbjct: 7   LYDVLGVSPTAGDSEIKKAYRKSALKYHPDK----NPTEEGAEKFKEVSAAYEILSDSEK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN-----------DKSKDVKIP 112
           R  YD +G+                      D  S  F              + +D+K  
Sbjct: 63  REIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRGRDIKHE 122

Query: 113 LKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERT 172
           +  +++ELY G+T K    + I+C  CEG G ++   G V      +C  CNG G K  T
Sbjct: 123 IAATLEELYKGRTAKLALNKQILCKTCEGRGGKK---GAVK-----KCSSCNGQGVKFVT 174

Query: 173 RMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQN 232
           R + P  +   +  C+ C G G++       K++CK C+ K + +E K L V +  G+++
Sbjct: 175 RQMGP-MIQRFQAECDVCSGTGDII----DPKDRCKTCNAKKVTNERKILEVHIEPGMKD 229

Query: 233 KDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGF 292
              I  + EADQ       GD+I V+ +        HF R G D V    + L  A+ G 
Sbjct: 230 GQNIVFKGEADQ-APDVIPGDVIFVVAQKPHK----HFQRSGDDLVYEAEIDLLTAIAG- 283

Query: 293 KDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPD 352
             +F  + + G  L +S+  G+VI PG+   I+ +G P+ P+    G+L V   ++F P 
Sbjct: 284 -GEFALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMPI-PKYGGHGNLIVHFTVKF-PQ 340

Query: 353 NWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILEELPDTLNESNNRSAY 412
             F+++  ++ L  +LP          KI  P N  TV    + E  P   +      +Y
Sbjct: 341 KHFADEDSLKKLEEILPP-------RKKISIPANA-TVDDCVLSEYDPSKSSARRGGQSY 392

Query: 413 DTGDQSDANYDREGPP--QCSQQ 433
           D+ D+     D++G    QC+ Q
Sbjct: 393 DSDDE-----DQQGGEGVQCASQ 410

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  176 bits (446), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 121/375 (32%), Positives = 190/375 (50%), Gaps = 35/375 (9%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY +LGV+  A D++IKKAYRK AL+YHPDK    N  EE   KFK+IT AYEILSD +K
Sbjct: 7   LYDLLGVSPDANDAQIKKAYRKSALKYHPDK----NPSEEAADKFKQITGAYEILSDSQK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN---------DKSKDVKIPLK 114
           R  YD +G+                      D  S  F            K +D++  + 
Sbjct: 63  REMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQKGRDIRHDIS 122

Query: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174
            +++ LY G+  K    + ++C +CEG G    K G+V      +C  CNG G K  TR 
Sbjct: 123 CTLENLYKGRAAKLALNKTVLCKRCEGRGG---KAGSVK-----KCTSCNGQGVKFVTRH 174

Query: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234
           + P  +   +  CE C+G+G+V        ++CK+C GK + SE K L V++  G+++  
Sbjct: 175 MGP-MIQRFQTTCEVCNGEGDVI----PAADRCKDCDGKKIASERKILEVNIQPGMKHGQ 229

Query: 235 TIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKD 294
            I  + EADQ+ G+   GD++ V+ E         F+R G +      + L  A+ G   
Sbjct: 230 KIVFQGEADQQPGQI-PGDVVFVVNEQ----EHPRFVRNGDNLHYEAEIDLLTAIAG--G 282

Query: 295 KFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNW 354
           +F  + + G  L + +  G+VI PG +  I+ +G P+    S +GDL +   ++F P + 
Sbjct: 283 QFALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGDLLIKFNVKF-PKSH 340

Query: 355 FSEKSDIQLLRNVLP 369
           F+++  ++ L  +LP
Sbjct: 341 FADEEALKKLEAILP 355

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  176 bits (446), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 125/374 (33%), Positives = 182/374 (48%), Gaps = 34/374 (9%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
            Y +LGV   A D++IKK YRK AL++HPDK    N   E   KFKE+T AYE+LSD +K
Sbjct: 7   FYDLLGVPVDANDAQIKKGYRKQALKFHPDK----NPSAEAADKFKELTVAYEVLSDSQK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN--------DKSKDVKIPLKL 115
           R  YD  G+                      D  S  F           K +D+K  +  
Sbjct: 63  RDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGASRPRGPQKGRDIKHEMSA 122

Query: 116 SIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRML 175
           S++ELY G+T K    + ++C  CEG G    K G V      +C  CNG G K  TR +
Sbjct: 123 SLEELYKGRTAKLALNKQVLCKTCEGRGG---KEGAVK-----KCASCNGQGVKFITRQM 174

Query: 176 IPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDT 235
            P  +   +  C+ C+G G++       K++CK C+GK + +E K L V +  G+++   
Sbjct: 175 GP-MIQRFQAECDACNGTGDIV----DPKDRCKTCNGKKIDNERKILEVHIEPGMKDGQK 229

Query: 236 IRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDK 295
           I  + EADQ  G    GD+I VI +        HF RKG +      + L  A+ G   +
Sbjct: 230 IVFQGEADQAPG-VIPGDVIFVISQRPHK----HFERKGDNLYYQAEVDLLSAIAG--GE 282

Query: 296 FLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWF 355
           F  + + G  L + +  G+VI PG    I+ +G PV  +   FGDL V  K+ F P N F
Sbjct: 283 FAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQ-KYGGFGDLIVTFKVNF-PTNHF 340

Query: 356 SEKSDIQLLRNVLP 369
           +++  ++ L  +LP
Sbjct: 341 ADEESLKKLEEILP 354

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  175 bits (443), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 188/376 (50%), Gaps = 37/376 (9%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY ++GV+  A D++IKKAYRK AL+YHPDK    N  EE   KFKEI+SAYEILSD +K
Sbjct: 7   LYDLIGVSPGADDAQIKKAYRKAALKYHPDK----NPTEEAAEKFKEISSAYEILSDSQK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN----------DKSKDVKIPL 113
           R  YD +                        D  S  F             K +D++  +
Sbjct: 63  REMYDQF-GEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGGSSRPRGPQKGRDIRHEI 121

Query: 114 KLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTR 173
             +++ELY G+T K    + I+C  CEG G    K G V      +C  CNG G+K  TR
Sbjct: 122 SATLEELYKGRTAKLALNKQILCKSCEGRGG---KAGAVK-----KCSSCNGQGFKFITR 173

Query: 174 MLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNK 233
            + P  +   +  C+ C+G G++       K++CK C+GK + +E K L V +  G+++ 
Sbjct: 174 QMGP-MIQRFQAECDACNGTGDII----DAKDRCKACNGKKIANERKILEVHIEPGMKDG 228

Query: 234 DTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFK 293
             I  + EADQ    +       V+   +  P +  F RKG D      + L  A+ G  
Sbjct: 229 QKIVFQGEADQ----APDVVPGDVVFVVSERPHE-RFNRKGDDLYYEAEVDLLTAIAG-- 281

Query: 294 DKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDN 353
            +F  + + G  L + +  G+VI PG    I+ +G PV  +   FG+L V  KI+FPP N
Sbjct: 282 GEFAVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQ-KYGGFGNLIVKFKIKFPP-N 339

Query: 354 WFSEKSDIQLLRNVLP 369
            F++++ ++ L N+LP
Sbjct: 340 HFADEASLKQLENILP 355

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  173 bits (439), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 125/374 (33%), Positives = 187/374 (50%), Gaps = 35/374 (9%)

Query: 5   YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
           Y +LGV+ SAT+ EIKKAYRK AL+YHPDK    N   E   KFKE++SAYE+LSD EKR
Sbjct: 8   YDLLGVSVSATEIEIKKAYRKSALKYHPDK----NPSAEAAEKFKEVSSAYEVLSDSEKR 63

Query: 65  AHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSY---------AFDNDKSKDVKIPLKL 115
             YD +G+                       +  +              + +D+K  + +
Sbjct: 64  QVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIFSQFFGGAPGGGRPRGPQRGRDIKHEIAV 123

Query: 116 SIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRML 175
           +++ELY G+T K    + I+C  C G G    K G V      +C  CNG GYK  TR +
Sbjct: 124 TLEELYKGRTAKLALNKQILCKGCNGRGG---KEGAVK-----KCSSCNGQGYKFVTRQM 175

Query: 176 IPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDT 235
            P  +   +  CE C G G++       K++CK+C+GK + +E K L V V  G+++   
Sbjct: 176 GP-MIQRFQTECEACAGTGDII----DPKDRCKSCNGKKVANERKILEVHVDPGMKDGQK 230

Query: 236 IRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDK 295
           I  + EADQ       GD+I V+ E        +F R G D V    + L  A+ G   +
Sbjct: 231 IVFKGEADQAP-DVIPGDVIFVVSEKPHK----NFQRVGDDLVYEAEIDLLTAVAG--GE 283

Query: 296 FLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWF 355
           F  + + G  L +++  G+VI PG    ++ +G P+  +   +G+L V  KI FPP N F
Sbjct: 284 FSLEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPI-AKFGGYGNLLVTFKINFPP-NHF 341

Query: 356 SEKSDIQLLRNVLP 369
           +   +++ L  +LP
Sbjct: 342 TSDENLKKLEEILP 355

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  172 bits (435), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 116/374 (31%), Positives = 191/374 (51%), Gaps = 34/374 (9%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY +LGV++ A D++IKKAYRK AL+YHPDK    N   E   KFK++T+AYEILSD +K
Sbjct: 7   LYDLLGVSADANDAQIKKAYRKAALKYHPDK----NPSSEAADKFKQMTAAYEILSDSQK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN--------DKSKDVKIPLKL 115
           R  YD +G+                    +  +  +             K +D+K  +  
Sbjct: 63  REVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQKGRDIKHDISC 122

Query: 116 SIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRML 175
           +++ LY G+T K    + ++C  CEG G    K+G+V      +C  C G G K  TR +
Sbjct: 123 TLENLYKGRTAKLALNKTVLCKSCEGRGG---KSGSVK-----KCSSCGGHGVKFVTRQM 174

Query: 176 IPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDT 235
            P  +   +  CE C+G+G+V       K++C+ C GK + +E K L V++  G++N   
Sbjct: 175 GP-MIQRFQTTCEACNGEGDVI----DPKDRCRECSGKKISNERKILEVNIEPGMKNGQK 229

Query: 236 IRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDK 295
           +  + EADQ+ G+   GD++ V+ E         F+R G +      + L  A+ G   +
Sbjct: 230 VVFQGEADQQPGQI-PGDVVFVVNEQ----EHPKFVRNGDNLHYEAQIDLLTAVAG--GQ 282

Query: 296 FLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWF 355
           F  + + G  L + +  G+VI PG +  I+ +G P+    S +G+L +   ++F P + F
Sbjct: 283 FALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGNLLIKFNVKF-PKSHF 340

Query: 356 SEKSDIQLLRNVLP 369
           +  +D++ L  +LP
Sbjct: 341 ASDADLKKLEEILP 354

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  171 bits (434), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 186/376 (49%), Gaps = 36/376 (9%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
            Y +LGV+++A+++EIKKAYRK AL+YHPDK    N  EE   KFKE +SAYE+L D EK
Sbjct: 7   FYDLLGVSATASETEIKKAYRKTALKYHPDK----NPSEEAAEKFKEASSAYEVLMDAEK 62

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYA--FDNDKSK--------DVKIPL 113
           R  YD +G+                        D ++  F    S+        D+K  +
Sbjct: 63  REAYDQFGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGGASRPRGPQRGRDIKHEI 122

Query: 114 KLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTR 173
            ++++ELY G+T K    + I+C  CEG G    K G V      +C  CNG G K  TR
Sbjct: 123 TVTLEELYKGRTSKLALNKQILCKTCEGRGG---KEGAVK-----KCTSCNGQGVKFITR 174

Query: 174 MLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNK 233
            + P  +   +  C+ C G G++     + K++CK C GK + +E K L V V  G+++ 
Sbjct: 175 QMGP-MIQRFQTECDACDGTGDII----NPKDRCKACSGKKVANERKILEVHVDPGMKDG 229

Query: 234 DTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFK 293
             I  + EADQ       GD+I V+ E        HF R   D V    + L  A+ G  
Sbjct: 230 QKIVFKGEADQ-APDIIPGDVIFVVSERPHK----HFRRDSDDLVYEADIDLLTAIAG-- 282

Query: 294 DKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDN 353
            +F  + + G  L + +  G+VI PG    I+ +G PV  +   FG+L V   I FP D+
Sbjct: 283 GEFAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPV-LKYGGFGNLLVKFNIVFPKDH 341

Query: 354 WFSEKSDIQLLRNVLP 369
            F+   +++ L  +LP
Sbjct: 342 -FTSLENMKKLEEILP 356

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  152 bits (385), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 107/386 (27%), Positives = 182/386 (47%), Gaps = 61/386 (15%)

Query: 2   ADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDE 61
           ++LY ILGV++SA+  +IKKAYR  AL++HPDK       EE+++KF++I  AYEIL DE
Sbjct: 7   SELYDILGVSASASRQDIKKAYRVNALKHHPDK---NGHSEESKLKFQQICKAYEILKDE 63

Query: 62  EKRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDY---------DSYAFDND-------- 104
            KR  YD +G A                     D           + +F ND        
Sbjct: 64  RKREMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSFFGKR 123

Query: 105 -------------KSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGN 151
                        +  D+K  LK +++E+Y+GK  K   KR  +C +C+G G  +     
Sbjct: 124 QGAHTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGGLKAS--- 180

Query: 152 VTIPHEIECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCH 211
                  +C  C G G +  T+   P  V T    C DC G+G        +K+ C++C+
Sbjct: 181 -------QCYTCGGRGIRTETKRHGP-MVQTWSSTCSDCAGRGSFM----KQKDICRDCN 228

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKT------GDIILVIEEDTTMP 265
           G+G + E +   + V +G++N   + +  EAD+ +G          GD+I+++E+   +P
Sbjct: 229 GQGCIRERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILEQ---LP 285

Query: 266 SDVHFIRKGTDFVM-YLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKI 324
               +  +    V+ +  + L  +L G    ++     G++L + V  G++++PG I  +
Sbjct: 286 HKAFWRHRDASLVLDHCKVDLKTSLCG-GPVWVDSHPSGKLLKIDVLPGEILKPGAIKCV 344

Query: 325 KQEGWPVNPQASKFGDLYVIIKIEFP 350
           +  G P +    +FG+LY+   + FP
Sbjct: 345 EGMGMPKS--GGRFGNLYIRFDVAFP 368

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  149 bits (375), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 120/438 (27%), Positives = 196/438 (44%), Gaps = 80/438 (18%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           DLY  LGV ++A+  EIKKAYR  AL++HPDK       E++++KF++I  AYEIL D++
Sbjct: 8   DLYDTLGVAANASRQEIKKAYRLKALKHHPDK---NGHSEQSKLKFQQICKAYEILGDDK 64

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDY-----------------------DSY 99
           KR  YD +G A                     D                         S 
Sbjct: 65  KREMYDRFGTADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFSEGMDFFGSSR 124

Query: 100 AFDNDKSK--------DVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGN 151
            F    S+        D+K  LK +++E+YNGK  K   KR  +C  C+G G ++     
Sbjct: 125 GFRAQGSRRSAPQRGPDIKHYLKCTLEEMYNGKRAKLALKRTRLCQTCQGEGSKK----- 179

Query: 152 VTIPHEIECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCH 211
                   C  C G G + +T+   P  + T    C  C G G +  KP+   + C  CH
Sbjct: 180 -----ATSCYACRGKGMQTQTKRQGP-IMQTWSSTCGTCGGSGTI-VKPS---DICNGCH 229

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEI----GKSKT--GDIILVIEEDTTMP 265
           G+G + E K   + V +G++N  T+ +  EAD+ +    G  +   GD+I+++E+   +P
Sbjct: 230 GQGWVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVIIILEQ---LP 286

Query: 266 SDVHFIRKGTDFVMYLS---LSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNII 322
                +++G D  + LS   + L  +L G    ++     G++L + V  G++++PG I 
Sbjct: 287 H--RSLKRGHDSSLLLSECQVDLKTSLCG-GTVWVDSHPSGKVLKIDVIPGELLKPGAIK 343

Query: 323 KIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPSGINGMMNSWKID 382
            ++  G P +     +GDL++  K+ FP               N+ P  I  M  +   +
Sbjct: 344 CVQSMGMPKS--KGGYGDLFIKFKVIFPD--------------NLKPDTIQTMQAALDKE 387

Query: 383 DPLNTETVTTFDILEELP 400
             + T   T  +I E +P
Sbjct: 388 PSMQTSATTQPEIDEGIP 405

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  145 bits (367), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 177/385 (45%), Gaps = 59/385 (15%)

Query: 2   ADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDE 61
            +LY  L ++  AT  EIKKAYR  AL+ HPDK    N  E+++ KF+EI  AYEIL D 
Sbjct: 7   TELYDTLNISVDATPQEIKKAYRLAALKSHPDK---NNHSEDSKRKFQEICKAYEILGDA 63

Query: 62  EKRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYA-------------FDND---- 104
           +K+  YD YG                   +     D ++             F ND    
Sbjct: 64  KKKLLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFNDDTMF 123

Query: 105 ------------KSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNV 152
                       +  D+K  L+ S++ELY+GK  K +  R  +C  C+G       NG  
Sbjct: 124 FTGKKNSQRRVSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTCKG-------NGGT 176

Query: 153 TIPHEIECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHG 212
           +      C+ CNG G+  +TR   P  V T    C+DC G G    +    K+ C  C G
Sbjct: 177 S---SSACRACNGQGFYTQTRRHGP-MVQTWSTTCQDCGGSGTFVRR----KDVCSECKG 228

Query: 213 KGLLSENKQLLVSVPRGLQNKDTIRIENEADQEI----GKSKT--GDIILVIEEDTTMPS 266
           +G + E K   + V  G+ +   I +  EAD+ +    GK +   GD+I+++++   +  
Sbjct: 229 QGCIKERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQQ---VKH 285

Query: 267 DVHFIRKGTDFVMY-LSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIK 325
            +  I   TD VM    + L  +L G  +  +     G  L + V  G++++PG +  ++
Sbjct: 286 PLFQIHNDTDLVMNDCHVDLKTSLCG-GEVLIENHPCGSALKIEVLPGEILKPGCVKCVE 344

Query: 326 QEGWPVNPQASKFGDLYVIIKIEFP 350
             G P +PQ+  FG+LY+  +++FP
Sbjct: 345 SMGMP-HPQSQGFGNLYIRFQVDFP 368

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  137 bits (345), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 112/365 (30%), Positives = 171/365 (46%), Gaps = 40/365 (10%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y+ILGV   A+D +IK AYR+L+ +YHPDK  +P D E+   +F E+  AYE LSD E
Sbjct: 21  DYYAILGVGRGASDKDIKSAYRQLSKKYHPDK--NPGD-EDAHNRFIEVGEAYEALSDPE 77

Query: 63  KRAHYDLYG-DAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN---------------DKS 106
           KR  YD +G +A                  D  D     F                  + 
Sbjct: 78  KRKIYDQFGAEALKNGGDRAGGGGAGGGFHDPFDIFDQMFGGGAGSRFHGGGGQRRKQRG 137

Query: 107 KDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGL 166
           + +++  +L++++ Y+G + +F    N  C  C+G G    ++G V      +C +C G 
Sbjct: 138 QSLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSG---SQDGKVE-----KCGQCGGR 189

Query: 167 GYKERTRMLIPGFVTTD-KIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVS 225
           G     +++  GF+T   +  C+ C G+GEV       KNKCK CHG  ++ +NK   V 
Sbjct: 190 GMV--VQVIRQGFITQQIQQMCQKCEGRGEVI------KNKCKTCHGSKVVKKNKSFHVD 241

Query: 226 VPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSL 285
           VP G        I  EA++    ++ GDI + + E      ++ + R+G D      LSL
Sbjct: 242 VPAGAPRDFVAVIRGEAEKSP-DTEPGDIYVKVVESPV--QNMGYRRRGPDLFRTEVLSL 298

Query: 286 AEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVII 345
            EAL G   + L      + + LS   G  ++ G +  IK  G P+    +K+GDLYV  
Sbjct: 299 TEALKGGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPLE-SGTKYGDLYVDY 357

Query: 346 KIEFP 350
            I  P
Sbjct: 358 VIVMP 362

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  134 bits (337), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 109/368 (29%), Positives = 172/368 (46%), Gaps = 43/368 (11%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y ILGV   A D EIK AYR+L+ +YHPDK  +P D EE   KF E+  AY++LSD E
Sbjct: 22  DYYKILGVNKDANDKEIKSAYRQLSKKYHPDK--NPGD-EEAHNKFIEVGEAYDVLSDSE 78

Query: 63  KRAHYDLYG-DAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDND----------------K 105
           KR  YD YG DA                  D  +     F+ +                +
Sbjct: 79  KRNIYDQYGADAIKNGGNGQRPGGGGSPFHDPFEMFEKMFNGNPFGGAARGGPGGRGRPR 138

Query: 106 SKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNG 165
            +++ +  ++S+ + YNG+ FK+  + N  C +C G G    K+G VT      C  C G
Sbjct: 139 GQNLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTG---SKDGKVT-----RCPDCQG 190

Query: 166 LGYKERTRMLIPGFVTTDKIR--CEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLL 223
            G       +I   + T +I+  C+ C G GE+       KN C +CHG  +   +K+  
Sbjct: 191 RGV---IVQVIQMGIMTQQIQHVCDRCSGSGEII------KNPCPHCHGHKVAKMDKEFT 241

Query: 224 VSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSL 283
           V +P G Q ++ + I++   ++      GD++    E++   +++ + R+G        L
Sbjct: 242 VKLPNGAQ-RNYVDIKHGEAEKGADFDAGDLMFEFRENSM--NNMGYRRRGDHLYRTEVL 298

Query: 284 SLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV-NPQASKFGDLY 342
           S+ EAL G  ++ L      + + L   + +V+  G I  +   G P+ N Q  KFGDL+
Sbjct: 299 SVQEALKGGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDLF 358

Query: 343 VIIKIEFP 350
           +   I  P
Sbjct: 359 IDYVILMP 366

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  134 bits (336), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 111/387 (28%), Positives = 170/387 (43%), Gaps = 61/387 (15%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY +L V+  A+  EI+KAYR LAL++HPDK    N  EE++ KF E+  AYEIL DE+K
Sbjct: 7   LYDVLNVSPEASAVEIRKAYRLLALKHHPDK---NNHSEESKSKFLEVNEAYEILIDEKK 63

Query: 64  RAHYDLYG--------------DAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN------ 103
           R+ YD YG              D                      D  +  FD       
Sbjct: 64  RSLYDQYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDKMSSPSF 123

Query: 104 ---------DKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTI 154
                    D   D+K  LK ++  LY GK  K    R  +C  C+G G  + +      
Sbjct: 124 GGKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRGSMKVRT----- 178

Query: 155 PHEIECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKG 214
                CK C G G + R+R + P   T  +  C DC+G G        + + C++C G+G
Sbjct: 179 -----CKACRGRGQQSRSRQMGPMMQTWTQT-CSDCNGMGTF----TKDSDVCRDCEGEG 228

Query: 215 LLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSK-------TGDIILVIEEDTTMPSD 267
            + E K   V V  G+     I +  EAD E+ K++        GD+I+ I +    P  
Sbjct: 229 CIRERKIFDVEVKPGMCQGQQIILPGEAD-EVIKTRFGNETVIPGDVIITIIQ-IKDPKF 286

Query: 268 VHFIRKGTDF-VMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQ 326
               R G D  V    + L  +L G K   +    +G+++ +++  G++I+P +   I+ 
Sbjct: 287 QRVNRNGCDLMVRNCKIPLVTSLCGGKLS-IDGHPNGKLINVTILPGELIKPNHFKSIEN 345

Query: 327 EGWPVNPQASK---FGDLYVIIKIEFP 350
            G P   +      +G+LY+  ++EFP
Sbjct: 346 LGMPRYEEKRAPEGYGNLYIQFQVEFP 372

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score =  129 bits (323), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 103/368 (27%), Positives = 157/368 (42%), Gaps = 43/368 (11%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D YSILG+   A+D ++K AYR+L+ +YHPDK  +P D   ++ +F E+  AYE+LSD E
Sbjct: 19  DYYSILGLNKDASDKDVKSAYRQLSKKYHPDK--NPGDESAHQ-RFIEVGEAYEVLSDPE 75

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSY------------------AFDND 104
           KR  +D YG                        +D +                       
Sbjct: 76  KRGIFDQYGADGLKNGAGGGGGPGGGFGGFHDPFDIFEQMFNRGGGGGGFGGGFGGMHRG 135

Query: 105 KSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCN 164
           K   +++  +LS+++ Y+G   +F+   N IC  CEG G    ++G V       C  C 
Sbjct: 136 KGPSLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSG---SEDGKVET-----CPDCG 187

Query: 165 GLGYKERTRMLIPGFVTTDKIR--CEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQL 222
           G G       +I   + T +I+  C  C G+G +       KN+CK C G  ++ + K  
Sbjct: 188 GQGI---LIQIIRMGIMTQRIQQPCGRCSGRGHII------KNQCKACGGHKVVKKPKSF 238

Query: 223 LVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLS 282
            V VP G           EADQ     + GDI +   E     +++ + R+G        
Sbjct: 239 QVEVPAGAPRDHVEVRHQEADQST-DMEAGDIFVEFTESDK--NNMGYRRRGDHLFRTEV 295

Query: 283 LSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLY 342
           LS  EAL G   + +    D + + L  P G ++  G I +I   G P       FGDL+
Sbjct: 296 LSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKSFGDLF 355

Query: 343 VIIKIEFP 350
           V   +  P
Sbjct: 356 VEYAVVMP 363

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score =  127 bits (319), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 159/364 (43%), Gaps = 39/364 (10%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y+ILG+   A+D EIK +YR+L+ ++HPDK  +P D EE   KF EI  AYE+LSD E
Sbjct: 21  DYYAILGLNKDASDKEIKSSYRQLSKKFHPDK--NPGD-EEAHHKFIEIGEAYEVLSDPE 77

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDND--------------KSKD 108
           KR  +D YG                    D  D     F+                +  +
Sbjct: 78  KRKIFDQYGADALKNGGPGGPGGGGGGFNDPFDIFEQMFNRGGGGGGGGFGRMQRPRGHN 137

Query: 109 VKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGY 168
           +K+  +LS++E Y G T +F    N IC  C+G G     +G V      +C  C G G 
Sbjct: 138 LKVREQLSLKEYYTGATLEFTLALNDICDHCDGTG---SADGKVA-----KCSDCQGRGV 189

Query: 169 KERTRMLIPGFVTTDKIR--CEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSV 226
                 +I   + T +I+  C  C GKG V       KN CK CHG  ++ + K   V V
Sbjct: 190 ---VIQVIRMGMMTQQIQQMCGRCGGKGSVI------KNHCKTCHGSKVVKKQKPFHVEV 240

Query: 227 PRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLA 286
           P G     T     E+D+       GD+ +   E TT  +++ + R+G        LS  
Sbjct: 241 PPGAARHYTETRSGESDKG-ADFDAGDVFIEFNEKTT--NNLGYRRRGPHLYRTEVLSAR 297

Query: 287 EALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIK 346
           EAL G   + +    + + + ++     V+  G + +I   G P       FGDL++   
Sbjct: 298 EALKGDWQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGMPQPNGKHAFGDLFIEYV 357

Query: 347 IEFP 350
           +  P
Sbjct: 358 VVMP 361

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  127 bits (318), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 166/364 (45%), Gaps = 39/364 (10%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D YSILGV+  A D +IK AYR+L+ +YHPDK  +P+D   +  KF E+  AYE+LSD E
Sbjct: 20  DYYSILGVSKGAGDKDIKSAYRQLSKKYHPDK--NPDDDSAHN-KFIEVGEAYEVLSDPE 76

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSY------------AFDNDKSKDVK 110
           KR  YD YG                        +D +                 +  +++
Sbjct: 77  KRKIYDQYGAEALKNNGGQGGGQGPRGGGFHDPFDIFEQMFGGGGGGQRQRRRARGHNLE 136

Query: 111 IPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKE 170
              +L+++E Y G +  F    N  C  CEG G    ++G VT     +C  C G G   
Sbjct: 137 TREELTLKEYYRGTSIDFNLNLNDFCEHCEGSG---SQDGKVT-----KCPDCKGHGVVV 188

Query: 171 RTRMLIPGFVTTDKIR--CEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPR 228
           +   + P    T +I+  C  C G+G      ++ KNKCK+CHG+ ++ + K   V VP 
Sbjct: 189 QIVRMGP---VTQQIQQMCGKCQGRG------STIKNKCKHCHGEKVVRKPKSFHVDVPP 239

Query: 229 GLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEA 288
           G   ++ + ++     +      GD+ +   E  T   ++ + R+G D     +LSL EA
Sbjct: 240 GAP-RNFVEVKQGESDKGPDFDAGDLFIKFSE--TSRDNLGYRRRGDDLFRTEALSLREA 296

Query: 289 LTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIE 348
           L G  ++ +      R + +   S  V   G I +I   G P   + +KFGDLY+   + 
Sbjct: 297 LKGGWEREIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMP--KEHNKFGDLYIDYVVI 354

Query: 349 FPPD 352
            P D
Sbjct: 355 VPDD 358

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  125 bits (315), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 97/378 (25%), Positives = 160/378 (42%), Gaps = 52/378 (13%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY +LGV    + +E+KK+Y+  AL+YHPDK       E ++ +F++I  AY +L DE  
Sbjct: 7   LYDVLGVQPGVSAAELKKSYKLAALRYHPDK---NGHSEASKQRFQQIADAYRVLGDERL 63

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXXTDQP-DYDSYAFDN------------------- 103
           R  YD YG                      P D  ++ F +                   
Sbjct: 64  RKIYDRYGTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLGSFAIFGESGASSAR 123

Query: 104 ----DKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIE 159
                +  D+K  L+ +++ELY GK  +    R  +C  C G G  R             
Sbjct: 124 CSRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRGGSRAST---------- 173

Query: 160 CKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSEN 219
           C  C+G G   +T+      V T    C  C G G +      + + C +C G G L E 
Sbjct: 174 CTACSGQGICSQTKRQ-GSLVQTWSSTCRVCSGSGTIV----KDCDTCTSCGGAGYLRER 228

Query: 220 KQLLVSVPRGLQNKDTIRIENEADQEI----GKSKT--GDIILVIEEDTTMPSDVHFIRK 273
           K   V +  G++    +    EAD+ +    GK +   GD+ + IEE T  P+  +  R 
Sbjct: 229 KVFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEAT--PATRYQCRG 286

Query: 274 GTDFVMY-LSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVN 332
             + ++  L + L  +L G    ++     G+++ L +  G+++ PG I  I+  G P  
Sbjct: 287 DANLLLTELHVDLRTSLCG-GTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMPHP 345

Query: 333 PQASKFGDLYVIIKIEFP 350
              S++G L++   ++FP
Sbjct: 346 DDPSQYGHLFIKFHVDFP 363

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  124 bits (310), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 117/399 (29%), Positives = 170/399 (42%), Gaps = 74/399 (18%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60
           M  LY +LGV S A+ SEIKKAYRKLAL+YHPDK    N  E+    F++I+ AY +L D
Sbjct: 1   MESLYDVLGVASDASQSEIKKAYRKLALRYHPDK---NNGDEKCHEAFQKISHAYGVLGD 57

Query: 61  EEKRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDN----------------- 103
             +R  YD  GD                  ++  D  S  F+                  
Sbjct: 58  VAQRQRYDQSGD---------ENESLQPTGSNAADLFSSFFNGGGVYPSGSSGGPGPSRG 108

Query: 104 -DKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKK 162
             +  ++   LK ++Q+LY GK  K   +R   C +C  LG       NV       C  
Sbjct: 109 PSRGPNIIHELKCTLQDLYRGKVIKLALRRTAPCERCS-LGA-----ANV-------CSS 155

Query: 163 CNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQL 222
           CNG G   R   + P    T    C  C G+G +          C  C G   L+E    
Sbjct: 156 CNGSGNITRIERVGP-LTQTWSSTCNACQGQGRMSVD-------CSQCGGAQYLNERVVF 207

Query: 223 LVSVPRGLQNKDTIRIENEADQ-------EIGKSKTGDIILVIEEDTTMPSDVHFIRKGT 275
            V V  G+ +  TI ++ EADQ        +  +++GD+++VI E     +D  F R   
Sbjct: 208 KVHVKPGMHDGQTIVLDGEADQCVRDRLGHLTVAESGDVVIVIRE----LADAKFKRSAL 263

Query: 276 D-----FVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIK-IKQEGW 329
           +     FV  + + L  ALTG  +  L     G ++ +++  G+ + P N IK ++  G 
Sbjct: 264 NKRENLFVDQVKVDLTTALTG-GNVLLEDHPSGNLMKINILPGEFL-PENCIKCVEGLGM 321

Query: 330 PVNPQASKFGDLYVIIKIEFPPDNWFSEKSDIQLLRNVL 368
           P++    + GDLY+      P      E   I  LR VL
Sbjct: 322 PIDDTGQR-GDLYIRFCTHSPLQ---LEPETIDKLREVL 356

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score =  122 bits (305), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 104/375 (27%), Positives = 170/375 (45%), Gaps = 51/375 (13%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y ILG+   A++  IK AYR+L+ +YHPDK  + ND EE    F EI  AYE+LSD E
Sbjct: 29  DYYKILGIPKEASEKAIKSAYRQLSKKYHPDK--NQND-EEAHNHFIEIGEAYEVLSDPE 85

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDND------------------ 104
           KR  YD +G +                      +D +   N                   
Sbjct: 86  KRRTYDQFG-SDAFQNGGQGQGGPGGPGGPGGFHDPFDLFNQMFGGNKGNFGGFGGFGGG 144

Query: 105 --------KSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPH 156
                   K++ +++   LS++E + G    FQ      C  C+G G    ++G V    
Sbjct: 145 GFADDRRRKAQSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSG---SEDGKVD--- 198

Query: 157 EIECKKCNGLGYKERTRMLIPGFVTTD-KIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGL 215
             +CK+C G G+  +   + P  VT     +C  CHG G      ++ KN CK CHG+ L
Sbjct: 199 --KCKECGGNGFVVQVIRMGP--VTQQMHTQCPKCHGAG------STIKNHCKKCHGQKL 248

Query: 216 LSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGT 275
           ++++K++ V VP G        +EN  D+E+  ++ GD+++  +E     +++ + R+G 
Sbjct: 249 VTKSKEINVKVPAGAPRDFLKIVENGGDKEL-NAEAGDLLVQFQE--IAQNNLGYRRRGN 305

Query: 276 DFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQA 335
           D     +L   +A+ G  ++ +      R + +S   G  +    I K+   G P+   +
Sbjct: 306 DLFRTEALVFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPIQ-GS 364

Query: 336 SKFGDLYVIIKIEFP 350
            +FGDLY+   I  P
Sbjct: 365 DRFGDLYIDYVIIVP 379

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score =  120 bits (300), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 102/364 (28%), Positives = 157/364 (43%), Gaps = 39/364 (10%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y IL +   ATD +I+ AYR+L+ +YHPDK  +PND E+   KF E+  AYEILSD E
Sbjct: 22  DYYKILELDKDATDKDIRSAYRQLSKKYHPDK--NPND-EDAHHKFIEVGQAYEILSDPE 78

Query: 63  KRAHYDLYGDAXXXXXXXX--------------XXXXXXXXXTDQPDYDSYAFDNDKSKD 108
           KR  YD +G                                       + +     + ++
Sbjct: 79  KRQRYDQFGPEGVNGQNGGGPGGAGFHDPFDIFEQMFGGGGGMGGHGGNPFQQQRQRGQN 138

Query: 109 VKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGY 168
           V      S++  YNG   KF    N IC  C G G     +G  T     +C  C G G 
Sbjct: 139 VVARESTSLKNYYNGYVLKFSINLNDICDHCHGSG---SNDGKST-----KCPDCQGRGV 190

Query: 169 KERTRMLIPGFVTTDKIR--CEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSV 226
              T  +I   + T +I+  C  C GKG++       KN CK CHG  ++ + K   + +
Sbjct: 191 ---TVQVIRMGMMTQQIQQVCGKCGGKGQII------KNPCKTCHGSKVVQKPKDFEIEL 241

Query: 227 PRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLA 286
           P G   K  +  E+ A  +     +GD+ +   E+     ++ + R+G        L+  
Sbjct: 242 PAGAPRK-FVHAEHGAADKHPDYDSGDVYIEFTENDK--DNMGYRRRGPHLYRTEVLNAT 298

Query: 287 EALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIK 346
           EAL G  ++ L+     +I+T+     K+I+ G   +I   G P+      FGDL++   
Sbjct: 299 EALYGGWERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDLFIDYV 358

Query: 347 IEFP 350
           +  P
Sbjct: 359 VVMP 362

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score =  115 bits (289), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 98/349 (28%), Positives = 162/349 (46%), Gaps = 33/349 (9%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y+ILG++  A+D EIK AYR+L+ +YHPDK  +P D EE   KF E+  AY+IL D E
Sbjct: 20  DYYAILGLSKDASDKEIKSAYRQLSKKYHPDK--NPGD-EEAHHKFIEVGEAYDILGDPE 76

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAF--------DNDKSKDVKIPLK 114
           KR  YD++G                    D  D     F           +S++ ++  +
Sbjct: 77  KRKTYDVHG---ADAFKNGGQGQRGGGFHDPFDMFEQMFGRQGGGFRQTQRSQNYQVRNQ 133

Query: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174
           +S++E Y+G   +F+   N IC  C G G     +G V +     C  C G G       
Sbjct: 134 VSLKEFYSGGEVEFEIPLNDICDSCHGSG---SADGKVKV-----CPACQGRG------- 178

Query: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234
           ++   +    I  +     G+   K  + +N CK C G  ++ +NK      P G+    
Sbjct: 179 VVVQVIRMGPITQQIQQQCGQCGGKGKTIENPCKTCKGHKVVRKNKPFHFEFPGGIPRNH 238

Query: 235 TIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKD 294
             +   E+D+     ++GDII  IE + +   ++ + R+G +      ++  EA+ G   
Sbjct: 239 IDKKSGESDKS-PDMESGDII--IEYNESEKENLGYRRRGNNLYRTEIITANEAINGGWT 295

Query: 295 KFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYV 343
           + +    + + + LS P G ++  G+I +IK  G P+   +  FGDLY+
Sbjct: 296 REIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIM-GSKNFGDLYI 343

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score =  115 bits (289), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 105/371 (28%), Positives = 163/371 (43%), Gaps = 53/371 (14%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y+IL +   AT+ EIK AYR+L+ +YHPDK       EE   KF E+  AY++LSD E
Sbjct: 23  DYYAILEIDKDATEKEIKSAYRQLSKKYHPDK---NAGSEEAHQKFIEVGEAYDVLSDPE 79

Query: 63  KRAHYDLYG-DAXXXXXXXXXXXXXXXXXTDQP-DYDSYAFD--------------NDKS 106
           K+  YD +G DA                    P D     F                 + 
Sbjct: 80  KKKIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMFQGGHGGPGGGFGQRQRQRG 139

Query: 107 KDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGL 166
             +K+  KLS+++ Y+G + +F    N  C  C G G     +G +      +C  C G 
Sbjct: 140 PMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSG---SADGKLA-----QCPDCQGR 191

Query: 167 GYKERTRMLIPGFVTTD-KIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVS 225
           G     ++L  G +T   +  C  C G G++       KN+CK CHGK +  +NK   V 
Sbjct: 192 GVI--IQVLRMGIMTQQIQQMCGRCGGTGQII------KNECKTCHGKKVTKKNKFFHVD 243

Query: 226 VPRGLQNKDTIRIENEADQEIGKSK------TGDIILVIEEDTTMPSDVHFIRKGTDFVM 279
           VP G          N  D  +G+++       GD+++  +E  T   ++ + R+G +   
Sbjct: 244 VPPGAPR-------NYMDTRVGEAEKGPDFDAGDLVIEFKEKDT--ENMGYRRRGDNLYR 294

Query: 280 YLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFG 339
              LS AEAL G   + +    + + + LS P+  V+  G +  +K  G P   +   +G
Sbjct: 295 TEVLSAAEALYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKG--YG 352

Query: 340 DLYVIIKIEFP 350
           DLY+   +  P
Sbjct: 353 DLYIDYVVVMP 363

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score =  115 bits (288), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 104/363 (28%), Positives = 157/363 (43%), Gaps = 39/363 (10%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y ILGV+  A+D EIK AYR+L+ ++HPDK  +P D E+   KF E+  AYE+LSD++
Sbjct: 25  DYYGILGVSKDASDKEIKSAYRQLSKKFHPDK--NPGD-EDAHHKFIEVGEAYEVLSDDQ 81

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXT----DQPDYDSYAFDNDKSK---------DV 109
           KR  YD +G                        D  D     F   +           ++
Sbjct: 82  KRQIYDQHGAEALKNGGPGGPGGPGGGFGGGFHDPMDIFEQMFGGHRGGGGRGRPRGHNL 141

Query: 110 KIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYK 169
           +   +L++++ Y G +  F    N  C  C G G    ++G  T      C +C G G  
Sbjct: 142 EAREELTLKQYYQGTSLDFTLNLNDFCENCHGSG---SQDGKTT-----HCSECRGQGVV 193

Query: 170 ERTRMLIPGFVTTDKIR--CEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVP 227
            +   + P    T KI+  C  C GKG+V       KNKCK CHG  +  + K   V VP
Sbjct: 194 IQVVRMGP---LTQKIQQMCGACQGKGQVI------KNKCKRCHGAKVERKAKHFHVDVP 244

Query: 228 RGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAE 287
            G   +D + ++     +     +GD+ +   E +    ++ + R+G        LSL E
Sbjct: 245 AGAP-RDFVDVKAGEADKGPDFDSGDVFIKFSESSR--DNMGYRRRGPHLYRTEVLSLKE 301

Query: 288 ALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKI 347
           AL G   + +      + L L    G  +R G I ++   G P      K GDL+V   +
Sbjct: 302 ALLGGWKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPTGGHG-KHGDLFVDYVV 360

Query: 348 EFP 350
             P
Sbjct: 361 VIP 363

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score =  115 bits (288), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 108/382 (28%), Positives = 168/382 (43%), Gaps = 54/382 (14%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y ILG++ +  + EIK AYR+L+ ++HPDK  +PND E+   KF EI  AYE+LSD E
Sbjct: 23  DYYKILGLSKNCNEKEIKSAYRQLSKKFHPDK--NPND-EDAHNKFIEIGEAYEVLSDPE 79

Query: 63  KRAHYDLYG-DAXXXXXXXXXXXXXXXXXTDQPDYDSY---------------------- 99
           KR  YD +G DA                    P +D +                      
Sbjct: 80  KRRMYDQFGADAVKNGGPGGPGGPGGPGGFHDP-FDLFEQMFGGGHGGGFGGFGGFGGFG 138

Query: 100 ----AFDNDKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIP 155
                    + + +K+   L++++ YNG +  F    N  C  C G G    ++G V   
Sbjct: 139 GGQQHQGKQRGQSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSG---SEDGKVK-- 193

Query: 156 HEIECKKCNGLGYKERTRMLIPGFVTTD-KIRCEDCHGKGEVYAKPNSEKNKCKNCHGKG 214
              +C  C G G     +++  G VT   + RC  C G GE+       +NKCK C G  
Sbjct: 194 ---KCPDCGGRGVV--IQVIRMGIVTQQVQQRCNRCAGSGEII------QNKCKVCSGAK 242

Query: 215 LLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKG 274
           +  + K + VS   G++       + EA++  G  + GD  L++E      +++ + R+G
Sbjct: 243 VQKKEKDISVSFDSGIERNHISVQQGEAEKGPG-IEPGD--LIVEFFEVPEANMGYRRRG 299

Query: 275 TDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQ 334
            D      L+L EA+ G   + +      + L L      ++  G + KI   G P+   
Sbjct: 300 KDLFRTEVLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMPILGS 359

Query: 335 ASKFGDL---YVIIKIEFPPDN 353
             KFGDL   YV+IK    P++
Sbjct: 360 KGKFGDLYIDYVVIKPHVDPNS 381

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  114 bits (285), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 107/369 (28%), Positives = 157/369 (42%), Gaps = 51/369 (13%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y+IL +   A++ EIK AYR+L+ +YHPDK       +E   KF EI  AYE+LSD E
Sbjct: 23  DYYAILDIGKDASEKEIKSAYRQLSKKYHPDK---NAGSDEAHHKFIEIGEAYEVLSDPE 79

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFD--------------NDKSKD 108
           K+  YD +G                    D  D     F                 +   
Sbjct: 80  KKKIYDQFGADAVKNGGGGAGGPGGGGFHDPFDIFERMFQGGQGGPGGGFGQRQRQRGPT 139

Query: 109 VKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGY 168
           +K+   LS+++ Y+G + +F    N  C  C G G     +G +      +C  C G G 
Sbjct: 140 IKVHENLSLKQFYSGTSIEFTLSLNDECDGCHGSG---SADGKLA-----QCPDCQGRGI 191

Query: 169 -KERTRMLIPGFVTTDKIR--CEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVS 225
             +  RM I     T +I+  C  C G G+V       KN+CK CHGK +  +NK   V 
Sbjct: 192 IVQVVRMGI----MTQQIQQICGRCAGTGQVI------KNQCKTCHGKKVTKKNKFFHVD 241

Query: 226 VPRGLQNKDTIRIENEADQEIGKSKTGDII----LVIEEDTTMPSDVHFIRKGTDFVMYL 281
           VP G          N  D   G+++ G       LVIE       ++ + R+G +     
Sbjct: 242 VPPGAPR-------NYMDTRAGEAEKGPDFDAGDLVIEFREMDTENMGYRRRGHNLYRTE 294

Query: 282 SLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDL 341
            LS AEAL G  ++ +    + + + LS P+  V+  G I  +K  G P    +   GDL
Sbjct: 295 VLSAAEALYGGWERTIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMPKG--SRDHGDL 352

Query: 342 YVIIKIEFP 350
           Y+   +  P
Sbjct: 353 YIDYVVVMP 361

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score =  112 bits (279), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 104/368 (28%), Positives = 162/368 (44%), Gaps = 46/368 (12%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y+IL V   A++ EIK AYR+L+ +YHPDK    +  EE   KF E+  AY++LSD E
Sbjct: 23  DYYAILEVDKDASEKEIKSAYRQLSKKYHPDK---NSGSEEAHHKFIEVGEAYDVLSDPE 79

Query: 63  KRAHYDLYG-DAXXXXXXXXXXXXXXXXXTDQPDYDSYAF----------------DNDK 105
           K+  YD +G DA                      +D +                     +
Sbjct: 80  KKKIYDQFGADAVKNGGGGGGGAGGPGGGGFHDPFDIFEHMFQGGHGGPGGGFGQRQRQR 139

Query: 106 SKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNG 165
              +K+  KLS+++ Y+G + +F    N  C  C G G     +G +      +C  C G
Sbjct: 140 GPMIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSG---SADGKLA-----QCPDCQG 191

Query: 166 LGYKERTRMLIPGFVTTD-KIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLV 224
            G     ++L  G +T   +  C  C G G++       KN+CK CHGK ++ +NK   V
Sbjct: 192 RGVI--IQVLRMGIMTQQIQQMCGRCGGTGQII------KNQCKTCHGKKVIKKNKFFHV 243

Query: 225 SVPRGLQNK--DTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLS 282
            VP G      DT   E E   +      GD+++  +E  T   ++ + R+G +      
Sbjct: 244 DVPPGAPRNYLDTRAGEAEKGPDF---DAGDLVIEFKEKDT--ENMGYRRRGDNLYRTEV 298

Query: 283 LSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLY 342
           LS  EAL G   + +    + + + LS P+  V+  G I  +K  G P + +    GDLY
Sbjct: 299 LSAEEALYGGWQRTIEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMPKSGKGH--GDLY 356

Query: 343 VIIKIEFP 350
           +   +  P
Sbjct: 357 IDYVVIMP 364

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  110 bits (276), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 98/363 (26%), Positives = 157/363 (43%), Gaps = 36/363 (9%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y+ILGV   A++ EIK AYR+L+ +YHPDK  +P + E +   F E+  AY++LSD E
Sbjct: 20  DYYAILGVDKQASEKEIKSAYRQLSKKYHPDK--NPGNDEAHH-HFIEVGEAYDVLSDPE 76

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDND---------KSKDVKIPL 113
           KR  YD +G A                  D  D     F ++         + +++++  
Sbjct: 77  KRQIYDRHG-ADALKNGHPGGPGGGNGFHDPFDLFEQMFGSNMYNRARGKPRGQNLQVNH 135

Query: 114 KLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTR 173
            +S++  Y G  F+F    N IC  C+G G    K           C  C G G   +  
Sbjct: 136 DISLKTFYLGTEFEFTLNLNDICDACDGSGSEDGKTET--------CPDCGGSGQIMKVF 187

Query: 174 MLIPGFVTTDKIR--CEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQ 231
              P      ++R  C  C G+G++       K+ CK C G  ++ ++K     V  G++
Sbjct: 188 RAGP---IEQRVRQPCSRCQGRGQLI------KHVCKKCKGVKVVQKSKVFTAKVEPGME 238

Query: 232 NKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTG 291
            ++ I +     ++    + GD+     E  +    + + R+G        LS  EAL G
Sbjct: 239 -RNHIHVMQGQSEKHPDIEPGDLYQYFRE--SEKDSMGYRRRGNTLYRTEILSFKEALQG 295

Query: 292 FKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPP 351
             ++ +      + L LS P G  ++ G    IK  G P+     KFGDL +I  +   P
Sbjct: 296 GWERNIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPIPSATDKFGDL-IIDYVILLP 354

Query: 352 DNW 354
             W
Sbjct: 355 GEW 357

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score =  110 bits (275), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 103/383 (26%), Positives = 166/383 (43%), Gaps = 48/383 (12%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y+ILGV+  A++ EIK AYR+L+ +YHPDK  +P D E    KF E+  AYE+LSD++
Sbjct: 24  DYYAILGVSKDASEKEIKSAYRQLSKKYHPDK--NPGD-ETAHHKFIEVGEAYEVLSDDQ 80

Query: 63  KRAHYDLYG-DAXXXXXXXXXXXXXXXXXTDQPDYD--------------SYAFDNDKSK 107
           KR  Y+ YG +A                      +D                     +  
Sbjct: 81  KRQIYNQYGAEALKNGGPGGSGGPGGPGGFGGGFHDPMDIFEQMFGAQRGGGGRGRPRGH 140

Query: 108 DVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLG 167
           +++   +++++E Y G +  F    N  C  C+G G    ++G  T      C  C G G
Sbjct: 141 NLEAREEITLKEYYQGTSLDFTLNLNDFCDNCKGTG---SQDGKTT-----RCSDCQGQG 192

Query: 168 YKERTRMLIPGFVTTDKIR--CEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVS 225
              +   + P    T +I+  C  C GKG++       KNKCK CHG  +  + K   V 
Sbjct: 193 VVIQIIRMGP---ITQQIQQMCGACQGKGQII------KNKCKQCHGAKVERKTKHFHVD 243

Query: 226 VPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSL 285
           VP G   +D + ++N    +      GD+ +   E +    ++ + R+G        L+L
Sbjct: 244 VPAGAP-RDFVDVKNGEADKGPDFDAGDVYIKFSESSR--DNMGYRRRGVHLHRTEVLTL 300

Query: 286 AEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVII 345
            EAL G   + +      + + L   +G  +R G   ++   G P +     FGDL+V  
Sbjct: 301 KEALQGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMPKD--GRHFGDLFVDY 358

Query: 346 KIEFPPDNWFSEKSDIQLLRNVL 368
            +  P       K   QL+++ L
Sbjct: 359 VVLTP------HKVSAQLIKDEL 375

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score =  108 bits (269), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 101/380 (26%), Positives = 165/380 (43%), Gaps = 48/380 (12%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y ILG+   ATD EIK AYR+L+ ++HPDK  +P + + ++ KF E+  AYE+LSD +
Sbjct: 21  DYYQILGIAKDATDKEIKSAYRQLSKKFHPDK--NPGNEDAHQ-KFIEVGEAYEVLSDPQ 77

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDY--------------DSYAFDNDKSKD 108
           KR  +D +G A                  D  D                       +  +
Sbjct: 78  KRQTFDQFG-ADAVKNGGQGQPGGGAQFHDPFDIFEQMFGGQGGGGNPFGGQRQKPRGPN 136

Query: 109 VKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGY 168
           +    ++S+++ Y G    F    N +C  C G G     +G +T      C  C G G 
Sbjct: 137 IMAREEISLKDYYTGYELNFTLNVNDLCDHCHGTG---SDDGKLT-----PCPDCQGRGV 188

Query: 169 KERTRMLIPGFVTTDKIR--CEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSV 226
                 LI   + T +I+  C  C GKG+++      K +C+ CHG  ++ + K+  V +
Sbjct: 189 ---IIQLIRMGMMTQQIQQMCGRCGGKGQLF------KKQCRKCHGNKVMPQKKEFQVKL 239

Query: 227 PRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLA 286
           P+G +         EAD+     + GD+++   E+    S++ + R+G +      L++ 
Sbjct: 240 PKGAKRHYMDVKHGEADKNP-DLEAGDLLIEFNENDK--SNMGYRRRGQNLYRTEVLNVT 296

Query: 287 EALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNP-QASKFGDL---Y 342
           EAL G   + +      + L +   S  V+  G + +I   G P    +   FGDL   Y
Sbjct: 297 EALYGGWQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDLFIDY 356

Query: 343 VIIKIEFPPDNWFSEKSDIQ 362
           V+I     P  W    S I+
Sbjct: 357 VVIM----PKQWNKVSSSIR 372

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  107 bits (267), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 101/367 (27%), Positives = 155/367 (42%), Gaps = 47/367 (12%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y+IL +   A++ EIK AYR+L+ ++HPDK       EE   KF E+  AY++LSD E
Sbjct: 23  DYYAILEIDKGASEKEIKSAYRQLSKKFHPDK---NAGSEEAHQKFIEVGEAYDVLSDPE 79

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFD--------------NDKSKD 108
           K+  YD +G                    D  D     F                 +   
Sbjct: 80  KKKIYDQFGAEAVKNGGDGAGGPGAGGFHDPFDIFERMFQGGHGGTGGGFGQRQRQRGPM 139

Query: 109 VKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGY 168
           +K+  KLS+++ Y+G + +F    N  C  C G G     +G +      +C  C G G 
Sbjct: 140 IKVQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSG---SADGKLA-----QCPDCQGRGV 191

Query: 169 KERTRMLIPGFVTTD-KIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVP 227
               ++L  G +T   +  C  C G G+V       KN+CK CHG  +   NK   V VP
Sbjct: 192 I--IQVLRMGIMTQQIQQMCGRCGGTGQVI------KNECKTCHGNKVTKRNKFFHVDVP 243

Query: 228 RGLQNKDTIRIENEADQEIGKSKTGDII----LVIEEDTTMPSDVHFIRKGTDFVMYLSL 283
            G          N  D   G+++ G       LVIE       ++ + R+G +      L
Sbjct: 244 PGAPR-------NYMDTRAGEAEKGPDFDAGDLVIEFKEKDSENMGYRRRGDNLYRTEVL 296

Query: 284 SLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYV 343
           S+ EAL G  ++ +    + + + LS P+   +  G I  +K  G P   +   +GDLY+
Sbjct: 297 SIEEALYGGWERTIEFLDENKPVKLSRPAYVGVSNGEIEVMKGFGMPKGGKG--YGDLYI 354

Query: 344 IIKIEFP 350
              +  P
Sbjct: 355 DYVVIMP 361

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 98/358 (27%), Positives = 160/358 (44%), Gaps = 32/358 (8%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y+ILGV   AT+ +IK AYR+L+ +YHPDK  +P D   +   F E+  AYE LSD E
Sbjct: 21  DYYAILGVDREATEKDIKSAYRQLSKKYHPDK--NPGDTTAHH-NFIEVGEAYEALSDPE 77

Query: 63  KRAHYDLYG-DAXXXXXXXXXXXXXXXXXTD--------QPDYDSYAFDNDKSKDVKIPL 113
           KR  YD YG +A                  D           +        +S+ +++  
Sbjct: 78  KRRIYDQYGAEALKNGGGAEGGHGGFHDPFDIFEQMFGGGARFGGGQRRRQRSQSLQVQE 137

Query: 114 KLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTR 173
           +L++++ Y+G   +F    N  C  C   G    ++G V       C +C+  G     +
Sbjct: 138 ELTLRQYYHGTAVEFTLSLNDHCDHCGATG---SQDGKVE-----RCTQCSVRGVI--VQ 187

Query: 174 MLIPGFVTTD-KIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQN 232
           +   GF+T   +  C    G       P +   KCK C G   + +NK   V VP G   
Sbjct: 188 VGRQGFMTQQFQQVCPRLLG-----PWPKALPKKCKVCQGHKAIKKNKSFRVEVPPGA-P 241

Query: 233 KDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGF 292
           +D + ++    +++     GDI + + E+T    ++ + R+G +      LSL EAL G 
Sbjct: 242 RDFVAVQQGEAEKVPDMDPGDIYVKVFENTR--DNMGYRRQGANLFRTEVLSLKEALHGD 299

Query: 293 KDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFP 350
             + L      + +  S   G+ ++ G + ++   G P+ P ++ FGDLYV   +  P
Sbjct: 300 WKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPL-PDSAGFGDLYVDYVVILP 356

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  104 bits (260), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 102/383 (26%), Positives = 170/383 (44%), Gaps = 40/383 (10%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y+ILGV   A++ +IK AYR+++ ++HPDK  +  D E +  KF EI  AYE+LSD E
Sbjct: 19  DYYAILGVAKDASEKDIKSAYRQMSKKWHPDK--NAGDDEAHH-KFIEIGEAYEVLSDSE 75

Query: 63  KRAHYDLYG-DAXXXXXXXXXXXXXXXXXTDQPD---------YDSYAFDNDKSKDVKIP 112
           KRA YD +G DA                     D          DS+    +  K   + 
Sbjct: 76  KRATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHPGGQNVRKGSNLI 135

Query: 113 LK--LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKE 170
           +K  +++   Y+G         N  C  C G G    +           C+ C G G   
Sbjct: 136 VKDSVTLNGFYHGFYANLTLDLNDDCEHCHGSGAEDNQFAT--------CETCQGRGVI- 186

Query: 171 RTRMLIPGFVTTD-KIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRG 229
             +++  GF+T   +  C  C GKG+        K+ CK C G  ++   K   +SVP G
Sbjct: 187 -IQVIQMGFMTQQIQQVCGACQGKGKTI------KHVCKICRGARVVKTPKTFEISVPAG 239

Query: 230 LQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEAL 289
            Q    +    +A++ +   ++GD++ V EE++    ++ + R+G        L   EAL
Sbjct: 240 AQRNYNVVKSGQAEK-VPDMQSGDLVFVFEENSH--ENLGYRRRGDHLYRTEVLHWKEAL 296

Query: 290 TGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWP-VNPQA---SKFGDLYVII 345
            G  ++ ++   D + + +      V  PG I ++   G P +N +    + +GDL++  
Sbjct: 297 LGGWERRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLNSKGKSTNAYGDLFIEY 356

Query: 346 KIEFPPDNWFSEKSDIQLLRNVL 368
            I   P  + S K   +++R+ L
Sbjct: 357 VI-VSPKEFPSGKGSPEIIRDEL 378

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score =  103 bits (258), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 121/254 (47%), Gaps = 26/254 (10%)

Query: 105 KSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCN 164
           +  D+K  LK ++ ELY+GK  K    R  +C  C+G G  RR+           CK C 
Sbjct: 161 RGPDIKHNLKCTLAELYDGKITKLGLNRRRMCQSCQGQGSLRRRT----------CKTCR 210

Query: 165 GLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLV 224
           G G +  TR   P  V T    C DC+G G  Y K   + + C  C G+  + E K   V
Sbjct: 211 GQGQQTETRRTGP-MVQTWTQTCPDCNGLG-TYTK---QADVCHECRGESYIKERKIFDV 265

Query: 225 SVPRGLQNKDTIRIENEADQEI----GKSKT--GDIILVIEEDTTMPSDVHFI-RKGTDF 277
            V +G+ +  TI +  EAD+ I    G  K   GD+++ I  D    S  H + R G D 
Sbjct: 266 EVSKGMCHGQTIVLPGEADELIKTSFGVEKVIPGDVVITI--DQVKDSKFHRVNRYGCDL 323

Query: 278 VM-YLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQAS 336
           VM   S+ L+ +L G  D ++     G++L +S+  G++I P  +  I+  G P      
Sbjct: 324 VMGSCSIDLSTSLCG-GDIYIDGHPSGKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHDG 382

Query: 337 KFGDLYVIIKIEFP 350
             G+LY+  ++E+P
Sbjct: 383 GKGNLYIQFQLEYP 396

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 48/68 (70%), Gaps = 3/68 (4%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY  L V+  AT SEIK+AY+ +AL+YHPDK    +  E+ + KF+E+  AYEIL+DE+K
Sbjct: 7  LYDTLKVSPDATISEIKRAYKVMALKYHPDK---NHHSEDAKNKFQEVCKAYEILADEDK 63

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 64 RVMYDRYG 71

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score =  103 bits (257), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 88/311 (28%), Positives = 142/311 (45%), Gaps = 36/311 (11%)

Query: 105 KSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCN 164
           +  D+K  LK  ++ELY+GK  K    R  +C +C G       +G++T      C +C 
Sbjct: 151 RGPDIKHNLKCELKELYSGKVAKLGLTRTRLCHRCSG-------HGSMT---SSVCGECR 200

Query: 165 GLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLV 224
           G G   +TR   P  V T    C +C G G  + K N   + C+ C G G + E K   V
Sbjct: 201 GQGVYSQTRRHGP-LVQTWSSSCRNCSGAG-TFVKSN---DVCQTCRGTGYIRERKIFEV 255

Query: 225 SVPRGLQNKDTIRIENEADQEI----GKSKT--GDIILVIEEDTTMPSDVHFIRKGTDFV 278
            +  GL NK  I +  EADQ I    GK +   GD+I++++E  +      F  + +D V
Sbjct: 256 EIKPGLSNKSEIILPGEADQVISTVYGKQQVIPGDVIIIVQEQCSTGRYRRF--RESDLV 313

Query: 279 M-YLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASK 337
           +    + L  +L G    ++     GR + L V  G+++ PG+I  ++  G P     S+
Sbjct: 314 LTRCVVDLRTSLCG-GSIYIDDHPSGRPIKLEVIPGELLNPGSIKCVENLGMPKRDNPSQ 372

Query: 338 FGDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVT------ 391
           +GDLY+   + FP      E   + ++ + L S  N ++    I +P + +T        
Sbjct: 373 YGDLYIKFCVNFPER---LEPETMNVISSALASDSN-IIRQENITEPSSAQTRNPDCYEE 428

Query: 392 -TFDILEELPD 401
             F    E+PD
Sbjct: 429 HVFSNFNEIPD 439

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 42/68 (61%), Gaps = 3/68 (4%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           Y +L V+ + +  E+KK+Y+  AL+YHPDK       E  +  F++IT AY ILSDE K
Sbjct: 7  FYDLLNVSPTVSPQELKKSYKLAALRYHPDK---NGHSESAKQAFQQITEAYGILSDERK 63

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 64 RKIYDRYG 71

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score = 99.8 bits (247), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 70/257 (27%), Positives = 120/257 (46%), Gaps = 27/257 (10%)

Query: 105 KSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCN 164
           +  D+K  LK +++ELYNGK  K    R  +C+ C G G  +R            C+ C 
Sbjct: 150 RGPDIKHVLKCTLRELYNGKMAKLALNRTRLCLPCNGFGGLQRTT----------CESCQ 199

Query: 165 GLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLV 224
           G G++ +TR + P  V T    C  C G G  + KPN   + C +CHG+G + E K   V
Sbjct: 200 GDGFQTQTRRMGP-MVQTWTQTCASCDGAG-CFIKPN---DVCPHCHGEGFIRERKIFHV 254

Query: 225 SVPRGLQNKDTIRIENEADQ----EIGKSKT--GDIILVIEEDTTMPSDVHFIRKGTDFV 278
            V  G Q+   + ++ EAD+     + K K   GD+++ I++     +    I      +
Sbjct: 255 EVKPGFQDGKDVIMQGEADEIMLNNLVKEKVIPGDVVITIKQSRDENNCFQMINNKDLLM 314

Query: 279 MYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV-----NP 333
               + L  +L G  + ++     G+++ L +  G++++P     I+  G P      + 
Sbjct: 315 NGCPVDLVTSLCG-GEVYIDNHPSGKLIKLDIIPGEILKPNCFKIIEGLGMPYLEDGKDD 373

Query: 334 QASKFGDLYVIIKIEFP 350
              + GDLY+  KI++P
Sbjct: 374 TMLRRGDLYIQFKIQYP 390

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 3/68 (4%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY  L V  +AT  +IKKAY+KLAL+YHPDK    N  E+++ KF+ +  AYEIL+D++ 
Sbjct: 7  LYETLNVPITATTLDIKKAYKKLALKYHPDK---NNHSEDSKTKFQAVCQAYEILNDKQS 63

Query: 64 RAHYDLYG 71
          RA YD  G
Sbjct: 64 RAIYDALG 71

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 75/261 (28%), Positives = 122/261 (46%), Gaps = 32/261 (12%)

Query: 104 DKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKC 163
           ++  D+K  L+ S+++LY GK  K +  R  +CV C G G  ++           +C  C
Sbjct: 162 ERGPDIKHTLRCSLKDLYYGKKTKLRLDRTRLCVLCMGQGSMKKS----------KCFTC 211

Query: 164 NGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLL 223
           NGLG   +TR + P  + T    C DC G G    + ++    C++C G G + E K   
Sbjct: 212 NGLGSLTQTRRMGP-MIQTFSQSCPDCQGSGMFVKRSDT----CQSCSGNGYVEERKIFD 266

Query: 224 VSVPRGLQNKDTIRIENEADQEI----GKSK--TGDIILVIEEDTTMPSDVHFIRKGTDF 277
           V +  G+ N   I +  EAD+ +    GK K   GDI+L I +     ++   I      
Sbjct: 267 VEIQPGMVNGQVIILPGEADEVVNTSFGKQKVIAGDIVLTINQ--LKDNNFEVINDCDLL 324

Query: 278 VMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWP----VNP 333
           +   S++L++AL G    F+S    G ++ + +  G+++ PG I  +   G P     +P
Sbjct: 325 LDNFSVNLSKALCG-GTIFISNHPSGNLIKIDIIPGEILSPGVIKTVANLGMPKEEKRDP 383

Query: 334 QASKF----GDLYVIIKIEFP 350
             S      G+LYV   I+FP
Sbjct: 384 DVSIINISKGNLYVKFDIKFP 404

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score = 96.3 bits (238), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 85/338 (25%), Positives = 158/338 (46%), Gaps = 45/338 (13%)

Query: 109 VKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGY 168
           ++  LK ++ +L++GK  K    R  +C +C+G G ++            +C+ C G G 
Sbjct: 165 IRHNLKCNLYDLFHGKRAKLALNRTRLCQRCQGYGGKK----------ATQCRGCQGTGL 214

Query: 169 KERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPR 228
              T+ + P  V T +  C++C G G+ Y +    K+ C  C G G + E K   V V  
Sbjct: 215 FTTTKRMGP-MVQTWQTTCKECSGTGK-YIR---SKDACTECSGNGFIKERKFFDVEVLP 269

Query: 229 GLQNKDTIRIENEADQ----EIGKSKT--GDIILVIEEDTTMPSDVH--FIRKGTDFVM- 279
           G++N + I +  EAD+    E GK +   GD+I+ I+      S++   ++    D ++ 
Sbjct: 270 GMRNGNEIILPGEADEVINTEYGKERVIPGDVIITIQLTRNEESNMRYKYLVHDHDLILD 329

Query: 280 YLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFG 339
              + L  +L G     +     G    + V SG++++PG I  ++ +G PV+   + FG
Sbjct: 330 NFEVDLKTSLCG-GTIIIEDHPSGNPFKIEVLSGELLKPGCIKCVENKGMPVDSNGN-FG 387

Query: 340 DLYVIIKIEFP---PDNWFSEKSDIQL----LRNVLPSGING---MMNSWKIDDPLNTET 389
           +LY+  +++FP     +  ++ S+I +    + ++L   IN     +NS  I +     T
Sbjct: 388 NLYIRFRVKFPEQLKSDTINKLSEILVQDENISSILSDSINNKSYKINSSDIAEEQVLST 447

Query: 390 VTTFDILEELPDTLNESNNRSAYDTGDQSDANYDREGP 427
            TT D+  +  +   +S N+  +          DR+GP
Sbjct: 448 FTTEDLQSKFKNAKRDSPNKRKH---------ADRDGP 476

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 97/375 (25%), Positives = 159/375 (42%), Gaps = 51/375 (13%)

Query: 3   DLYSILGVTSS-ATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDE 61
           D Y ILG+  +   + EIK AYRKL+ +YHPDK  +  D ++N IK   +  AY++L D 
Sbjct: 24  DYYKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDKDAQQNFIK---VGEAYDVLGDP 80

Query: 62  EKRAHYDLYG-DAXXXXXXXXXXXXXXXXXTDQPDYDSY--------------------- 99
           +K+  YD  G DA                      +D +                     
Sbjct: 81  DKKRQYDQMGHDAFVNNAQHGGPEGGPGGQPFHDPFDMFEKMFHGGGPGGGNPFGGNPFG 140

Query: 100 -AFDNDKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEI 158
                 +   +K+  +LS+++ Y G  F+F    +  C  C G G    ++G   +    
Sbjct: 141 GGGGQRRGPSLKVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTG---SEDGKTKV---- 193

Query: 159 ECKKCNGLGYKERTRMLIPGFVTTDKIR--CEDCHGKGEVYAKPNSEKNKCKNCHGKGLL 216
            C  C G G       +I   + T +I+  C  C G+G +       KN CK C+G  + 
Sbjct: 194 -CPDCKGSGI---IIQIIRMGMMTQQIQQPCGRCRGQGHLI------KNFCKVCNGAKVQ 243

Query: 217 SENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSD-VHFIRKGT 275
            + K   V VP G   ++ + ++    ++    + GD+I+   E   +P D + + R+G 
Sbjct: 244 QKLKDFKVYVPPG-SPRNHVEVKAGQAEKNPNYEPGDVIIEFNE---LPLDNLGYRRRGN 299

Query: 276 DFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQA 335
           +      +SL EAL G  ++ L      + + L       I  G I  +K  G P+  + 
Sbjct: 300 NLFRTEYISLNEALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPIPNKK 359

Query: 336 SKFGDLYVIIKIEFP 350
           +KFGDLY+  K+  P
Sbjct: 360 NKFGDLYIDYKVIIP 374

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 113/256 (44%), Gaps = 27/256 (10%)

Query: 104 DKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKC 163
           D+  D+K  LK +++ELY GKT K    R  IC  C+G G  ++            CK C
Sbjct: 174 DRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICSVCDGHGGLKK----------CTCKTC 223

Query: 164 NGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLL 223
            G G + +TR + P  V +    C DC G G V+ K    K+ C+ C G G + E K L 
Sbjct: 224 KGQGIQTQTRRMGP-LVQSWSQTCADCGGAG-VFVK---NKDICQQCQGLGFIKERKILQ 278

Query: 224 VSVPRGLQNKDTIRIENEADQEI-----GKSKT--GDIILVIEEDTTMPSDVHFIRKGTD 276
           V+V  G  +   I +  E D+ I     G  K   GD+++ I        +   I     
Sbjct: 279 VTVQPGSCHNQLIVLTGEGDEVISTKGGGHEKVIPGDVVITILR--LKDPNFQVINYSNL 336

Query: 277 FVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWP--VNPQ 334
                 +    +L G    ++     G+++ L +  G++++PG    ++  G P  +N  
Sbjct: 337 ICKKCKIDFMTSLCG-GVVYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGV 395

Query: 335 ASKFGDLYVIIKIEFP 350
            S FG LYV   + +P
Sbjct: 396 RSGFGHLYVKFDVTYP 411

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/68 (58%), Positives = 47/68 (69%), Gaps = 3/68 (4%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY  L VT++A+ SEIKKAYR  AL+YHPDK    N  EE++ KF+EI  AYEIL D   
Sbjct: 7  LYDSLNVTAAASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEILKDNRL 63

Query: 64 RAHYDLYG 71
          RA YD YG
Sbjct: 64 RALYDQYG 71

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 115/257 (44%), Gaps = 30/257 (11%)

Query: 104 DKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKC 163
           ++  D+K  LK +++ELY GKT K    R  IC  CEG G  ++            CK C
Sbjct: 185 NRGPDIKHTLKCTLRELYMGKTAKLGLNRTRICHVCEGHGGLQK----------YTCKTC 234

Query: 164 NGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLL 223
            G G + +T+ + P  V +    C DC G G ++ +    K+ C+ C G G + + K L 
Sbjct: 235 KGQGVQTQTKCMGP-LVQSWSQTCADCGGAG-IFVE---SKDICQQCQGLGFIKQRKILQ 289

Query: 224 VSVPRGLQNKDTIRIENEADQEIGKSKT------GDIILVIEEDTTMPSDVHFIRKGTDF 277
           V+V  G  +   I +  E D+ I K         GD+++ I        D  F       
Sbjct: 290 VTVQPGTSHNQLIVLTGEGDEVISKGGGHEKVIPGDVVITI----LRLKDPKFQVTDNCS 345

Query: 278 VMY--LSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWP--VNP 333
           ++Y    + L  +L G    ++     G+++ L +  G+V++P     I+  G P  +N 
Sbjct: 346 LIYKKCKVDLMTSLCG-GIVYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFING 404

Query: 334 QASKFGDLYVIIKIEFP 350
             S FG LYV   + +P
Sbjct: 405 VRSGFGHLYVKFDVSYP 421

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 47/68 (69%), Gaps = 3/68 (4%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY  L VT++A+ SEIKKAYR  AL+YHPDK    N  EE++ KF+EI  AYE+L D   
Sbjct: 7  LYDSLNVTTTASTSEIKKAYRNAALRYHPDK---NNHTEESKRKFQEICQAYEVLKDNHL 63

Query: 64 RAHYDLYG 71
          R+ YD YG
Sbjct: 64 RSLYDQYG 71

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score = 87.8 bits (216), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 122/271 (45%), Gaps = 35/271 (12%)

Query: 104 DKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKC 163
           ++  D+K  LK +++ELY GKT K    R  IC  C+G G  R+            CK C
Sbjct: 181 NRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICHVCDGHGGLRK----------YTCKPC 230

Query: 164 NGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLL 223
            G G + +T+ + P  V +    C DC G G  + K    K+ C+ C G G + + K L 
Sbjct: 231 KGQGIQTQTKRMGP-LVQSWSQTCADCGGAG-TFVK---NKDICEQCQGLGFIKQRKILQ 285

Query: 224 VSVPRGLQNKDTIRIENEADQEI-----GKSKT--GDIILVIEEDTTMPSDVHF-IRKGT 275
           V+V  G  +   I +  E D+ I     G+ K   GD+++ I        D  F I    
Sbjct: 286 VTVQPGSCHNQLIVLTGEGDEVISTKGGGREKVIPGDVVITI----LRLKDPKFQITDNC 341

Query: 276 DFVM-YLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWP--VN 332
           D +     + L  +L G    ++     G+++ + +  G+V++PG    ++  G P  +N
Sbjct: 342 DLICKKCEVDLMTSLCG-GIVYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFIN 400

Query: 333 PQASKFGDLYVIIKIEFP----PDNWFSEKS 359
              S FG LYV   + +P    P+N    KS
Sbjct: 401 GVRSGFGHLYVKFDVTYPERLEPENAAKVKS 431

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 47/68 (69%), Gaps = 3/68 (4%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY  L VT++A+ SEIKKAYR  AL+YHPDK    N  EE++ KF+EI  AYE+L D   
Sbjct: 7  LYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEVLKDNHL 63

Query: 64 RAHYDLYG 71
          R+ YD YG
Sbjct: 64 RSLYDQYG 71

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 90/399 (22%), Positives = 157/399 (39%), Gaps = 72/399 (18%)

Query: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           LY+ L +  +A+ S+IKKAYR  AL+YHPDK    N+ EE++ KF++I+ AY IL DE +
Sbjct: 7   LYNALNIPPTASQSDIKKAYRVQALRYHPDK---NNESEESKKKFQDISEAYSILRDENQ 63

Query: 64  RAHYDLYGDAXXXXXXXXXXXXXXXXX----TDQPDYDSYAFD----NDKSKDVKIPLKL 115
           R  YD YG                           D  S  FD    N    +   P   
Sbjct: 64  RKMYDKYGTVNPTEIQQQNQRTNVPFTDPFGMSAADLFSQFFDTQNHNSGQSNSSPPFGF 123

Query: 116 SIQ------------------ELYNGKTFKFQSKRNI-ICVQCEGLGWRRRKNGNVTIPH 156
                                + +N K+   Q   +I   ++C      R K   + +  
Sbjct: 124 PFNSSRNGNGNNNRAADGVFGDFFNTKSRPLQKGPDINHNLKCTIKDLYRGKRSKLRLER 183

Query: 157 EIECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPN--------------- 201
              C  C G G  +R+              C  CHG G +                    
Sbjct: 184 SKLCSICKGDGGVKRS-------------MCNQCHGDGNITETTRLGPMLQTFTHTCNIC 230

Query: 202 -------SEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKT--G 252
                    +  C+ C+G G  +E K   V +  G+++   I   NE D+ + K +   G
Sbjct: 231 NGNGWVIISQETCQGCNGVGFYNEMKIFDVEIYPGMKDGTQIVFNNEGDEIVNKRRVIPG 290

Query: 253 DIILVIEEDTTMPSDVHFIRKGTDFVMY-LSLSLAEALTGFKDKFLSKSLDGRILTLSVP 311
           ++I+ I E     +    +  G D   +   + L  +L G    ++    + +++ + + 
Sbjct: 291 NVIIHINE--IEDNKFKRVNDGQDLYYWNYEIDLFTSLCG-GVIYIKGHPNNKLIKVDIL 347

Query: 312 SGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFP 350
            G++I  G++  ++  G P N + +++G LY+  ++++P
Sbjct: 348 PGEIIESGSVKGVESLGMPKN-KGNEYGILYIQFQVKYP 385

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 116/260 (44%), Gaps = 35/260 (13%)

Query: 104 DKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKC 163
           ++  D+K  LK +++ELY GKT K    R  IC  C+G G  ++            CK C
Sbjct: 178 NRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICQVCDGHGGLKK----------YACKTC 227

Query: 164 NGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLL 223
            G G + +T  + P  V +    C DC G G ++ +    K+ C+ C G G + + K L 
Sbjct: 228 KGQGVQTQTNRMGP-LVQSWSQTCADCGGAG-IFVE---SKDICQQCQGLGFVKQRKILQ 282

Query: 224 VSVPRGLQNKDTIRIENEADQEI-----GKSKT--GDIILVI----EEDTTMPSDVHFIR 272
           V+V  G  +   I +  E D+ I     G  K   GD+++ I    +    +  D + I 
Sbjct: 283 VAVQPGSCHNQLIVLTGEGDEVISSKGGGHEKIIPGDVVITILRLKDPRFQIVDDYNLIY 342

Query: 273 KGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWP-- 330
           K     +  SL            ++     G+++ L +  G+V++PG    ++  G P  
Sbjct: 343 KKCKVDLMTSLCGGVV-------YIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMGMPKF 395

Query: 331 VNPQASKFGDLYVIIKIEFP 350
           +N   S FG +YV  ++ +P
Sbjct: 396 INGVRSGFGHMYVKFEVTYP 415

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 46/68 (67%), Gaps = 3/68 (4%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY  L VT++A+ SEIKKAYR  AL+YHPDK    N  EE++ KF+EI  AYE L D   
Sbjct: 7  LYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYETLKDNHL 63

Query: 64 RAHYDLYG 71
          R+ YD YG
Sbjct: 64 RSLYDQYG 71

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/68 (61%), Positives = 50/68 (73%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+SSA+D+EIKK YRK AL+YHPDK   P    E   KFKEI+ A+EILSD  K
Sbjct: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILSDSNK 60

Query: 64 RAHYDLYG 71
          R+ YD YG
Sbjct: 61 RSVYDQYG 68

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 4/81 (4%)

Query: 270 FIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGW 329
           + R G + +  L L+  E+L GF      ++LDGR L LS    + ++P        +G 
Sbjct: 262 YKRDGDNIIYTLPLTFKESLLGFSKTL--QTLDGRTLPLS--RSQPVQPTEENTYPGQGM 317

Query: 330 PVNPQASKFGDLYVIIKIEFP 350
           P++    + G+L +  KI +P
Sbjct: 318 PISKNPGQRGNLIIKYKINYP 338

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/68 (61%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ SA D EIKK YRK ALQYHPDK   P    E   KFK+I+ AYEILSD  K
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALQYHPDK---PTGNTE---KFKQISEAYEILSDSNK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REVYDQYG 68

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 65/141 (46%), Gaps = 12/141 (8%)

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEAD--QEIGKSKTGDIILVIEEDTTMPSDVH 269
           G G   E KQ+ + + RG +    I  +NE D     G  KT   +L   ++   P    
Sbjct: 195 GPGGSQEKKQIDIQLKRGWKAGTKITYKNEGDFNPRTGGRKTLQFVL---QEKAHP---L 248

Query: 270 FIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGW 329
           F R G + +  + LS  E+L GF      +++DGR L+LS    + I+P        +G 
Sbjct: 249 FKRDGENLLYTVPLSFQESLLGFSKTV--QTIDGRSLSLS--RTQPIQPTETTTYPGQGM 304

Query: 330 PVNPQASKFGDLYVIIKIEFP 350
           P     ++ GDL +  KI++P
Sbjct: 305 PNPKNPNQRGDLIITYKIDYP 325

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 78.2 bits (191), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 106/230 (46%), Gaps = 26/230 (11%)

Query: 108 DVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLG 167
           D+K  LK ++  LY+GK  K + +R   C++C+G G    K+          C KCNG G
Sbjct: 232 DIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFGSLNIKS----------CSKCNGRG 281

Query: 168 YKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVP 227
              +T+   P    T    C+ C G G  +A     ++ C  C G+G L+E K   V + 
Sbjct: 282 SLTQTKKFGP-MTQTFTQTCDGCGGNG-TFADA---QDICNECQGEGFLNEKKIFEVEIT 336

Query: 228 RGLQNKDTIRIENEADQEI----GKSKT--GDIILVIEEDTTMPSDVHFIRKGTDFVMY- 280
            G+ +   I +  EAD+ I    GK +   GDIIL I     +P     + +G D +   
Sbjct: 337 PGMTDGQLIILTGEADEVISTNLGKERVIPGDIILTI---NLLPDPTFKVVQGADLLYAN 393

Query: 281 LSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWP 330
             ++L  +L G    ++       ++ +++  G++I+ G I  ++  G P
Sbjct: 394 YKINLLTSLCG-GSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMP 442

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 3/68 (4%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY IL V   + +S IKKAYR LAL+YHPDK    N  EE++  F++I+ AY +LS+++K
Sbjct: 7  LYDILQVRYDSDESVIKKAYRTLALKYHPDK---NNLSEESKQMFQKISEAYVVLSNKDK 63

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 64 RQMYDKYG 71

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score = 78.2 bits (191), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 127/296 (42%), Gaps = 49/296 (16%)

Query: 108 DVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLG 167
           D+K  L  +++ELY GK  K    R   C  C G+G            + I C +C G G
Sbjct: 172 DIKHVLNCTLKELYQGKKCKLGLNRTRSCHSCNGMGGM----------NTIICNECQGKG 221

Query: 168 YKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVP 227
               T+ML P  V +    C +C G G         ++ CK C G+G L E     V+V 
Sbjct: 222 INTETKMLGP-MVQSWSSTCFNCSGMGYFI----DSQSGCKECQGEGYLRERTIFTVTVK 276

Query: 228 RGLQNKDTIRIENEADQ-----EIGKSKT--GDIILVIEE--------DTTM-----PSD 267
            G++N   I ++ EADQ     ++ K K   GD+I+VI +        D+ +      + 
Sbjct: 277 PGMRNNQKIVLKGEADQVMLVGKLNKEKVIPGDVIIVINQIEGKSWKNDSNIDQGENKNK 336

Query: 268 VHF--IRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIK 325
            HF  I +    +    + L  +L G  + ++     G+++ L +   ++++P  +  ++
Sbjct: 337 FHFEIINEKDLLLRNCQIDLITSLCG-GEIYIKNHPSGKLIKLDIIPSEILKPDCLKCVE 395

Query: 326 QEGWPV--------NPQASKFGDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPSGIN 373
             G P           +    GDLY+  K+++P      E   I  LR++L   I+
Sbjct: 396 NLGMPRYIEDETNNGEEYLPNGDLYIQFKVKYPTK---LENETIDKLRSILSEDIH 448

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 3/68 (4%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LYSIL V ++AT  EIK AY+KLAL+YHPDK    N  EE+++KF+EI  AYE+L D++K
Sbjct: 14 LYSILQVPTAATLFEIKNAYKKLALKYHPDK---NNHSEESKLKFQEICKAYEVLHDKDK 70

Query: 64 RAHYDLYG 71
          +  YD YG
Sbjct: 71 KLLYDTYG 78

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 106/260 (40%), Gaps = 35/260 (13%)

Query: 108 DVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLG 167
           D+K  LK ++ +LY GK  K    R  +C  C+G G  R  +          C+ C G G
Sbjct: 150 DIKHYLKCNLSDLYQGKKTKLGLNRMRVCSSCDGKGGMRVAS----------CRTCKGQG 199

Query: 168 YKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVP 227
              +TR + P  V T    C  CHG G        + + C  C G G+  E K   V V 
Sbjct: 200 EVVKTRRVGP-MVQTMSSTCNSCHGTGTFI----KDSDLCFVCKGSGVSKERKIFDVEVK 254

Query: 228 RGLQNKDTIRIENEADQEIGKS------KTGDIILVIEEDTTMPSDVHFIRKGTDFVMYL 281
            G+ +   I +  EAD+ I  S      + GD+++VI  D    +    +      +   
Sbjct: 255 AGMTHNQVIVLPGEADEVIETSHGLIKVQPGDVVIVI--DLVKNTQFQVVNDHDLVLKNC 312

Query: 282 SLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWP----------- 330
            + L   L G  +  +     G+I+ LS+   ++++P     ++  G P           
Sbjct: 313 EVPLKTCLCG-GEIMIEGHPSGKIIKLSIIPNELLKPSCFKTVEGLGMPKVIANSDHANI 371

Query: 331 VNPQASKFGDLYVIIKIEFP 350
                  +G+LYV  +++FP
Sbjct: 372 AGTDIDGYGNLYVQFQVKFP 391

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 108/277 (38%), Gaps = 55/277 (19%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y  LGV+  A+ S+IK+AY KLA +YHPD   +P   +     F  + +AYEILSDE+
Sbjct: 48  DPYKTLGVSRDASPSDIKRAYYKLAKKYHPDINKEPGADKT----FHNLQNAYEILSDEK 103

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYA-FDNDKSKDVKIPLKLSIQELY 121
           K+  YD YG +                         +A F     +D+            
Sbjct: 104 KKLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDL-FGAAFGRSGFR 162

Query: 122 NGK-TFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIE--------------------C 160
           NG     F  + NI+         R  +  ++ I H +                     C
Sbjct: 163 NGGDAGGFNGRANIV---------REYQGDSIEIQHVVSFKDAVFGLNNVSLKYKSLDPC 213

Query: 161 KKCNGLG------YKERTRMLIPGFVTTDKIR--------CEDCHGKGEVYAKPNSEKNK 206
             C+G G      +K +T     G  T   ++        C  CHG+G   A+ ++    
Sbjct: 214 GTCHGSGLKNGEQHKRKTCSYCNGTGTQVHVKSGFQMASTCMHCHGEGTTIAREDT---- 269

Query: 207 CKNCHGKGL-LSENKQLLVSVPRGLQNKDTIRIENEA 242
           C  C G G+ ++  K L V+ P GL + D IRI  E 
Sbjct: 270 CSACDGDGVKINSKKSLNVNFPSGLSDGDVIRIPGEG 306

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ SA D EIKK YRK AL+YHPDK   P    E   KFKEI+ A+EILSD  K
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALKYHPDK---PTGNTE---KFKEISEAFEILSDSNK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REVYDQYG 68

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 64/141 (45%), Gaps = 12/141 (8%)

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVH-- 269
           G+  + E  Q+ + +  G +    I  +N  D          +  VI+E       VH  
Sbjct: 210 GQNGVQEKVQVDIQLKAGWKAGTKITFKNYGDYNPSTGGRKTLQFVIKEK------VHPN 263

Query: 270 FIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGW 329
           F R+    V YL L+  E+L GF+     +++DGR  TL +   + ++P +      +G 
Sbjct: 264 FKREDDTLVYYLPLTFKESLLGFQKTI--QTIDGR--TLPISRVQPVQPNDSSTYPGQGM 319

Query: 330 PVNPQASKFGDLYVIIKIEFP 350
           P+  +  + GD+ V  KIE+P
Sbjct: 320 PMTKKPGQRGDMIVKYKIEYP 340

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ SA D EIKK YRK AL+YHPDK   P    E   KFKEI+ A+EILSD+ K
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILSDKNK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REVYDQYG 68

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 67/141 (47%), Gaps = 12/141 (8%)

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEAD--QEIGKSKTGDIILVIEEDTTMPSDVH 269
           G+G + E  Q+ + +  G +    I  +++ D   + G  KT   +L   ++   P    
Sbjct: 214 GQGGIPEKTQIDIQLKPGWKAGTKITYKSQGDYNPQTGGRKTLQFML---QEKNHPV--- 267

Query: 270 FIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGW 329
           F R+G D    L L+  E+L GF  +   +++DGR  TL +   + I+P        +G 
Sbjct: 268 FKREGDDLTCTLPLTFKESLLGFNKQI--QTIDGR--TLPISRTQPIQPSETSVYPGQGM 323

Query: 330 PVNPQASKFGDLYVIIKIEFP 350
           P+    S+ G+L V  KI++P
Sbjct: 324 PIPKTPSQRGNLIVRYKIDYP 344

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGVT SA + EIKK YRK AL+YHPDK   P    E   KFK+I+ AYEILSD  K
Sbjct: 7  LYDLLGVTPSANEQEIKKGYRKAALKYHPDK---PTGDTE---KFKQISEAYEILSDSNK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 65/139 (46%), Gaps = 8/139 (5%)

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFI 271
           G G + E  Q+ + +  G +    +  +N+ D          +  +I+E    P+   F 
Sbjct: 216 GPGGVQEKTQIDIQLKPGWKAGTKLTYKNKGDYNPRTHGRKTLQFIIDEKP-HPT---FQ 271

Query: 272 RKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV 331
           R+  + V  + L+  E+L GF      +++DGR L +S    + I+P  I +   +G P+
Sbjct: 272 REDDNLVCTVPLTFKESLLGFSKTV--QTIDGRNLPIS--RSQPIQPTEITRYPGQGMPI 327

Query: 332 NPQASKFGDLYVIIKIEFP 350
           + +  + GDL V  KI +P
Sbjct: 328 SKKPGQRGDLIVKYKIAYP 346

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/68 (58%), Positives = 48/68 (70%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ SA+D+E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EILSD  K
Sbjct: 7  LYDLLGVSPSASDAELKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILSDPNK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REVYDTYG 68

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 69/139 (49%), Gaps = 8/139 (5%)

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFI 271
           G+  + E KQ+ + +  G +    I  +NE D          I  +I+E    P +  F 
Sbjct: 204 GQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTIQFIIQEK---PHEF-FK 259

Query: 272 RKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV 331
           R G D +  L L+  E+L GF DK + +++DGR   +S+   + ++P   ++   +G P+
Sbjct: 260 RDGNDLIYTLPLTFKESLLGF-DKTV-RTIDGR--QISIHKTQPVQPSEEMRYPGQGMPL 315

Query: 332 NPQASKFGDLYVIIKIEFP 350
           +   S+ GDL V  K ++P
Sbjct: 316 SKNPSERGDLIVKYKTDYP 334

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (70%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LG++ SA ++EIKK YRK AL+YHPDK   P    E   KFKEI+ A+EILSD +K
Sbjct: 7  LYDLLGISPSAGEAEIKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILSDAQK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REVYDTYG 68

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 64/139 (46%), Gaps = 8/139 (5%)

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFI 271
           G G +SE  Q+ + +  G +    I  + E D          +  V++E    P +  F 
Sbjct: 209 GAGGVSEKNQIDIQLKPGWKAGTKITFKGEGDYNPRTGGRQTLQFVLQEK---PHEF-FT 264

Query: 272 RKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV 331
           R+  D +  L LS  E+L GF  +   +++DG+  T+ +   + I+P        +G  +
Sbjct: 265 RQDNDLIYTLPLSFKESLLGFSKQV--QTIDGK--TIPITRTQPIQPTQTSTYPGQGMTL 320

Query: 332 NPQASKFGDLYVIIKIEFP 350
           +   S+ GDL +  KI++P
Sbjct: 321 SKNPSQRGDLIIKFKIDYP 339

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LG++ SA + EIKK YRK AL+YHPDK   P    E   KFKEI+ A+EILSD +K
Sbjct: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILSDPQK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REVYDQYG 68

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 58/138 (42%), Gaps = 18/138 (13%)

Query: 218 ENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDF 277
           E  Q+ + +  G +    I  +N  D      +   +  +I+E         F R G D 
Sbjct: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEK----KHPFFTRDGNDL 265

Query: 278 VMYLSLSLAEALTGFKDKFLSKSLDGRILTLS-----VPSGKVIRPGNIIKIKQEGWPVN 332
           +  L L+  E+L GF      +++DGR L +S      PS K   PG       +G P+ 
Sbjct: 266 IYTLPLTFKESLLGFNKTI--QTIDGRTLPVSRIQPIQPSEKSTYPG-------QGMPIP 316

Query: 333 PQASKFGDLYVIIKIEFP 350
               + GD+ V  K+++P
Sbjct: 317 KTPGQRGDMIVNYKVDYP 334

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 49/68 (72%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ SA ++E+KK YRK AL+YHPDK   P+   E   KFKEI+ A+EIL+D +K
Sbjct: 7  LYDLLGVSPSAQETELKKGYRKAALKYHPDK---PSGDAE---KFKEISEAFEILNDPQK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REVYDTYG 68

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 65/139 (46%), Gaps = 8/139 (5%)

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFI 271
           G G  SE +Q+ + +  G +    I  +NE D      +   +  +++E        ++ 
Sbjct: 208 GPGGASEKQQVDIQLKPGWKAGTKITYKNEGDYNPRTGRRQTLQFILQEK----PHSNYT 263

Query: 272 RKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV 331
           R G D +  L L+  E+L GF      +++DGR  TL +   + ++P +      +G P+
Sbjct: 264 RDGNDLIYSLPLTFKESLLGFSKTI--QTIDGR--TLPISRVQPVQPSDSSTYPGQGMPI 319

Query: 332 NPQASKFGDLYVIIKIEFP 350
               S+ G+L V  KI++P
Sbjct: 320 AKTPSQRGNLIVKYKIDYP 338

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 2/64 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV S A+D E+KKAYRK ALQYHPDK  +P++ EE   KF  I +AYE+LSD ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDK--NPDNVEEATEKFAIIRAAYEVLSDSQER 63

Query: 65 AHYD 68
          A YD
Sbjct: 64 AWYD 67

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 2/64 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV S A+D E+KKAYRK ALQYHPDK  +P++ EE   KF  I +AYE+LSD ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDK--NPDNVEEATQKFAIIRAAYEVLSDSQER 63

Query: 65 AHYD 68
          A YD
Sbjct: 64 AWYD 67

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +L V+ +A + EIKK YRK AL+YHPDK   P    E   KFKEI+ A+EILSD EK
Sbjct: 7  LYDLLNVSPTANEQEIKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILSDAEK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REVYDQYG 68

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 63/136 (46%), Gaps = 12/136 (8%)

Query: 217 SENKQLLVSVPRGLQNKDTIRIENEADQ--EIGKSKTGDIILVIEEDTTMPSDVHFIRKG 274
           +E  Q+ +++  G +    I  +N+ D     G  KT   IL  + +T      +F R  
Sbjct: 217 AEKAQIEIALKAGWKAGTKITYKNQGDYNPSTGGRKTLQFILKEKPNT------NFKRDE 270

Query: 275 TDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQ 334
            + +  L L+  E+L GF+     K++DG+  TL +   + ++P        +G P++  
Sbjct: 271 DNLIYTLPLTFKESLLGFQKTI--KTIDGK--TLPISRVQPVQPSECTTYPGQGMPISKS 326

Query: 335 ASKFGDLYVIIKIEFP 350
             + GD+ V  K+ +P
Sbjct: 327 VGQRGDMIVKFKVGYP 342

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           M D Y +LG++SSA+D +IK AYRKL+L++HPDK+   L   DRE  E ++ +IT AYE 
Sbjct: 119 MFDPYELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYES 178

Query: 58  LSDEEKRAHYDLYG 71
           L+DE  R +Y  YG
Sbjct: 179 LTDELIRFNYLTYG 192

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ SA + E+KK Y+K AL+YHPDK     D E    KFKEI+ AYEILSD  K
Sbjct: 7  LYDMLGVSPSANEQELKKGYKKAALKYHPDKPA--GDTE----KFKEISEAYEILSDSSK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 65/135 (48%), Gaps = 12/135 (8%)

Query: 218 ENKQLLVSVPRGLQNKDTIRIENEAD--QEIGKSKTGDIILVIEEDTTMPSDVHFIRKGT 275
           E  Q+ + +  G +    I  +NE D   + G  KT  +  V++E     S   + R G 
Sbjct: 218 EKTQIDIQLKPGWKAGTKITYKNEGDYNPQTGGRKT--LQFVLQEK----SHPLYKRDGD 271

Query: 276 DFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQA 335
           + +  L LS  E+L GF      +++DGR  TL +   + ++P  +     +G PV+ + 
Sbjct: 272 NLIYSLPLSFKESLLGFSKTI--QTIDGR--TLPISKIQPVQPTEVSSYPGQGMPVSKRP 327

Query: 336 SKFGDLYVIIKIEFP 350
            + GDL V  KI++P
Sbjct: 328 GQRGDLVVKYKIDYP 342

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 48/68 (70%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ SA ++E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EIL+D +K
Sbjct: 7  LYDLLGVSPSAQETELKKGYRKAALKYHPDK---PTGDAE---KFKEISEAFEILNDPQK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REIYDNYG 68

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 67/139 (48%), Gaps = 8/139 (5%)

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFI 271
           G G   E +Q+ + +  G +    I  +NE D      +   +  +I+E    P + ++ 
Sbjct: 205 GPGGAPEKQQVDIQLRPGWKAGTKITYKNEGDYNPRTGRRQTMQFIIQEK---PHE-NYT 260

Query: 272 RKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV 331
           R G D +  L L+  E+L GF      +++DGR  TL +   + ++P ++     +G PV
Sbjct: 261 RDGNDLIYTLPLTFKESLLGFNKTI--QTIDGR--TLPISRVQPVQPSDVSTYPGQGMPV 316

Query: 332 NPQASKFGDLYVIIKIEFP 350
               S+ G+L V  KI++P
Sbjct: 317 AKNPSQRGNLIVKYKIDYP 335

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ SA + E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EIL+D +K
Sbjct: 7  LYDLLGVSPSANEQELKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILNDPQK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 68/145 (46%), Gaps = 15/145 (10%)

Query: 208 KNCHGKGLLSENKQLLVSVPRGLQNKDTIRIENEAD--QEIGKSKTGDIILVIEEDTTMP 265
           K  HG    SE  Q+ + +  G +    I  +N+ D   + G+ KT  +  VI+E     
Sbjct: 206 KGPHG---ASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKT--LQFVIQEK---- 256

Query: 266 SDVHFIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIK 325
           S  +F R G D +  L LS  E+L GF      +++DGR L LS    + ++P       
Sbjct: 257 SHPNFKRDGDDLIYTLPLSFKESLLGFSKTI--QTIDGRTLPLS--RVQPVQPSQTSTYP 312

Query: 326 QEGWPVNPQASKFGDLYVIIKIEFP 350
            +G P     S+ G+L V  K+++P
Sbjct: 313 GQGMPTPKNPSQRGNLIVKYKVDYP 337

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 52/70 (74%), Gaps = 3/70 (4%)

Query: 2  ADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDE 61
          ++ Y +LGV+++AT  EIKKAYRK ++Q HPDK  +PND +  E +F+ I+ AY++L D+
Sbjct: 5  SEYYDLLGVSTTATAIEIKKAYRKKSIQEHPDK--NPNDPKATE-RFQAISEAYQVLGDD 61

Query: 62 EKRAHYDLYG 71
          E RA YD YG
Sbjct: 62 ELRAKYDKYG 71

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 50/66 (75%), Gaps = 2/66 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV ++A+DS++KKAYR+ ALQYHPDK  +P++ EE    F  I SAYE+L+D ++R
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDK--NPDNVEEATTVFATIRSAYEVLADPQER 63

Query: 65 AHYDLY 70
          A YD +
Sbjct: 64 AWYDSH 69

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ SA + E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EIL+D +K
Sbjct: 7  LYDLLGVSPSADEGELKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILNDPQK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REIYDSYG 68

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 68/141 (48%), Gaps = 12/141 (8%)

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEAD--QEIGKSKTGDIILVIEEDTTMPSDVH 269
           G G + E KQ+ + +  G +    I  +NE D  Q+ G  +T  +  VI+E        H
Sbjct: 203 GPGSVPEKKQIDIQMKPGWKAGTKITFKNEGDYNQQTGGRQT--MQFVIQEKL----HPH 256

Query: 270 FIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGW 329
           F R G + +  L LS  E+L GF      +++DGR  TL +   + I+P        +G 
Sbjct: 257 FKRDGNNLIYTLPLSFKESLLGFSKTI--QTIDGR--TLPISRVQPIQPSETSTYPGQGM 312

Query: 330 PVNPQASKFGDLYVIIKIEFP 350
           P+    ++ GDL +  K+++P
Sbjct: 313 PLPKTPAQRGDLIIKYKVDYP 333

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 69.7 bits (169), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 4/69 (5%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y IL V   ATDSEIKKAYRKLA++ HPDK   P   E     FK I  A+E+LS+EE
Sbjct: 21 EFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGE----AFKVINRAFEVLSNEE 76

Query: 63 KRAHYDLYG 71
          KR+ YD  G
Sbjct: 77 KRSIYDRIG 85

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/64 (57%), Positives = 48/64 (75%), Gaps = 2/64 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV + A+D E+KKAYRK ALQYHPDK  +P++ EE   KF  I +AYE+LSD ++R
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDK--NPDNVEEATQKFAVIRAAYEVLSDPQER 63

Query: 65 AHYD 68
          A YD
Sbjct: 64 AWYD 67

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ +A + E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EIL+D +K
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILNDSQK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 64/136 (47%), Gaps = 12/136 (8%)

Query: 217 SENKQLLVSVPRGLQNKDTIRIENEAD--QEIGKSKTGDIILVIEEDTTMPSDVHFIRKG 274
           SE  Q+ + + +G +    I  +NE D     G  KT   +L   ++   P    F R G
Sbjct: 229 SEKTQIDIQLKQGWKAGTKITYKNEGDYNPRTGGRKTLQFVL---QEKAHP---LFKRDG 282

Query: 275 TDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQ 334
            + +  L LS  E+L GF      +++DGR  TL +   + I+P    +   +G P+  +
Sbjct: 283 DNLIYTLPLSFKESLLGFSKTI--QTIDGR--TLPISRVQPIQPSESSRYPGQGMPITKK 338

Query: 335 ASKFGDLYVIIKIEFP 350
             + GDL V  KI++P
Sbjct: 339 PGQRGDLIVKYKIDYP 354

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ +A + E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EIL+D +K
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILNDSQK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 68/145 (46%), Gaps = 15/145 (10%)

Query: 208 KNCHGKGLLSENKQLLVSVPRGLQNKDTIRIENEAD--QEIGKSKTGDIILVIEEDTTMP 265
           K  HG    SE  Q+ + +  G +    I  +N+ D   + G+ KT  +  VI+E     
Sbjct: 220 KGPHG---ASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKT--LQFVIQEK---- 270

Query: 266 SDVHFIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIK 325
           S  +F R G D +  L LS  E+L GF      +++DGR L LS    + ++P       
Sbjct: 271 SHPNFKRDGDDLIYTLPLSFKESLLGFSKTI--QTIDGRTLPLS--RVQPVQPSQTSTYP 326

Query: 326 QEGWPVNPQASKFGDLYVIIKIEFP 350
            +G P     S+ G+L V  K+++P
Sbjct: 327 GQGMPTPKNPSQRGNLIVKYKVDYP 351

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 53/69 (76%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LG++++ATD EIKKAYRK +++ HPDK  +PND    E +F+ I+ AY++LSD++
Sbjct: 6  EYYDLLGISTTATDIEIKKAYRKKSIKEHPDK--NPNDPSATE-RFQAISEAYQVLSDKQ 62

Query: 63 KRAHYDLYG 71
           R++YD YG
Sbjct: 63 LRSNYDKYG 71

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ +A + E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EIL+D +K
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILNDAQK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 67/145 (46%), Gaps = 15/145 (10%)

Query: 208 KNCHGKGLLSENKQLLVSVPRGLQNKDTIRIENEAD--QEIGKSKTGDIILVIEEDTTMP 265
           K  HG    +E  Q+ + +  G +    I  +N+ D   + G+ KT  +  VI+E     
Sbjct: 222 KGPHG---AAEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKT--LQFVIQEK---- 272

Query: 266 SDVHFIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIK 325
              +F R G D +  L LS  E+L GF      +++DGR L LS    + ++P       
Sbjct: 273 GHPNFKRDGDDLIYTLPLSFKESLLGFSKTI--QTIDGRTLPLS--RVQPVQPSQTSTYP 328

Query: 326 QEGWPVNPQASKFGDLYVIIKIEFP 350
            +G P     S+ G+L V  K+++P
Sbjct: 329 GQGMPTPKNPSQRGNLIVKYKVDYP 353

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (70%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ +A + E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EIL+D++K
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKSALKYHPDK---PTGDTE---KFKEISEAFEILNDKQK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 60/139 (43%), Gaps = 8/139 (5%)

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFI 271
           G G   E  Q+ + +  G +    +  +N  D          +  VI+E T       + 
Sbjct: 218 GPGGAQEKVQIDIQLKAGWKAGTKVTYKNHGDYNPRTGGRKTLQFVIQEKT----HPLYK 273

Query: 272 RKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV 331
           R G D    L L+  E+L GF      +++DGR L LS  S   ++P    +   +G P+
Sbjct: 274 RNGDDLEYTLPLTFKESLLGFSKTI--QTIDGRTLPLSRSS--PVQPTETSRYPGQGMPM 329

Query: 332 NPQASKFGDLYVIIKIEFP 350
               S+ GDL V  KI++P
Sbjct: 330 PKMPSQRGDLVVRFKIDYP 348

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LGV+ +AT  EIKKAYRK A+Q HPDK  +P+D  E E KF+ +  AY++LSD E
Sbjct: 6  EYYDVLGVSPTATAMEIKKAYRKKAMQTHPDK--NPDD-PEAETKFQAVGEAYQVLSDTE 62

Query: 63 KRAHYDLYG 71
           R+ YD +G
Sbjct: 63 LRSRYDQFG 71

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ +A + E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EIL+D +K
Sbjct: 7  LYDMLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILNDPQK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 65/143 (45%), Gaps = 11/143 (7%)

Query: 208 KNCHGKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSD 267
           K  HG    SE  Q+ + +  G +    I  +N+ D     ++   +  VI+E     S 
Sbjct: 213 KGPHG---TSEKTQIDIQLKPGWKAGTKITYKNQGDFNPQTNRRKTLQFVIQEK----SH 265

Query: 268 VHFIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQE 327
            +F R G D +  L LS  E+L GF      +++DGR L LS    + ++P        +
Sbjct: 266 PNFKRDGDDLIYTLPLSFKESLLGFSKTI--QTIDGRTLPLS--RVQPVQPSQTSTYPGQ 321

Query: 328 GWPVNPQASKFGDLYVIIKIEFP 350
           G P     S+ G+L V  K+++P
Sbjct: 322 GMPTPKNPSQRGNLIVKYKVDYP 344

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y IL V   ATD EIKKAYRKLA++ HPDK   P   E     FK I  A+E+LS+EE
Sbjct: 21 EFYEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASE----AFKVINRAFEVLSNEE 76

Query: 63 KRAHYDLYG 71
          KR+ YD  G
Sbjct: 77 KRSIYDRIG 85

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/64 (57%), Positives = 48/64 (75%), Gaps = 2/64 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV S A+D E+KKAYRK ALQYHPDK  +P++ +E   KF  I +AYE+LSD ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDK--NPDNVQEATEKFAIIRAAYEVLSDPQER 63

Query: 65 AHYD 68
          A YD
Sbjct: 64 AWYD 67

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 50/67 (74%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y ILG+T +AT +EIKKAYRK +++ HPDK  +PND    E +F++I+ AY++LSDE  R
Sbjct: 8  YDILGITPTATQAEIKKAYRKKSIKEHPDK--NPNDPTATE-RFQQISEAYQVLSDEHLR 64

Query: 65 AHYDLYG 71
           +YD +G
Sbjct: 65 NNYDQFG 71

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y IL V   ATD EIKKAYRKLA++ HPDK   P   E     FK I  A+E+LS+EE
Sbjct: 21 EFYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKASE----AFKIINRAFEVLSNEE 76

Query: 63 KRAHYDLYG 71
          KR  YD  G
Sbjct: 77 KRGLYDRIG 85

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV  +ATD E+KKAYRK ALQ+HPDK  +P++ EE    F  I SAYE+LSD ++R
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDK--NPDNVEEATEIFATIRSAYEVLSDPQER 63

Query: 65 AHYDLY 70
          A YD +
Sbjct: 64 AWYDAH 69

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 45/69 (65%), Gaps = 4/69 (5%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y IL V   ATDS+IKKAYRKLA++ HPDK   P   E     FK I  A+E+LS+EE
Sbjct: 21 EFYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGE----AFKVINRAFEVLSNEE 76

Query: 63 KRAHYDLYG 71
          KR+ YD  G
Sbjct: 77 KRSIYDRIG 85

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 48/64 (75%), Gaps = 2/64 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV ++ATD E+KKAYR+ ALQ+HPDK  +P++ EE    F  + +AYE+L+D ++R
Sbjct: 6  YELLGVETNATDVELKKAYRRKALQFHPDK--NPDNVEETTAIFASVRAAYEVLADPQER 63

Query: 65 AHYD 68
          A YD
Sbjct: 64 AWYD 67

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ +  D+E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EIL+D  K
Sbjct: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILNDPNK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REVYDKYG 68

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 12/141 (8%)

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVH-F 270
           G   + E KQ+ + +  G +    I  +NE D          +  +I+E       +H F
Sbjct: 202 GPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEK------MHDF 255

Query: 271 I-RKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGW 329
           + R G D    L LS  E+L GF       ++DGR + +S    + ++P    +   +G 
Sbjct: 256 LKRDGNDLTYTLPLSFKESLLGFSKTV--HTIDGRQIFIS--KTQPVQPSEESRYPGQGM 311

Query: 330 PVNPQASKFGDLYVIIKIEFP 350
           P++   S+ GDL V  KI++P
Sbjct: 312 PLSKNPSERGDLIVKYKIDYP 332

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 44/68 (64%), Gaps = 4/68 (5%)

Query: 1  MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60
          + D Y +LGV SSA+  EIKKAY KLA QYHPD     N     E KF ++ +AYEILSD
Sbjct: 33 IKDPYGVLGVKSSASQGEIKKAYYKLAKQYHPDI----NKEAGAEKKFHDLQNAYEILSD 88

Query: 61 EEKRAHYD 68
          E KR  +D
Sbjct: 89 ESKRKQFD 96

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 108/267 (40%), Gaps = 41/267 (15%)

Query: 96  YDSYAFDNDKSKDVKIPLKLSIQELYNGKTFKFQSKRNII--CVQCEGLGWRRRKNGNVT 153
           + S  +   K   V +   +S ++   GK+   + K N+   C  C G G ++  + +  
Sbjct: 173 FSSSGYRQYKGDSVHVSYNMSFKDAVFGKS-GVKLKFNVFDPCDTCSGSGIKKGASRH-- 229

Query: 154 IPHEIECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGK 213
                +C  C G G K   R    GF       C +C G+G       +  + C  CHG+
Sbjct: 230 -----QCPGCQGSGTKIHVRG---GFQMMST--CNECQGEGTTV----NSSDLCGACHGE 275

Query: 214 GL-LSENKQLLVSVPRGLQNKDTIRIENEA-------DQEIGKS---KTGDII--LVIEE 260
           G+     K++ V +P GLQ+ D IRI  +        D  +  S     GD++  + +EE
Sbjct: 276 GVHFHRGKEITVDLPHGLQDGDVIRIPGQGSYPEVALDPSLAGSVKLTRGDVLVNVRVEE 335

Query: 261 DTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGN 320
           D T       IR  +D    + + +  A  G        ++DG  + L V  G   + G+
Sbjct: 336 DPTFT-----IRDKSDIWYTMEIPITTAALG--GTVQVPTVDGSHIRLKVAPG--TQSGD 386

Query: 321 IIKIKQEGWPVNPQASKFGDLYVIIKI 347
           +I +   G P +      G + V  +I
Sbjct: 387 VITVPNMGVPRSNLTRSRGAMKVQYRI 413

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV S A+D E+KKAYRK AL+YHPDK  +PN+ EE    F  I  AYE+LSD ++R
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDK--NPNNVEEATQAFATIRLAYEVLSDPQER 63

Query: 65 AHYDLY 70
          A YD +
Sbjct: 64 AWYDSH 69

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 51/69 (73%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LGV+++A+  EIKKAYRK ++Q HPDK  +PND +  E +F+ I+ AY++L D+E
Sbjct: 6  EYYDLLGVSTTASAIEIKKAYRKKSIQEHPDK--NPNDLKATE-RFQAISEAYQVLGDDE 62

Query: 63 KRAHYDLYG 71
           RA YD +G
Sbjct: 63 LRAKYDKFG 71

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV   AT  +IKKAYRK A+Q HPDK  +PND  E + KF+E++ AY++LSD E R
Sbjct: 8  YDVLGVQPDATAEQIKKAYRKKAIQTHPDK--NPND-PEAQAKFQEVSKAYKVLSDGELR 64

Query: 65 AHYDLYG 71
          + YD  G
Sbjct: 65 SRYDEVG 71

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 49/66 (74%), Gaps = 2/66 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV  +A+D+E+KKAYRK ALQ+HPDK  +P++ +E    F  I +AYE+LSD ++R
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDK--NPDNVDEATENFATIRAAYEVLSDPQER 63

Query: 65 AHYDLY 70
          A YD +
Sbjct: 64 AWYDAH 69

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV  +ATD E+KKAYRK ALQ+HPDK  +P++ +E    F  I SAYE+LSD ++R
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDK--NPDNVDEATEIFATIRSAYEVLSDPQER 63

Query: 65 AHYDLY 70
          A YD +
Sbjct: 64 AWYDAH 69

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 50/74 (67%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           + D Y ILGV++SA D EIK AYRKL++++HPDK+   L P  R + E  + +IT AYE 
Sbjct: 120 LFDPYEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYES 179

Query: 58  LSDEEKRAHYDLYG 71
           L+DE  + +Y  YG
Sbjct: 180 LTDENVKENYLRYG 193

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/64 (57%), Positives = 45/64 (70%), Gaps = 2/64 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV S A+D E+KKAYRK ALQYHPDK  +P   EE    F  I +AYE+LSD ++R
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDK--NPTKVEEATEIFATIRTAYEVLSDPQER 63

Query: 65 AHYD 68
          A YD
Sbjct: 64 AWYD 67

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 66.2 bits (160), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 44/68 (64%), Gaps = 4/68 (5%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           Y +L +  SA+D+EIKK+YRKLA++ HPDK   P   E     FK I  A+E+LSDEEK
Sbjct: 25 FYEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRASE----AFKVINRAFEVLSDEEK 80

Query: 64 RAHYDLYG 71
          R  YD  G
Sbjct: 81 RRLYDRLG 88

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 50/69 (72%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LGV+++A+  EIKKAYRK ++Q HPDK  +PND    E +F+ I+ AY++L D++
Sbjct: 6  EYYDLLGVSTTASSIEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLGDDD 62

Query: 63 KRAHYDLYG 71
           RA YD YG
Sbjct: 63 LRAKYDKYG 71

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +LGV+ +A + E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EIL+D   
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILNDPNT 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REVYDQYG 68

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 62/139 (44%), Gaps = 8/139 (5%)

Query: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFI 271
           G G   E  Q+ + +  G +    +  +N+ D          +  VI+E     +   F 
Sbjct: 182 GPGGSQEKTQIDIQLRPGWKAGTKVTYKNQGDYNPRSGGRKTLQFVIQEK----AHPDFK 237

Query: 272 RKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV 331
           R G D +  L LS  E+L GF       ++DGR L LS    + I+P  I     +G PV
Sbjct: 238 RDGDDLIYILRLSFKESLLGFSKTI--NTIDGRKLPLS--RSQPIQPTEISTYPGQGMPV 293

Query: 332 NPQASKFGDLYVIIKIEFP 350
           +   S+ G+L +  KI++P
Sbjct: 294 SKNPSQRGNLIIKYKIDYP 312

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LG+  SAT  EIKKAYRK +++ HPDK  +PND +  E +F+ I+ AY++LSDE  R
Sbjct: 8  YDLLGIEPSATQGEIKKAYRKKSIKEHPDK--NPNDPQATE-RFQAISEAYQVLSDESLR 64

Query: 65 AHYDLYG 71
            YD YG
Sbjct: 65 LKYDKYG 71

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 2/66 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV S A+D+++KKAYR+ ALQYHPDK +  N ++  EI F  I +AYE+LSD ++R
Sbjct: 6  YELLGVDSGASDTDLKKAYRRKALQYHPDKNI-GNVQQATEI-FASIRAAYEVLSDAQER 63

Query: 65 AHYDLY 70
          A YD +
Sbjct: 64 AWYDAH 69

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 52/74 (70%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           + D Y ILG+++SA+D +IK AYRKL++++HPDK+   L P+++   E  + +IT AYE 
Sbjct: 123 LFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYES 182

Query: 58  LSDEEKRAHYDLYG 71
           L+DE  R +Y  YG
Sbjct: 183 LTDELVRQNYLKYG 196

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
          LY +L V  +A + E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EIL+D +K
Sbjct: 7  LYDLLNVQPTANEQELKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILNDPQK 60

Query: 64 RAHYDLYG 71
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 269 HFIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEG 328
           HF R+  + +  L L+  E+L GF      +++DG+ L LS   G+ ++P        +G
Sbjct: 275 HFKREDDNLIYTLPLTFKESLLGFSKTI--QTIDGKNLPLS--RGQPVQPSETTTYPGQG 330

Query: 329 WPVNPQASKFGDLYVIIKIEFP 350
            P+  +  + GDL +  K+++P
Sbjct: 331 MPITKKPGQRGDLLIKYKVDYP 352

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 52/74 (70%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           + D Y ILGV++SA+D +IK AYRKL++++HPDK+   L P+++   E  + +IT AYE 
Sbjct: 123 LFDPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYES 182

Query: 58  LSDEEKRAHYDLYG 71
           L+DE  R +Y  YG
Sbjct: 183 LTDELVRQNYLKYG 196

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LG+  +AT  EIKKAYRK ++Q HPDK  +PND    E +F+ I+ AY++LS EE R
Sbjct: 8  YDLLGIGPTATAVEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLSSEELR 64

Query: 65 AHYDLYG 71
          A YD +G
Sbjct: 65 AKYDKFG 71

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 47/64 (73%), Gaps = 2/64 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +L V S A+D ++KKAYR+ ALQYHPDK  +P++ EE    F EI +AYE+LSD ++R
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDK--NPDNVEEATTIFAEIRAAYEVLSDPQER 63

Query: 65 AHYD 68
          A YD
Sbjct: 64 AWYD 67

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LGV+++A+  EIKKAYRK ++Q HPDK  +PND +  E +F+ I+ AY++L D E
Sbjct: 6  EYYDLLGVSTTASAIEIKKAYRKKSIQEHPDK--NPNDPKATE-RFQAISEAYQVLGDNE 62

Query: 63 KRAHYDLYG 71
           R  YD YG
Sbjct: 63 LRVKYDKYG 71

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +L V S ATD+++K+AYRK AL YHPDK  + N+ EE    F +I +AYE+LSD ++R
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDK--NRNNIEEATEVFAQIRAAYEVLSDAQER 63

Query: 65 AHYDLYGD 72
          A YD + D
Sbjct: 64 AWYDAHKD 71

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LG++ SAT  EIKKAYRK ++Q HPDK  +PND    E +F+ I+ AY++LSD+  R
Sbjct: 8  YELLGISPSATAIEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLSDDTLR 64

Query: 65 AHYDLYG 71
            YD YG
Sbjct: 65 LKYDKYG 71

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y  LG++ +AT +EIKKAYR+ A++ HPDK   P+D  E E KF+ +  AY++LSDE 
Sbjct: 6  EYYDRLGISPTATPTEIKKAYRRKAMETHPDK--HPDD-PEAENKFQAVGEAYQVLSDES 62

Query: 63 KRAHYDLYG 71
           RA YD YG
Sbjct: 63 LRARYDEYG 71

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV  +AT +EIKKAYR+ A+Q HPDK   P+D  E + KF+E+  AY++LSD   R
Sbjct: 8  YDVLGVQPTATPAEIKKAYRRRAMQTHPDK--HPDD-PEAQAKFQEVGEAYQVLSDPGLR 64

Query: 65 AHYDLYG 71
          + YD +G
Sbjct: 65 SRYDEFG 71

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           Y +L +   A+D+EIKKAYRKLA++ HPDK   P   E     FK I  A+E+LSDE+K
Sbjct: 23 FYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRASE----AFKRINRAFEVLSDEQK 78

Query: 64 RAHYDLYG 71
          R  +D  G
Sbjct: 79 RRIFDQVG 86

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 46/68 (67%), Gaps = 5/68 (7%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVL-DPNDREENEIKFKEITSAYEILSDEEK 63
          Y ILGVT +AT  EIKKAYRK ++Q HPDK   DP   E    +F+ I+ AY++LSDE+ 
Sbjct: 8  YEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDPMATE----RFQAISEAYQVLSDEDL 63

Query: 64 RAHYDLYG 71
          R  YD +G
Sbjct: 64 RGKYDRFG 71

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LG+T +AT  EIKKAYRK ++Q HPDK  +PND    E +F+ I+ AY++LS++E R
Sbjct: 8  YDLLGITPNATSIEIKKAYRKKSVQEHPDK--NPNDPGATE-RFQAISEAYQVLSNDELR 64

Query: 65 AHYDLYG 71
          A YD  G
Sbjct: 65 AKYDRLG 71

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 50/69 (72%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LG+ ++AT  EIKKAYRK +++ HPDK  +PND    E +F+ I+ AY++LSD +
Sbjct: 6  EYYELLGIETTATAVEIKKAYRKKSIEEHPDK--NPNDPGATE-RFQAISEAYQVLSDSD 62

Query: 63 KRAHYDLYG 71
           RA+YD +G
Sbjct: 63 LRANYDKFG 71

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 86/302 (28%), Positives = 130/302 (43%), Gaps = 56/302 (18%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y  LG+  SAT +EIKKAY KLA +YHP    D N   + E KF ++ +AYEILSDE 
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHP----DINKEVDAEKKFHDLQNAYEILSDEN 116

Query: 63  KRAHYDLYGDAXXXXXXXXXXXXXXXXXTDQPDYDSYAFDNDKSKDVKIPLKLSIQELYN 122
           KR  YD +G A                      +D   F N           ++ ++L+ 
Sbjct: 117 KRQQYDQFGPAAFGGGGAAGGPGSGGSPFGSQFHDFSGFTNAGGSPFG---GINFEDLF- 172

Query: 123 GKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIE--------------------CKK 162
           G  F    + +    +   + +R+ +   + I H++                     C  
Sbjct: 173 GAAFGGAGRSSGGGPRSSSM-FRQYRGDPIEIVHKVSFKDAVFGSNNVQLKFSALDPCST 231

Query: 163 CNGLGYKERTRML----IPGFVTTDKIR--------CEDCHGKGEVYAKPNSEKNKCKNC 210
           C+G G K  T  +      G  TT  IR        C  C+G+G +  +P   ++ C  C
Sbjct: 232 CSGTGMKPNTHKVNCSTCHGTGTTVHIRGGFQMMSTCPTCNGEGTM-KRP---QDSCTKC 287

Query: 211 HGKGL-LSENKQLLVSVPRGLQNKDTIRIEN---------EAD-QEIGKSKTGDIILVIE 259
           HG+G+ ++  K + V +P GLQ+ D +RI           EAD ++  K   GDI++ I 
Sbjct: 288 HGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDTVKLSRGDILVRIR 347

Query: 260 ED 261
            D
Sbjct: 348 VD 349

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 51/74 (68%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           + D Y++LGV+ SATD +IK AYRKL++++HPDK+   L   +R   E  + +I+ AYE 
Sbjct: 121 LFDPYALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEA 180

Query: 58  LSDEEKRAHYDLYG 71
           L+DE  +A+Y  YG
Sbjct: 181 LTDEITKANYLTYG 194

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 52/74 (70%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           + D Y ILG++SSA+D +IK AYRKL++++HPDK+   L  ++++  E  + +IT AYE 
Sbjct: 123 LFDPYEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYES 182

Query: 58  LSDEEKRAHYDLYG 71
           L+DE  R +Y  YG
Sbjct: 183 LTDELVRQNYLKYG 196

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 52/72 (72%), Gaps = 3/72 (4%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVL-DPNDREENEIK--FKEITSAYEILS 59
           D Y +LGV+ +A+D EIK AYRKL+L++HPDKV  D  + E+N ++  + +I+ AYE L+
Sbjct: 120 DPYDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALT 179

Query: 60  DEEKRAHYDLYG 71
           DE  + +Y +YG
Sbjct: 180 DELVKQNYLMYG 191

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y  LGV   A+ S+IKKAY KLA Q+HP    D N  E  E KF ++ +AYEILSDE 
Sbjct: 41  DPYETLGVAKDASASQIKKAYYKLAKQFHP----DINKDEGAEKKFHDLQNAYEILSDEN 96

Query: 63  KRAHYDLY 70
           KR  YD +
Sbjct: 97  KRRQYDQF 104

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/256 (21%), Positives = 103/256 (40%), Gaps = 38/256 (14%)

Query: 105 KSKDVKIPLKLSIQELYNG-KTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKC 163
           K   +++P KLS ++   G K    +      C  C G G +     +V       C  C
Sbjct: 171 KGDSIQVPFKLSFRDAVFGLKDVPLRYAVYDQCGTCSGSGLKAGAQRSV-------CGGC 223

Query: 164 NGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLL-SENKQL 222
           +G G +   R    GF       C  C G+G    +     ++C  C G+G++ + NK++
Sbjct: 224 HGTGTQVHVRA---GFQMAST--CSQCSGEGYSIRR----GDRCGTCSGEGVVFNRNKEV 274

Query: 223 LVSVPRGLQNKDTIRIENEAD----------QEIGKSKTGDIILVIEEDTTMPSDVHF-I 271
            +  P GLQ+ D +++  +                + + GD+++ ++    +  D  F I
Sbjct: 275 KMDFPHGLQDGDVVKVPGQGSFPHIQVDPKTAHTMRLRRGDLLVQVQ----VERDPRFQI 330

Query: 272 RKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV 331
           +   D      + +  A  G        ++DG  + L V  G   +P  ++ I  +G P 
Sbjct: 331 KNNYDIWYVQEIPITTAALG--GTVSIPTVDGDQIRLKVIPG--TQPDQVVSIPNKGVPR 386

Query: 332 NPQASKFGDLYVIIKI 347
               ++ GD+ V  +I
Sbjct: 387 GLSGAR-GDMKVQYRI 401

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 2/64 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV+S+A D E+KKA+R+ ALQYHPDK  D  + EE    F +I +AYE+L+D ++R
Sbjct: 6  YELLGVSSTADDLELKKAFRRKALQYHPDKNRD--NVEEATETFAQIRAAYEVLNDPQER 63

Query: 65 AHYD 68
          A YD
Sbjct: 64 AWYD 67

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 63.9 bits (154), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           Y IL V  +A D+EIKKAYRKLA++ HPDK   P   E     FK I  A+E+LSD EK
Sbjct: 23 FYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKASE----AFKIINRAFEVLSDVEK 78

Query: 64 RAHYDLYG 71
          R  YD  G
Sbjct: 79 RQLYDRIG 86

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 2/68 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPND--REENEIKFKEITSAYEILSD 60
           D Y ILGV  SAT  +++++Y +L  ++HPDK  + ND  R++NE K  EI  AYEILSD
Sbjct: 528 DYYKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYEILSD 587

Query: 61  EEKRAHYD 68
           ++KR  YD
Sbjct: 588 DDKRTKYD 595

>TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.297
           YJL073W
          Length = 666

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDK--VLDPNDREENEIKFKEITSAYEILSD 60
           D Y +L + +SATD EI+KAY  L  +YHPDK   L P  + +N  K   I  AYEILSD
Sbjct: 560 DFYKVLSIPTSATDKEIRKAYLLLTKKYHPDKQGQLSPKQQAKNHAKMIAINEAYEILSD 619

Query: 61  EEKRAHYD 68
           E KR  YD
Sbjct: 620 ENKRRDYD 627

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 50/74 (67%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           + D Y ILG++SSA++ EIK AYRKL++++HPDK+   L   +R   E  + +IT AYE 
Sbjct: 117 LFDPYDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEA 176

Query: 58  LSDEEKRAHYDLYG 71
           L+DE  R ++  YG
Sbjct: 177 LTDELTRQNFLKYG 190

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 51/74 (68%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           + D Y ILG+++SA+D +IK AYRKL++++HPDKV   L  +++   E  + +IT AYE 
Sbjct: 123 LFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAYES 182

Query: 58  LSDEEKRAHYDLYG 71
           L+DE  R +Y  YG
Sbjct: 183 LTDELVRQNYLKYG 196

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 63.9 bits (154), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           Y +L +   A+DS++KKAYRKLA++ HPDK   P   E     FK+I  A+E+LSDE K
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRAAE----AFKKINRAFEVLSDENK 80

Query: 64 RAHYDLYG 71
          R  YD  G
Sbjct: 81 RKVYDQIG 88

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 63.2 bits (152), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 45/70 (64%), Gaps = 4/70 (5%)

Query: 2  ADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDE 61
          ++ Y +L V  +A+D+EIKKAYR+LA++ HPDK   P   E     FK I  A+E+L DE
Sbjct: 22 SEFYEVLQVERTASDNEIKKAYRRLAIKLHPDKNGHPRSAE----AFKVINRAFEVLGDE 77

Query: 62 EKRAHYDLYG 71
          +KR  +D  G
Sbjct: 78 DKRRLFDQLG 87

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 63.5 bits (153), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           Y IL V  +A D+EIKK+YRKLA++ HPDK   P   E     FK I  A+E+L DE+K
Sbjct: 25 FYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKASE----AFKRINRAFEVLGDEKK 80

Query: 64 RAHYDLYG 71
          R  +D  G
Sbjct: 81 RVLFDRIG 88

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 63.5 bits (153), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 42/69 (60%), Gaps = 4/69 (5%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +L V   A+D+EIKKAYRKLA++ HPDK   P   E     FK I  A+E+LSD  
Sbjct: 24 EFYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASE----AFKRINRAFEVLSDVG 79

Query: 63 KRAHYDLYG 71
          KR  +D  G
Sbjct: 80 KRRMFDQLG 88

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 48/72 (66%), Gaps = 3/72 (4%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEILS 59
           D Y ILGVT S+T+ EIKKAYR L+L++HPDK+   L   +R   E  F +I+ AYE L+
Sbjct: 121 DPYEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAYEALT 180

Query: 60  DEEKRAHYDLYG 71
           +   + +Y LYG
Sbjct: 181 NPATKENYLLYG 192

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 59.7 bits (143), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 4/61 (6%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           Y +L V   A+D EIKKAYRKLA++ HPDK   P   E     FK I  A+E+LSDE+K
Sbjct: 23 FYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASE----AFKRINRAFEVLSDEQK 78

Query: 64 R 64
          R
Sbjct: 79 R 79

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LGV+  A+  EIKKAYRK A++ HPDK  D  D    + KF+ +  AY++LSDEE
Sbjct: 6  EYYDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDPD---AQAKFQRVGEAYQVLSDEE 62

Query: 63 KRAHYDLYG 71
           R  YD +G
Sbjct: 63 LRKRYDEFG 71

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y ILGV   AT +EIKKAYR+ A++ HPDK   PND    + KF+ +  AY++LSD+E
Sbjct: 6  EYYDILGVKPEATSAEIKKAYRRRAMETHPDK--HPND-PNAQAKFQAVGEAYQVLSDDE 62

Query: 63 KRAHYDLYG 71
           R  YD  G
Sbjct: 63 LRKRYDQLG 71

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y ILG+  SAT +EIKKAYRK A++ HPDK  D  D +    KF+ +  AY++LSD++
Sbjct: 6  EYYDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDPDAQS---KFQSVGEAYQVLSDDD 62

Query: 63 KRAHYDLYG 71
           R  YD +G
Sbjct: 63 LRKRYDEFG 71

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           Y IL V  ++T++EIKKAYRKLA++ HPDK   P   E     FK I  A+E+LSD EK
Sbjct: 22 FYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKASE----AFKIINRAFEVLSDNEK 77

Query: 64 RAHYDLYG 71
          R  +D  G
Sbjct: 78 RRIFDQLG 85

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV+ +A   EIKKAYRK ++Q HPDK  +PND    E +F+ I+ AY++LS+EE R
Sbjct: 8  YDLLGVSPNARPIEIKKAYRKKSVQEHPDK--NPNDPSATE-RFQSISQAYQVLSNEELR 64

Query: 65 AHYDLYG 71
            YD +G
Sbjct: 65 TKYDKFG 71

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 45/64 (70%), Gaps = 2/64 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +L V+  A+D E+KKAYRK ALQYHPDK  +  + EE    F EI +AYE+LSD ++R
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDK--NRENPEEATAIFSEIRAAYEVLSDPQER 63

Query: 65 AHYD 68
          A YD
Sbjct: 64 AWYD 67

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           Y IL V  +A D+EIKK+YRKLA++ HPDK   P   E     FK I  A+E+L D EK
Sbjct: 23 FYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRASE----AFKLINRAFEVLGDSEK 78

Query: 64 RAHYDLYG 71
          R+ YD  G
Sbjct: 79 RSLYDRLG 86

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV+  A   EIKKAYRK ++Q HPDK  +PND +  E +F+ I+ AY++LS +E R
Sbjct: 8  YDLLGVSPDAKAIEIKKAYRKKSVQEHPDK--NPNDPKATE-RFQAISEAYQVLSSDELR 64

Query: 65 AHYDLYG 71
          A YD +G
Sbjct: 65 AKYDKFG 71

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 4/69 (5%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +L V  SA++S+IKKAYRKLA++ HPDK   P   E     FK+I  A+E+LSD+ 
Sbjct: 22 EFYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRASE----AFKKINRAFEVLSDDS 77

Query: 63 KRAHYDLYG 71
          KR  +D  G
Sbjct: 78 KRRIFDQLG 86

>KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 471

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/310 (25%), Positives = 130/310 (41%), Gaps = 66/310 (21%)

Query: 105 KSKDVKIPLKLSIQE-LYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKC 163
           K ++V +P ++S ++ ++  K  K   +    C  C+G G +   + +V       C  C
Sbjct: 168 KGENVTVPFQVSFKDAVFGVKNVKLNYQCYDPCSSCDGSGLKAGHSRSV-------CPTC 220

Query: 164 NGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGL-LSENKQL 222
           +G G +   R    GF       C+ C G+G        + +KC  CH  G  L+ NK +
Sbjct: 221 HGTGTQVHVRA---GFQMAST--CQTCDGEGSTI----KDSDKCGTCHSHGFKLNSNKTI 271

Query: 223 LVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHF----------IR 272
            V +P GLQ+ DTIR+ N+       S  G  I     D +M S++H           +R
Sbjct: 272 TVDLPHGLQDGDTIRVPNQG------SYPGMAI-----DPSMKSELHLTRGDLLIRVRVR 320

Query: 273 KGTDF-------VMY---LSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNII 322
           K T F       ++Y   + ++ A AL G  +     +++   + L V SG   +   +I
Sbjct: 321 KDTRFQVSNNYDIIYTQEIPITTA-ALGGVIE---VPTVEEEKIRLKVSSG--TQHDQVI 374

Query: 323 KIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWFSEK----------SDIQLLRNVLPSGI 372
           +I  +G P   +  + GD+ V  KI        +E+          +D    R + PSG 
Sbjct: 375 RIPNKGVPRGARGDR-GDMLVKFKIVIKKPKDETERYLWETLAHLTNDTTARRTITPSGS 433

Query: 373 NGMMNSWKID 382
           +   NS   D
Sbjct: 434 SAKDNSSSAD 443

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 4/71 (5%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          D Y +LG+  +++ S+IKKAY KLA +YHPD     N  E+++ KF ++ +AYEILSDE+
Sbjct: 25 DPYKVLGINKNSSQSDIKKAYYKLAKKYHPD----INKEEDSQKKFHDLQNAYEILSDED 80

Query: 63 KRAHYDLYGDA 73
          KR  YD +G A
Sbjct: 81 KRKQYDQFGAA 91

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           Y +L V   A+D +IKKAYRK+A++ HPDK   P   E     FK++  A+E+LSDE+K
Sbjct: 25 FYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAE----AFKKVNRAFEVLSDEKK 80

Query: 64 RAHYDLYG 71
          R  YD  G
Sbjct: 81 RRVYDQLG 88

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV  SA   +IKKAYRK ++Q HPDK  +PND    E +F+ I+ AY++LS E+ R
Sbjct: 9  YDLLGVDPSAKAIDIKKAYRKKSVQEHPDK--NPNDPTATE-RFQAISQAYQVLSKEDLR 65

Query: 65 AHYDLYG 71
          A YD YG
Sbjct: 66 AKYDKYG 72

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           Y IL V  SA   EIKK+YRKLA++ HPDK   P   E     FK I  A+E+LSD+EK
Sbjct: 25 FYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKAGE----AFKVINRAFEVLSDDEK 80

Query: 64 RAHYDLYG 71
          R+ +D  G
Sbjct: 81 RSVFDRIG 88

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LGVT  AT ++IKKAYRK A+Q HPDK   P+D  E + KF+ +  AY++LSD  
Sbjct: 6  EYYDVLGVTPEATPTDIKKAYRKKAMQTHPDK--HPDD-PEAQSKFQAVGEAYQVLSDPG 62

Query: 63 KRAHYDLYG 71
           R+ YD +G
Sbjct: 63 LRSKYDQFG 71

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 51/74 (68%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           + D Y++L V++S+TD EI+ AYRKL++++HPDK+   L  N+R   E ++  IT AY+ 
Sbjct: 115 LFDPYALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKA 174

Query: 58  LSDEEKRAHYDLYG 71
           L+DE  R +Y  YG
Sbjct: 175 LTDEVTRENYLKYG 188

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV ++A+D+++KKAYRK AL YHPDK  D  + EE    F  I +AYE+L+D ++R
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDKNRD--NVEEATAIFATIRAAYEVLADPQER 63

Query: 65 AHYDLY 70
          A YD +
Sbjct: 64 AWYDSH 69

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 50/74 (67%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           M D Y +LG+++SA++ +IK AYRKL++++HPDK+   L   +R   E  + +IT AYE 
Sbjct: 127 MFDPYELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEA 186

Query: 58  LSDEEKRAHYDLYG 71
           L+DE  R ++  YG
Sbjct: 187 LTDEAMRENFLKYG 200

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          D Y++L V  S+ ++EIKK+YRKLA++ HPDK   P   E     FK I  A+E+LSD E
Sbjct: 22 DFYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKASE----AFKVINRAFEVLSDNE 77

Query: 63 KRAHYDLYG 71
          KR  +D  G
Sbjct: 78 KREIFDRIG 86

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LG++  AT SEIKKAYRK+A+  HPDK   P+D  E + KF+ +  AY++L+D  
Sbjct: 6  EFYDVLGISPEATPSEIKKAYRKMAMLTHPDK--HPDD-PEAQAKFQAVGEAYQVLNDPA 62

Query: 63 KRAHYDLYG 71
           R  YD +G
Sbjct: 63 LRKQYDEFG 71

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +L V   A D+E+KKAYR+ ALQYHPDK  +P + EE    F  I +AYE+LSD ++R
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDK--NPENVEEATEIFASIRAAYEVLSDPQER 63

Query: 65 AHYD 68
          A YD
Sbjct: 64 AWYD 67

>ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {ON}
           similar to uniprot|Q752R6 Ashbya gossypii AFR507W
           AFR507Wp and some similarites with YFL016C
           uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 462

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 98/411 (23%), Positives = 159/411 (38%), Gaps = 76/411 (18%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y  LGV  SA+ SEIKKAY KLA +YHPD     N  +    KF ++ +AYEILSD +
Sbjct: 33  DPYDTLGVGKSASPSEIKKAYYKLAKKYHPDI----NKEQGAGDKFHDLQNAYEILSDAD 88

Query: 63  KRAHYDL---------------------------------YGDAXXXXXXXXXXXXXXXX 89
           K++ YD                                  +G                  
Sbjct: 89  KKSQYDQFGAAAFGQGGAGGGPGGPGAGYGGFSDFSGFGNFGGINFEDLFGAAFGGGGGR 148

Query: 90  XTDQPDYDSYAFDNDKSKDVKIPLKLSIQE-LYNGKTFKFQSKRNIICVQCEGLGWRRRK 148
            +    + S  F   +   +++  ++  ++ ++  K    + +    C  C+G G +   
Sbjct: 149 SSRGSPFGSSMFREYRGDPIEVSYRMPFKDAVFGAKDVNLKFRALDPCHTCDGSGMK--- 205

Query: 149 NGNVTIPHEIECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCK 208
               T      C  C+G G     R    GF       C+ C G+G    +    ++ C 
Sbjct: 206 ----TGAKPQSCPSCHGTGTTVHVRA---GFQMA--TTCQQCGGEGTTTKR----EDLCG 252

Query: 209 NCHGKGL-LSENKQLLVSVPRGLQNKDTIRIENEAD-------QEIGKS---KTGDIILV 257
           +CHG G+  +++K + V +P+GLQ+ D +R+  +          E+  S   + GD+++ 
Sbjct: 253 SCHGDGVEWTKDKSVRVDLPQGLQDGDVVRVPGQGSYPNMAVPPEMKSSIRLRRGDVLVR 312

Query: 258 IEEDTTMPSDVHF-IRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVI 316
           I  D     D  F IR   D      + +  A  G        ++DG  + L V  G   
Sbjct: 313 IRVD----KDPRFSIRDKWDIWFIQDIPITTAALG--GTVQVPTVDGSHVRLRVQPG--T 364

Query: 317 RPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWFSEKSDIQLLRNV 367
           +   II I   G P    A   G + V  KI+       +E+   + L N+
Sbjct: 365 QHDQIISIPNMGVPR--VAGTRGSMKVQYKIQVKKPQSKAERCLWEALANI 413

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 51/69 (73%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LGV  ++TD EIKKAYRK +++ HPDK  +PN+ +  + KF+ I+ AY++LSD+ 
Sbjct: 6  EYYDLLGVEPNSTDIEIKKAYRKKSIKLHPDK--NPNNPDATK-KFQAISEAYQVLSDKN 62

Query: 63 KRAHYDLYG 71
           R++YD +G
Sbjct: 63 LRSNYDKFG 71

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 50/74 (67%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           + D Y++LGV +SATD E++ AYRKL++++HPDK+   L    R E E ++  IT AY+ 
Sbjct: 114 LFDPYTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKA 173

Query: 58  LSDEEKRAHYDLYG 71
           L+DE  + +Y  +G
Sbjct: 174 LTDEITKENYLKFG 187

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 3/72 (4%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEILS 59
           D Y +LG++ SA+D +IK AYRKL++++HPDK+   L   +R   E K+ +IT AYE L+
Sbjct: 121 DPYELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALT 180

Query: 60  DEEKRAHYDLYG 71
           DE  + ++  YG
Sbjct: 181 DEVIKENFLKYG 192

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           Y IL V  S++D +IKKAYRKLA++ HPDK   P   E     FK I  A+E+LSD +K
Sbjct: 22 FYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKAHE----AFKLINRAFEVLSDSQK 77

Query: 64 RAHYDLYG 71
          R  YD  G
Sbjct: 78 RQIYDQIG 85

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LG+   A+ +EIKKAYRK A+  HPDK   P+D  E + KF+ I  AY++LSD E
Sbjct: 6  EYYDLLGIQPDASATEIKKAYRKKAMLTHPDK--HPDD-PEAQAKFQAIGQAYQVLSDPE 62

Query: 63 KRAHYDLYG 71
           R+ YD +G
Sbjct: 63 LRSRYDEFG 71

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKV-LDPNDREEN-EIKFKEITSAYEILSD 60
           D Y ILGV+ SA+  EI+KAY  L  +YHPDK+  + ND++E+      +I  AYE LSD
Sbjct: 538 DYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSD 597

Query: 61  EEKRAHYDL 69
           ++KR  YDL
Sbjct: 598 DDKRKEYDL 606

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (66%), Gaps = 3/72 (4%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEILS 59
           D Y +LGVT S+TD EIK AYRKL++++HPDK+   L+  +R   E +F  I  AY+ L+
Sbjct: 111 DPYELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALT 170

Query: 60  DEEKRAHYDLYG 71
           DE  + +Y  YG
Sbjct: 171 DEITKENYRKYG 182

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 41/68 (60%), Gaps = 4/68 (5%)

Query: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63
           Y IL V  +A DSEIKKAYRKLA++ HPDK   P   E     FK I  A+E+L + EK
Sbjct: 23 FYEILKVNRTANDSEIKKAYRKLAIKLHPDKNPHPKAAE----AFKLINRAFEVLGNSEK 78

Query: 64 RAHYDLYG 71
          R  ++  G
Sbjct: 79 REIFNRIG 86

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 2/68 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKV--LDPNDREENEIKFKEITSAYEILSD 60
           D Y ILG++  AT  +I+KAY +L  +YHPDK   L  +++++N  K  EI  AYE LSD
Sbjct: 559 DYYKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLSD 618

Query: 61  EEKRAHYD 68
           E K++ YD
Sbjct: 619 EAKKSEYD 626

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y ILGV   AT +EIKKAYR+ A++ HPDK   P+D  E + KF+ +  AY++LSD   R
Sbjct: 8  YDILGVKPEATPAEIKKAYRRRAMETHPDK--HPDD-PEAQSKFQAVGEAYQVLSDPGLR 64

Query: 65 AHYDLYG 71
          + YD +G
Sbjct: 65 SRYDEFG 71

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKV-LDPNDREEN-EIKFKEITSAYEILSD 60
           D Y +LGV   AT  EI+KAY  L  +YHPDK+  + ND+EE       +I  AYE LSD
Sbjct: 535 DYYKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYETLSD 594

Query: 61  EEKRAHYDL 69
           ++KR  YDL
Sbjct: 595 DDKRKEYDL 603

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y ILGV   AT +EIKKAYR+ A+Q HPDK  D  D    + KF+ +  AY++LSD  
Sbjct: 6  EYYDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPD---AQAKFQAVGEAYQVLSDPG 62

Query: 63 KRAHYDLYG 71
           R+ YD +G
Sbjct: 63 LRSRYDEFG 71

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 47/64 (73%), Gaps = 2/64 (3%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +L V  +A+D+++KKAYR+ ALQYHPDK ++ N +E  +I F  I +AYEILSD ++R
Sbjct: 6  YELLDVEMTASDADLKKAYRRKALQYHPDKNIN-NIKEATDI-FANIRTAYEILSDPQER 63

Query: 65 AHYD 68
            YD
Sbjct: 64 VWYD 67

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV+  A   +IKKAYRK ++Q HPDK  +PND +  E +F+ I+ AY++L  +E R
Sbjct: 8  YDLLGVSPDAKQIDIKKAYRKKSVQEHPDK--NPNDPKATE-RFQAISEAYQVLGSDELR 64

Query: 65 AHYDLYG 71
          A YD +G
Sbjct: 65 AKYDKFG 71

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 44/69 (63%), Gaps = 2/69 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKV-LDPNDREEN-EIKFKEITSAYEILSD 60
           D Y  LGVT SAT  EI+KAY  L  +YHPDK+  + ND++E+      +I  AYE LSD
Sbjct: 538 DYYKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYEALSD 597

Query: 61  EEKRAHYDL 69
           + KR  YDL
Sbjct: 598 DNKRKEYDL 606

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LG+   AT +EIKKAYR+ A+Q HPDK  D  D +    KF+ +  AY++LSD +
Sbjct: 6  EYYDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDPDAQS---KFQAVGEAYQVLSDPQ 62

Query: 63 KRAHYDLYG 71
           ++ YD +G
Sbjct: 63 LKSRYDQFG 71

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKV--LDPNDREENEIKFKEITSAYEILSD 60
           D Y IL V  +A   +I+KAY +L  +YHPDK   L  N++  NE K   I  AYEILSD
Sbjct: 507 DYYKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEILSD 566

Query: 61  EEKRAHYDL 69
           E KR  YDL
Sbjct: 567 ESKRKEYDL 575

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 51/74 (68%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           + D Y++L +++S+TD EI+ AYRKL++++HPDK+   L  ++R   E ++  IT AY+ 
Sbjct: 113 LFDPYALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKA 172

Query: 58  LSDEEKRAHYDLYG 71
           L+DE  R +Y  YG
Sbjct: 173 LTDEITRENYLRYG 186

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y IL V+  A+  EIKK+YRKLA++ HPDK  +P+D  + + KF+E+  AY++L D++ R
Sbjct: 8  YDILQVSVDASPQEIKKSYRKLAIKTHPDK--NPDD-PQAQTKFQELAKAYQVLIDDDLR 64

Query: 65 AHYDLYG 71
            YD +G
Sbjct: 65 KKYDQFG 71

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LG+  +AT +EIKKAYR+ A++ HPDK   P+D   +E +F+++  AY++LSD +
Sbjct: 6  EYYDVLGIPPTATATEIKKAYRRKAMETHPDK--HPDDPTASE-RFQQVGEAYQVLSDPD 62

Query: 63 KRAHYDLYG 71
           R  YD +G
Sbjct: 63 LRKQYDEFG 71

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y ILG+   AT +EIKKAYR+ A++ HPDK  D  D    + KF+ +  AY++LSD+ 
Sbjct: 6  EYYDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDQG 62

Query: 63 KRAHYDLYG 71
           R+ YD +G
Sbjct: 63 LRSKYDEFG 71

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 2/69 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKV-LDPNDREEN-EIKFKEITSAYEILSD 60
           D Y ILGV+ +A   EI+KAY  L  +YHPDK+  + ND++E+      +I  AYE LSD
Sbjct: 542 DYYKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYETLSD 601

Query: 61  EEKRAHYDL 69
           E+KR  YDL
Sbjct: 602 EDKRKEYDL 610

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV+  A   +IKKAYRK ++Q HPDK  +PND    E +F+ I+ AY++LS ++ R
Sbjct: 8  YDLLGVSPDAKSIDIKKAYRKKSVQEHPDK--NPNDPTATE-RFQAISQAYQVLSKDDLR 64

Query: 65 AHYDLYG 71
          A YD +G
Sbjct: 65 AKYDKFG 71

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +L +  +AT  EIKKAYRK +++ HPDK  +PND    E +F+ I+ AY++LSD+ 
Sbjct: 6  EYYDLLDIDITATAIEIKKAYRKKSIKEHPDK--NPNDPTATE-RFQAISEAYQVLSDKN 62

Query: 63 KRAHYDLYG 71
           RA+YD +G
Sbjct: 63 LRANYDKFG 71

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (57%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y IL + S AT  EIKKAYR   L  HPDK+    +   N +   +I  AY+ILS+ +KR
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQKR 69

Query: 65 AHYD 68
            YD
Sbjct: 70 GEYD 73

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 48/74 (64%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           M D Y +LG++ SA+D +IK AYR+L+L++HPDK+   L   +R   E  + +I+ A+E 
Sbjct: 123 MFDPYDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEA 182

Query: 58  LSDEEKRAHYDLYG 71
           L+D   R +Y  YG
Sbjct: 183 LTDPIVRENYLKYG 196

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y ILG+   AT +EIKKAYR+ A++ HPDK  D  D    + KF+ +  AY++LSD  
Sbjct: 6  EYYDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPG 62

Query: 63 KRAHYDLYG 71
           R+ YD +G
Sbjct: 63 LRSKYDEFG 71

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y ILG+   AT +EIKKAYR+ A++ HPDK  D  D    + KF+ +  AY++LSD  
Sbjct: 6  EYYDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPG 62

Query: 63 KRAHYDLYG 71
           R+ YD +G
Sbjct: 63 LRSKYDEFG 71

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y  LG++  AT +EIKKAYRK A+  HPDK   PND  + + KF+ +  AY++LSD   R
Sbjct: 8  YDALGISPDATPTEIKKAYRKKAMLTHPDK--HPND-PDAQAKFQAVGQAYQVLSDPGLR 64

Query: 65 AHYDLYG 71
          + YD +G
Sbjct: 65 SRYDEFG 71

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y ILG+   AT +EIKKAYR+ A++ HPDK  D  D    + KF+ +  AY++LSD  
Sbjct: 6  EYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPG 62

Query: 63 KRAHYDLYG 71
           R+ YD +G
Sbjct: 63 LRSKYDQFG 71

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKV--LDPNDREENEIKFKEITSAYEILSD 60
           D Y ILGV  ++   EI+K+Y  L  +YHPDK   L   ++E N  K ++I  AYE LSD
Sbjct: 604 DYYKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEEEQERNHKKMEQINEAYECLSD 663

Query: 61  EEKRAHYDL 69
           E KR  YDL
Sbjct: 664 ESKRKEYDL 672

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 2/68 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEI--KFKEITSAYEILSD 60
           D Y +LG++ +A+  EI+KAY  L  +YHPDK    +++E+ +I  K  ++  AYEILSD
Sbjct: 522 DYYKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSD 581

Query: 61  EEKRAHYD 68
           E K+  YD
Sbjct: 582 EGKKRDYD 589

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (58%), Gaps = 2/68 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDK--VLDPNDREENEIKFKEITSAYEILSD 60
           D Y ILGV  ++    I+KAY  L  +YHPDK   L   ++E+N  K  EI  AYEIL D
Sbjct: 554 DYYKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEILGD 613

Query: 61  EEKRAHYD 68
           E K+  YD
Sbjct: 614 ESKKKEYD 621

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV + A   +IKKAYRK +++ HPDK  +P+D    E +F+ I+ AY++LS EE R
Sbjct: 8  YDLLGVATDAKQIDIKKAYRKKSVKEHPDK--NPDDPTATE-RFQAISEAYQVLSSEELR 64

Query: 65 AHYDLYG 71
            YD +G
Sbjct: 65 MKYDKFG 71

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LGV  +ATD EIKKAYRK ++  HPDK  D     E   +F+ I+ AY++LS+++
Sbjct: 6  EYYDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAATE---RFQSISEAYQVLSNKD 62

Query: 63 KRAHYDLYG 71
           RA+YD  G
Sbjct: 63 LRANYDKSG 71

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
          + Y +LG+   A+ ++IKKAYRK A+  HPDK   P+D  E + KF+ I  AY++LSD +
Sbjct: 6  EYYDLLGLQPDASATDIKKAYRKKAMLTHPDK--HPDD-PEAQAKFQAIGEAYQVLSDPD 62

Query: 63 KRAHYDLYG 71
           R+ YD +G
Sbjct: 63 LRSRYDEFG 71

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 50/74 (67%), Gaps = 3/74 (4%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEI 57
           + D Y +LG+ +SAT+ E++ +YRKL++++HPDK+   L   +R + E ++  IT AY+ 
Sbjct: 113 LFDPYELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKA 172

Query: 58  LSDEEKRAHYDLYG 71
           L++E  R +Y  YG
Sbjct: 173 LTEEVTRENYLKYG 186

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDK--VLDPNDREENEIKFKEITSAYEILSD 60
           + Y +LGV   AT  +I+K+Y  +  +YHPDK   L    + +N+ K  EI  AYEILSD
Sbjct: 505 NYYKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSD 564

Query: 61  EEKRAHYD 68
           E KR  YD
Sbjct: 565 EGKRKEYD 572

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDK--VLDPNDREENEIKFKEITSAYEILSD 60
           + Y +L VT  AT  +I+K+Y  +  +YHPDK   L  + + +N+ +  EI  AYEILSD
Sbjct: 503 NYYKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILSD 562

Query: 61  EEKRAHYD 68
           E KR  YD
Sbjct: 563 EGKRKEYD 570

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 50/109 (45%), Gaps = 17/109 (15%)

Query: 136 CVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGE 195
           C +C G G  R             C  C+G G K   R    GF       C  CHG+G 
Sbjct: 252 CNKCSGSGLNRNAK-------RTTCPSCHGSGQKVHIRS---GFQMVST--CNHCHGEGT 299

Query: 196 VYAKPNSEKNKCKNCHGKGL-LSENKQLLVSVPRGLQNKDTIRIENEAD 243
           +       K+ C +CHG G+ L+ NK + V++P GLQ+ D IR+  + +
Sbjct: 300 II----DSKDICSSCHGDGVELNHNKSIDVNLPNGLQDGDVIRVPGQGN 344

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/71 (54%), Positives = 50/71 (70%), Gaps = 4/71 (5%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60
           + D YS+LGV +SA+ SEIKKAY KLA +YHPD     N + + E KF ++ +AYEILSD
Sbjct: 77  IKDPYSVLGVNNSASTSEIKKAYYKLAKKYHPDI----NKQPDAEKKFHDLQNAYEILSD 132

Query: 61  EEKRAHYDLYG 71
           E KR  YD +G
Sbjct: 133 ENKRKQYDTFG 143

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 84/209 (40%), Gaps = 38/209 (18%)

Query: 136 CVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGE 195
           C  C G G +          H+  C+ CNG G +   R    GF       C DC+G+G 
Sbjct: 210 CNTCNGSGLKHNA-------HKSTCQTCNGTGTRVHIR---GGFQMMST--CNDCNGEG- 256

Query: 196 VYAKPNSEKNKCKNCHGKGL-LSENKQLLVSVPRGLQNKDTIRIENEA------------ 242
               PN   + C +CHG G+    NK++ V +P  LQ+ D IR+ N+             
Sbjct: 257 TKIDPN---DYCNHCHGDGVEFKRNKEITVDLPNALQDGDVIRVSNKGSYPQMAMDPDLI 313

Query: 243 DQEIGKSKTGDIILVIEEDTTMPSDVHF-IRKGTDFVMYLSLSLAEALTGFKDKFLSKSL 301
           +    +   GDI++ I     + +D  F IR   D    + + +  A  G        S+
Sbjct: 314 NNNNVRMTRGDILIKIN----VINDTKFKIRDKYDIWYTMEIPITTAALG--GIVTIPSI 367

Query: 302 DGRILTLSVPSGKVIRPGNIIKIKQEGWP 330
           DG  + L V  G   +   II I   G P
Sbjct: 368 DGTNVRLRVSPG--TQNDQIISIPNMGVP 394

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 48/71 (67%), Gaps = 4/71 (5%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60
           + D Y  LG+ S+A+ S+IKKAY KLA +YHP    D N  E  E KF ++ +AYEILSD
Sbjct: 45  IKDPYKTLGINSNASQSDIKKAYYKLAKKYHP----DINKEENAEAKFHDLQNAYEILSD 100

Query: 61  EEKRAHYDLYG 71
           E+KR  YD +G
Sbjct: 101 EQKRKQYDQFG 111

>SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32527 Saccharomyces
           cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
           chaperone contains a DnaJ domain together with Ssz1p
           acts as a chaperone for nascent polypeptide chains
          Length = 432

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (62%), Gaps = 4/70 (5%)

Query: 2   ADLYSILGVTS---SATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEIL 58
           ADLY+ +G++     ATD++I KA+RK  L++HPDK       EE+   FK I  AYE L
Sbjct: 96  ADLYAAMGISKLRYKATDAQIIKAHRKQVLKHHPDKKSASGGLEEDGF-FKIIQKAYETL 154

Query: 59  SDEEKRAHYD 68
           +D  KRA YD
Sbjct: 155 TDSNKRAQYD 164

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 5   YSILGVTSSATDSEIKKAYRKLALQYHPD---KVLDPNDREENEIKFKEITSAYEILSDE 61
           Y ILG+   A+D EI+KAY  L  +YHPD   K L   + ++N+ K  EI  AYE+L+DE
Sbjct: 543 YQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEVLNDE 602

Query: 62  EKRAHYD 68
           EKR  YD
Sbjct: 603 EKRKEYD 609

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          YSILG+T  ATD+EI+K+Y KLA Q HPDK    +  E     FK +  A+ IL+DEE +
Sbjct: 9  YSILGLTPKATDNEIRKSYMKLARQLHPDKSKSDSCAE----LFKLVVHAHSILTDEETK 64

Query: 65 AHYD 68
            YD
Sbjct: 65 RKYD 68

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEI--KFKEITSAYEILSD 60
           D Y IL V+  A   +I+K+Y  L  ++HPDK    +++E+ +I  K  EI  AYE+LSD
Sbjct: 527 DYYKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVLSD 586

Query: 61  EEKRAHYDL 69
           E KR  YDL
Sbjct: 587 ETKRNEYDL 595

>TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.297
           YJL073W
          Length = 604

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 2/68 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEI--KFKEITSAYEILSD 60
           D Y ILG+  +AT  +I++AY     +YHPDK    +++EE++I  K  +I  AYE LSD
Sbjct: 494 DYYKILGLPKTATSKDIRRAYLDFTKKYHPDKQGQLSEKEESKIHEKMSQINEAYETLSD 553

Query: 61  EEKRAHYD 68
           + +R  YD
Sbjct: 554 DTRRKEYD 561

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (63%), Gaps = 3/72 (4%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKV---LDPNDREENEIKFKEITSAYEILS 59
           D Y +L V S ATD EI+ AYRKL++++HPDK+   L   +R   E ++  IT AY+ L+
Sbjct: 115 DPYELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALT 174

Query: 60  DEEKRAHYDLYG 71
           D+  R ++  YG
Sbjct: 175 DDATRDNFLRYG 186

>SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {ON}
           some similarities with uniprot|P35191 Saccharomyces
           cerevisiae YFL016C MDJ1 Protein involved in folding of
           mitochondrially synthesized proteins in the
           mitochondrial matrix localizes to the mitochondrial
           inner membrane member of the DnaJ family of molecular
           chaperones
          Length = 510

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 85/200 (42%), Gaps = 30/200 (15%)

Query: 160 CKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGL-LSE 218
           C  C G G +   R    GF       C  C G+G V        + C  CHG+G+ ++ 
Sbjct: 242 CPGCQGTGTRVHVRA---GFQMAST--CTQCDGEGSVI----RGSDMCGTCHGEGVVMNR 292

Query: 219 NKQLLVSVPRGLQNKDTIRIENEA-------DQEIGKS---KTGDIILVIEEDTTMPSDV 268
            KQ+ V +P GLQ+ D IRI  E        D  +  S   + GD++L +  D     D 
Sbjct: 293 GKQIKVDLPHGLQDGDAIRISREGSYPHISIDPSMKNSVHLRRGDLLLRVRVD----KDP 348

Query: 269 HF-IRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQE 327
            F I+   D      + L  A  G        ++DG+ + L V  G   +  +++ I Q+
Sbjct: 349 RFSIKNNYDIWFTQEIPLTTAALG--GVVTVPTVDGQQIRLKVKQG--TQHDDVVSIPQQ 404

Query: 328 GWPVNPQASKFGDLYVIIKI 347
           G P     S+ GD+ V  K+
Sbjct: 405 GVPRGTLGSR-GDMKVQYKL 423

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 49/73 (67%), Gaps = 4/73 (5%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60
           + D Y  LGV+ SA+ SEIKKAY KLA +YHPD     N  E+ + KF ++ +AYEILSD
Sbjct: 54  IKDPYKTLGVSQSASGSEIKKAYYKLAKKYHPDI----NKAEDAQKKFHDLQNAYEILSD 109

Query: 61  EEKRAHYDLYGDA 73
           E K+  +D +G A
Sbjct: 110 ETKKQQWDQFGPA 122

>YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON}
          JJJ2Protein of unknown function, contains a J-domain,
          which is a region with homology to the E. coli DnaJ
          protein
          Length = 583

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 4/64 (6%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          YSILG+TS+AT SE+ K+Y KLA   HPDK       +++E  FK +  A+ IL+DE+++
Sbjct: 15 YSILGLTSNATSSEVHKSYLKLARLLHPDKT----KSDKSEELFKAVVHAHSILTDEDQK 70

Query: 65 AHYD 68
            YD
Sbjct: 71 LRYD 74

>KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 473

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 92/225 (40%), Gaps = 35/225 (15%)

Query: 136 CVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGE 195
           C  C+G G +   +          C  C+G G +   R    GF       C  C G+G 
Sbjct: 206 CGTCDGSGLKPGAS-------RTTCPGCSGTGTRVHIRA---GFQMAST--CNQCGGEGS 253

Query: 196 VYAKPNSEKNKCKNCHGKGL-LSENKQLLVSVPRGLQNKDTIRIENE----------ADQ 244
           V      + + C  CHG+G  L+++  + V +P GLQ+ D IRI  +          A +
Sbjct: 254 VV----RDSDTCATCHGEGASLNKDHAIKVDLPHGLQDGDVIRISGQGSYPNIAVDPAMK 309

Query: 245 EIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGR 304
           +  +   GD++L I  D     D  F  K   + ++L+  +              ++DG 
Sbjct: 310 DTVRLSRGDVLLRIRVD----KDPRFQIK-NKYDIWLTQDIPITTAALGGIVTVPTVDGE 364

Query: 305 ILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEF 349
            + L V  G   +  +++ I Q+G P     S+ GD+ V  KI  
Sbjct: 365 QVRLKVAPG--TQHNDVVSISQKGVPRGAFGSR-GDMKVQYKISI 406

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 50/73 (68%), Gaps = 4/73 (5%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60
           + D Y+ LGV+ SA+ SEIKKAY KLA +YHPD     N  E+ + KF ++ +AYEILSD
Sbjct: 38  LKDPYATLGVSKSASGSEIKKAYYKLAKKYHPDI----NKAEDAQKKFHDLQNAYEILSD 93

Query: 61  EEKRAHYDLYGDA 73
           + KR  +D +G A
Sbjct: 94  DSKRQQWDQFGPA 106

>CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016c MDJ1
           heat shock protein - chaperone
          Length = 522

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 94/229 (41%), Gaps = 41/229 (17%)

Query: 136 CVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGE 195
           C  C G G +   +       +  C  C+G G     R    GF       C+ C G+G 
Sbjct: 223 CGTCNGSGLKSGAS-------KTTCPSCHGSGTTVHVRA---GFQMMST--CQTCGGEGT 270

Query: 196 VYAKPNSEKNKCKNCHGKGL-LSENKQLLVSVPRGLQNKDTIRIENEA-------DQEIG 247
                 +  + CK+CHG+G+ ++  K + V +P GLQ+ D +RI  +        D+E+ 
Sbjct: 271 TV----NASDFCKSCHGEGVNVNTQKTITVDLPHGLQDGDVVRIPGQGSYPDIAVDKEMA 326

Query: 248 KS---KTGDIILVIEEDTTMPSDVHF-IRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDG 303
           KS     GDI++ I     +  D HF I+   D      + +  A  G        +++G
Sbjct: 327 KSVKLSRGDILVRIR----VNKDPHFSIKNKYDIWYTKEIPITTAALGGTVSI--PTIEG 380

Query: 304 RILTLSVPSGKVIRPGNIIKIKQEGWP-----VNPQASKFGDLYVIIKI 347
             + + VP+G    P  +I I   G P      N      GD+ +  K+
Sbjct: 381 TKIRIKVPAGTA--PEQVISIPNMGVPKSSPYRNSAVQARGDMKIQYKV 427

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 42/66 (63%), Gaps = 4/66 (6%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y  LGV  S++ S+IKKAY KLA +YHP    D N     E KF ++ +AYEILSDE 
Sbjct: 47  DPYETLGVKKSSSQSDIKKAYYKLAKKYHP----DINKEAGAEKKFHDLQNAYEILSDES 102

Query: 63  KRAHYD 68
           KR  YD
Sbjct: 103 KRKQYD 108

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEI--KFKEITSAYEILSD 60
           + Y ILG+ + A   +I++AY  L  +YHPDK  + +D E  ++  K   I  AYE+LSD
Sbjct: 509 NYYKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVLSD 568

Query: 61  EEKRAHYDL 69
           E KR  YD+
Sbjct: 569 ESKRKEYDM 577

>ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]
           {ON} weakly similar to uniprot|P40358 Saccharomyces
           cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
           nuclear membrane fusion during mating localizes to the
           ER membrane exhibits genetic interactions with KAR2
          Length = 584

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 39/69 (56%), Gaps = 2/69 (2%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDK--VLDPNDREENEIKFKEITSAYEILSD 60
           D Y IL +  +A   EI+KAY      YHPDK   L    +++N+ K  EI  AYE LSD
Sbjct: 475 DYYKILNIPKNANAKEIRKAYLNFTKMYHPDKQGQLSEEQQKKNDEKMSEINEAYETLSD 534

Query: 61  EEKRAHYDL 69
           E KR  YD+
Sbjct: 535 EGKRREYDM 543

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa]
          {ON} Anc_1.92 YGL128C
          Length = 312

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 6/70 (8%)

Query: 2  ADLYSILGV---TSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEIL 58
           +LY ILG     S+ T +EIKK YR LAL+YHPDK   PND    E KF +IT A  IL
Sbjct: 13 VNLYDILGFHNNNSTITSNEIKKRYRSLALKYHPDKT--PNDLTLVE-KFHKITIALNIL 69

Query: 59 SDEEKRAHYD 68
          ++ + +  YD
Sbjct: 70 TNNQLKTEYD 79

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 49/73 (67%), Gaps = 4/73 (5%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60
           + D Y +LG+  SAT SEIKKAY KLA +YHPD   +P      E KF ++ +AYEILSD
Sbjct: 49  IKDPYKVLGINKSATSSEIKKAYYKLAKKYHPDINKEPT----AEKKFHDLQNAYEILSD 104

Query: 61  EEKRAHYDLYGDA 73
           E K++ YD +G A
Sbjct: 105 ETKKSQYDTFGSA 117

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 61/137 (44%), Gaps = 24/137 (17%)

Query: 110 KIPLKLSIQELYNGKTFKFQSKRNII--CVQCEGLGWRRRKNGNVTIPHEIECKKCNGLG 167
           +IP K ++  L N        K N++  C  C G G ++    +       +C  C+G G
Sbjct: 199 RIPFKDAVFGLAN-----VSLKYNVMDPCHTCHGSGIKQGAQKH-------QCPSCHGSG 246

Query: 168 YKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGL-LSENKQLLVSV 226
            K   R    GF       C +CHG+G +     +  + C  CHG  +  + +  + V++
Sbjct: 247 QKVHIR---SGFQMVST--CNECHGEGTIL----NASDYCGTCHGDAVEFTRDHSINVNL 297

Query: 227 PRGLQNKDTIRIENEAD 243
           P GLQ+ D IRI  + +
Sbjct: 298 PNGLQDGDVIRIPGQGN 314

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/272 (25%), Positives = 112/272 (41%), Gaps = 39/272 (14%)

Query: 109 VKIPLKLSIQE-LYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLG 167
           ++I  K+S ++ ++  K  + +      C  C G G +          H++ C  C+G G
Sbjct: 206 IEIVHKVSFKDAVFGAKNVQLKFSALDPCGTCSGTGMKPNT-------HKVSCTTCHGSG 258

Query: 168 YKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLS-ENKQLLVSV 226
                R    GF       C  C+G+G +       ++ C +CHG+G+ +   K + V +
Sbjct: 259 STVHVRG---GFQMMST--CPTCNGEGTM----KRPQDNCTSCHGEGVQANRGKSITVDL 309

Query: 227 PRGLQNKDTIRIEN---------EAD-QEIGKSKTGDIILVIEEDTTMPSDVHF-IRKGT 275
           P GLQ+ D +RI           EAD Q+  K   GDI++ I  D     D  F IR   
Sbjct: 310 PHGLQDGDVVRIPGQGSYPDIAVEADLQDSIKLSRGDILVRIRVD----KDPSFSIRNKY 365

Query: 276 DFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQA 335
           D      + +  A  G        ++DG+ + + V  G   +   +I I   G P    A
Sbjct: 366 DIWYDKEIPITTAALG--GTITIPTVDGQKIRIKVAPG--TQYNQVISIPNMGVPRT--A 419

Query: 336 SKFGDLYVIIKIEFPPDNWFSEKSDIQLLRNV 367
           +  GD+ V  KI        +EK   + L +V
Sbjct: 420 TLRGDMKVQYKIVVKKPQSLAEKCLWEALADV 451

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 44/66 (66%), Gaps = 4/66 (6%)

Query: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62
           D Y  LG+  SAT +EIKKAY KLA +YHPD   +P    + E KF ++ +AYEILSD+ 
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEP----DAEKKFHDLQNAYEILSDDT 116

Query: 63  KRAHYD 68
           KR  +D
Sbjct: 117 KRQQFD 122

>SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa]
          {ON} weakly similar to uniprot|P52868 Saccharomyces
          cerevisiae YGL128C
          Length = 281

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 46/74 (62%), Gaps = 10/74 (13%)

Query: 2  ADLYSILGVTSSATDS-------EIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSA 54
           +LYS+LG +  + D+       +++K YRKLALQYHPDK  +P+D      KF +++ A
Sbjct: 13 VNLYSVLGFSPGSLDAVRAVSTLQVRKQYRKLALQYHPDK--NPHDTSLIH-KFHQVSVA 69

Query: 55 YEILSDEEKRAHYD 68
           +ILSD   R+ YD
Sbjct: 70 TKILSDSRLRSLYD 83

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 4/64 (6%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          YS+LG+TS AT+++IKKAYRK+A+  HPDK    N        FK ++ A  +L D+E+R
Sbjct: 14 YSMLGLTSDATEAQIKKAYRKIAMAIHPDK----NKSVSAAELFKLVSHAQSVLIDKEQR 69

Query: 65 AHYD 68
            Y+
Sbjct: 70 QSYN 73

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON}
          Anc_7.217 YER048C
          Length = 373

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y +LGV   AT SEIKKAYRK AL   P+K   P++   NE KF+ I  AY++L  +E R
Sbjct: 8  YELLGVEPDATSSEIKKAYRKKALSMLPEK--HPSNIGANE-KFQAIAEAYQVLHSKELR 64

Query: 65 AHYDLYG 71
            YD  G
Sbjct: 65 EKYDKLG 71

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 42/57 (73%)

Query: 3  DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILS 59
          D Y+ L +++ A DS++KK+YR+L L+YHPDK+ +   +EE + +F ++  +YE+L+
Sbjct: 12 DPYATLELSNDAEDSQVKKSYRRLMLRYHPDKLSNDLAKEEAQDRFHKVQLSYEVLT 68

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 5/72 (6%)

Query: 2   ADLYSILGVTSSATDS----EIKKAYRKLALQYHPDK-VLDPNDREENEIKFKEITSAYE 56
            DLY +LG+ S+  D     E+K+ Y+KL LQYHPDK V    D      +F  + SA++
Sbjct: 81  VDLYDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDKNVSGAEDASFVASRFHSLRSAFQ 140

Query: 57  ILSDEEKRAHYD 68
           IL D   R  YD
Sbjct: 141 ILCDSSLRTQYD 152

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 4/73 (5%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60
           + D YS LGV++SAT SEIKKAY KLA +YHPD     N   + + KF ++ +AYEILSD
Sbjct: 37  LKDPYSTLGVSNSATSSEIKKAYYKLAKKYHPDI----NKAADAQKKFHDLQNAYEILSD 92

Query: 61  EEKRAHYDLYGDA 73
           + KR  +D YG A
Sbjct: 93  DCKRQQWDQYGPA 105

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 94/224 (41%), Gaps = 37/224 (16%)

Query: 136 CVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGE 195
           C  C+G G +   + +        C  C+G G +   R    GF       C  C G+G 
Sbjct: 210 CNTCDGSGLKPGASRST-------CPGCSGTGTRVHVRA---GFQMAST--CNQCGGEGS 257

Query: 196 VYAKPNSEKNKCKNCHGKGL-LSENKQLLVSVPRGLQNKDTIRIENE----------ADQ 244
           V      + + C+ CHG+G  L +N +L V +P GLQ+ D IRI  +          A +
Sbjct: 258 VL----RDADTCQTCHGEGAKLDKNHELKVDLPHGLQDGDVIRISGKGSYPNIAVDPAMK 313

Query: 245 EIGKSKTGDIILVIEEDTTMPSDVHF-IRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDG 303
           +  +   GD++L I  D     D  F I+   D      + +  A  G        ++DG
Sbjct: 314 DTVRLSRGDLLLRIRVD----KDPRFQIKNKYDIWFTQDIPITTAALG--GVVTIPTVDG 367

Query: 304 RILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKI 347
             + L V  G   +  +++ I Q+G P     ++ GD+ V  ++
Sbjct: 368 EQVRLKVSPG--TQHHDVVSIPQKGVPRGSFGTR-GDMKVQYRV 408

>KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4
           YGR285C
          Length = 434

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 4/70 (5%)

Query: 2   ADLYSILGVTS---SATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEIL 58
           ADLY+ +G++     ATD +I KA+RK  ++YHPDK        EN+  FK I  A+E L
Sbjct: 97  ADLYAAMGLSQLRYRATDVQIVKAHRKQVVKYHPDK-QSAAGAAENDAFFKIIQKAFETL 155

Query: 59  SDEEKRAHYD 68
           +D  KR  YD
Sbjct: 156 TDRTKRMQYD 165

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 35/64 (54%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          Y IL + S AT  EIKKAYR   L  HPDK+      + N +    I  AY++LS+ + R
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNIKTR 69

Query: 65 AHYD 68
            YD
Sbjct: 70 GEYD 73

>TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {ON}
           Anc_8.61 YFL016C
          Length = 470

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (65%), Gaps = 4/73 (5%)

Query: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60
           + D Y  LGV  +A+ SEIKKAY KLA ++HPD   +PN     E KF ++ +AYEILSD
Sbjct: 34  IKDPYETLGVGKNASSSEIKKAYYKLAKKFHPDINKEPN----AEAKFHDLQNAYEILSD 89

Query: 61  EEKRAHYDLYGDA 73
           + K+  YD +G A
Sbjct: 90  DTKKQQYDQFGAA 102

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 69/168 (41%), Gaps = 32/168 (19%)

Query: 136 CVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGE 195
           C  C G G ++    +        C  C+G G     R    GF       C  C G+G 
Sbjct: 202 CGVCHGSGLKKNAQSST-------CPSCHGTGTTVHVRG---GFQMAST--CNQCGGEGT 249

Query: 196 VYAKPNSEKNKCKNCHGKGL-LSENKQLLVSVPRGLQNKDTIRIENEA-------DQEIG 247
              +P   ++ C  CHG+G+ L+  + + V +P+GLQ+ D +R+  +        D ++ 
Sbjct: 250 T-VRP---EDVCSKCHGEGVELNSQRSISVDLPQGLQDGDVVRVPGQGSYPHLAVDPKMK 305

Query: 248 KS---KTGDIILVIEEDTTMPSDVHF-IRKGTDFVMYLSLSLAEALTG 291
            S     GD+++ I  D     D  F IR  TD      + +  A  G
Sbjct: 306 NSVKLHRGDVLVRIRVD----KDSRFSIRNKTDIWFTKEIPITTAALG 349

>YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}
           ZUO1Ribosome-associated chaperone, functions in ribosome
           biogenesis and, in partnership with Ssz1p and SSb1/2, as
           a chaperone for nascent polypeptide chains; contains a
           DnaJ domain and functions as a J-protein partner for
           Ssb1p and Ssb2p
          Length = 433

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query: 2   ADLYSILGVTS---SATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEIL 58
           ADLY+ +G++     AT+S+I KA+RK  ++YHPDK        + +  FK I  A+E L
Sbjct: 96  ADLYAAMGLSKLRFRATESQIIKAHRKQVVKYHPDKQSAAGGSLDQDGFFKIIQKAFETL 155

Query: 59  SDEEKRAHYD 68
           +D  KRA YD
Sbjct: 156 TDSNKRAQYD 165

>Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR285C
           (ZUO1) - Zuotin, putative Z-DNA binding protein [contig
           73] FULL
          Length = 428

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 4/70 (5%)

Query: 2   ADLYSILGVTS---SATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEIL 58
           ADLY+ +G++     AT+++I KA+RK  L++HPDK       E++   FK I  AYE L
Sbjct: 95  ADLYAAMGLSKLRYRATEAQIIKAHRKQVLKHHPDKKSASGGLEQDGF-FKIIQKAYETL 153

Query: 59  SDEEKRAHYD 68
           +D  KRA YD
Sbjct: 154 TDSNKRAQYD 163

>TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa]
          {ON} Anc_1.185 YJL162C
          Length = 492

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 45/65 (69%), Gaps = 4/65 (6%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          YS+LG+T +A+ ++IKK+Y+KLA + HPDK       E +E+ FK +  AY ILSD ++R
Sbjct: 9  YSVLGLTPTASLNDIKKSYKKLARELHPDK---SKSNESSEL-FKIVVDAYSILSDVKER 64

Query: 65 AHYDL 69
            Y++
Sbjct: 65 EEYNI 69

>TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON}
          Anc_1.185 YJL162C
          Length = 556

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          YS LG++S+A ++EI K+Y  LA Q HPDK    +  E +  +FK I+ A+ +L DE KR
Sbjct: 15 YSTLGLSSNANEAEIHKSYMMLARQLHPDK----SKSEASAEQFKLISHAHSVLMDEAKR 70

Query: 65 AHYD 68
            YD
Sbjct: 71 LKYD 74

>SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa]
          {ON} similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and some similarites with YJL162C
          uniprot|P46997 Saccharomyces cerevisiae YJL162C JJJ2
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 583

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (62%), Gaps = 4/64 (6%)

Query: 5  YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64
          YS+LG+   ATD++I+K+Y KLA + HPDK    +  E     FK +  A+ IL+D EKR
Sbjct: 14 YSVLGLPFDATDAQIRKSYMKLARELHPDK----SKSEVAAELFKVVAHAHSILTDREKR 69

Query: 65 AHYD 68
            YD
Sbjct: 70 LKYD 73

>TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa]
           {ON} Anc_5.4 YGR285C
          Length = 430

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 2   ADLYSILGVTS---SATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEIL 58
           ADLY+ +G++     A D+++ KA+RK  L+YHPDK        + +  FK I  A+E L
Sbjct: 96  ADLYAAMGLSKLRYRANDTQVIKAHRKQVLKYHPDKTSAEGGSLDQDGIFKIIQKAFETL 155

Query: 59  SDEEKRAHYD 68
           +D  KRA YD
Sbjct: 156 TDSTKRAQYD 165

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,631,951
Number of extensions: 2320189
Number of successful extensions: 6506
Number of sequences better than 10.0: 391
Number of HSP's gapped: 5982
Number of HSP's successfully gapped: 493
Length of query: 433
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 321
Effective length of database: 40,638,807
Effective search space: 13045057047
Effective search space used: 13045057047
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)