Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B019908.263ON58858830450.0
NCAS0B050208.263ON56853422290.0
YLR089C (ALT1)8.263ON59249921240.0
Skud_12.1578.263ON59249921180.0
Smik_12.1488.263ON59249921130.0
TDEL0F039008.263ON55951621040.0
Suva_10.1738.263ON59249921050.0
KNAG0G020408.263ON59149020430.0
ZYRO0C01628g8.263ON53448620160.0
SAKL0H17006g8.263ON53148819990.0
KLLA0F19162g8.263ON52848619680.0
CAGL0L12254g8.263ON57450919720.0
KAFR0B027308.263ON53948719230.0
Kpol_392.58.263ON51252618630.0
NCAS0B038408.263ON49748918450.0
Skud_4.3728.263ON50750518100.0
TPHA0J007508.263ON52251217930.0
KNAG0M012108.263ON52149217910.0
YDR111C (ALT2)8.263ON50750517860.0
KAFR0B055308.263ON51451617680.0
Smik_4.3578.263ON50750517590.0
Suva_2.2718.263ON50750517540.0
KLTH0G13662g8.263ON51951517540.0
Kwal_56.237918.263ON51850417440.0
TBLA0E044408.263ON56248417350.0
NDAI0J013608.263ON50148917290.0
Kpol_543.398.263ON49248917110.0
KAFR0B05520singletonON51049016940.0
Ecym_43078.263ON53450316660.0
AGR085W8.263ON52150816610.0
TPHA0A018008.263ON49849016580.0
TBLA0F030608.263ON50049615560.0
TBLA0G01630singletonON50050015240.0
Kwal_34.160181.472ON3791591214e-06
Kwal_23.48882.252ON3891591134e-05
KLLA0F10021g3.511ON4973251144e-05
KLTH0G09614g2.252ON3891571117e-05
Kwal_14.25741.321ON443641101e-04
Kpol_1039.222.252ON3861841091e-04
KLTH0G19646g1.472ON3791081063e-04
KNAG0B006603.511ON496601063e-04
TPHA0O014501.321ON4431711010.001
TPHA0D033703.511ON497601010.001
YGL202W (ARO8)3.511ON500274990.002
Smik_10.1801.321ON44453990.002
NCAS0E006703.511ON49782980.003
KAFR0A017101.321ON435246980.003
CAGL0G01254g3.511ON50460980.003
Kpol_278.23.511ON49860970.003
SAKL0E08492g2.252ON384128960.004
CAGL0J05126g1.321ON43357960.004
Kpol_1035.231.321ON44471960.004
KNAG0B053201.321ON43357960.005
TPHA0F012602.252ON392124950.005
KLLA0F03509g2.252ON387176950.006
SAKL0D11528g1.472ON383152940.007
SAKL0D06886g1.321ON44771950.007
KLTH0H10648g1.321ON44367940.008
TDEL0D019001.321ON44340940.008
NDAI0G057601.321ON44871940.009
ZYRO0A01672g2.252ON386162930.010
ADL249W2.252ON387186930.010
KLLA0F01617g1.321ON44490920.013
ZYRO0C06028g3.511ON49660920.013
TDEL0D057903.511ON49760910.019
SAKL0F02156g3.511ON49876910.020
YJL060W (BNA3)1.321ON44453910.020
KLTH0G02002g3.511ON49660910.022
Skud_10.1561.321ON46040900.026
KNAG0G005501.472ON38753890.027
Suva_6.1361.321ON44453890.032
Skud_7.693.511ON500274880.040
NCAS0A092001.321ON44571880.040
Kwal_47.189823.511ON49660880.041
KLTH0G19624gsingletonON46852880.042
AEL170C1.321ON45871880.044
NDAI0I028303.511ON50060870.052
KLTH0E07678gna 1ON49243860.074
SAKL0H21824gna 1ON49963860.081
Kwal_47.17462na 1ON49263860.081
NCAS0G040501.472ON384105850.090
Smik_5.3198.204ON44372850.092
Smik_7.693.511ON50060850.11
KAFR0D014203.511ON492261850.11
KNAG0E018502.252ON384103840.13
TBLA0B009902.102ON54643840.13
Suva_7.613.511ON50060840.14
KLTH0B00176g8.204ON44833830.16
Ecym_32902.252ON386129830.18
NDAI0B037302.252ON386129820.24
ZYRO0G20636g1.321ON45340820.25
TDEL0A016008.204ON47533810.32
ZYRO0B11088g8.204ON45032790.46
NCAS0B064402.252ON385131790.47
KLLA0F13640g2.475ON41898790.48
Ecym_6319singletonON35440790.51
TPHA0O015202.102ON50343790.56
Kwal_14.9392.649ON56287790.61
TDEL0C040902.252ON383127780.64
Ecym_7228na 1ON48872780.77
TBLA0A103205.287ON62160780.77
Ecym_62921.321ON43041770.88
Kpol_480.11.472ON38044770.88
SAKL0A06974g6.121ON62380770.88
Suva_5.2818.204ON45093770.96
Skud_13.1732.565ON920148771.1
ABL038W2.475ON443152761.2
KAFR0J015802.252ON383129751.4
SAKL0E12188g2.102ON53043751.6
CAGL0C01243g2.252ON383104751.7
KLLA0A04906gna 1ON48043742.2
Kwal_8.5858.204ON44632742.2
Suva_15.3342.102ON56066732.5
TPHA0J024306.221ON587127742.5
Kwal_26.77682.475ON422224732.8
KNAG0G016808.204ON45233732.9
SAKL0D14630g7.14ON27056723.1
AFR548C3.511ON497128723.6
TDEL0E003802.3ON50544723.8
Suva_9.782.252ON386103714.1
CAGL0G06028g2.102ON53743724.3
TBLA0I011802.475ON443134714.6
Skud_9.552.252ON385104705.3
ZYRO0G05346g2.102ON50443706.7
YIL116W (HIS5)2.252ON385104706.7
Smik_9.532.252ON388106706.8
KNAG0H037302.102ON523172699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B01990
         (588 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...  1177   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   863   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   822   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   820   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   818   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   815   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   815   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   791   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   781   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   774   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   762   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   764   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   745   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   722   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   715   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   701   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   695   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   694   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   692   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            685   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   682   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   680   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   680   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   676   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   672   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   670   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   663   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   657   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   646   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   644   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   643   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   603   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              591   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    51   4e-06
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    48   4e-05
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    49   4e-05
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    47   7e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    47   1e-04
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    47   1e-04
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    45   3e-04
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    45   3e-04
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    44   0.001
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    44   0.001
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    43   0.002
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    43   0.002
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     42   0.003
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    42   0.003
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    42   0.003
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    42   0.003
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    42   0.004
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    42   0.004
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    42   0.004
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    42   0.005
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    41   0.005
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    41   0.006
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    41   0.007
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    41   0.007
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    41   0.008
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    41   0.008
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    41   0.009
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    40   0.010
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    40   0.010
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    40   0.013
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    40   0.013
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    40   0.019
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    40   0.020
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    40   0.020
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    40   0.022
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    39   0.026
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       39   0.027
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    39   0.032
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    39   0.040
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    39   0.040
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    39   0.041
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    39   0.042
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    39   0.044
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    38   0.052
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    38   0.074
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    38   0.081
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    38   0.081
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    37   0.090
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    37   0.092
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    37   0.11 
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    37   0.11 
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    37   0.13 
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    37   0.13 
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    37   0.14 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    37   0.16 
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    37   0.18 
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    36   0.24 
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    36   0.25 
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    36   0.32 
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    35   0.46 
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    35   0.47 
KLLA0F13640g Chr6 complement(1264781..1266037) [1257 bp, 418 aa]...    35   0.48 
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    35   0.51 
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    35   0.56 
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    35   0.61 
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    35   0.64 
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    35   0.77 
TBLA0A10320 Chr1 (2542498..2544363) [1866 bp, 621 aa] {ON} Anc_5...    35   0.77 
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    34   0.88 
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    34   0.88 
SAKL0A06974g Chr1 (620230..622101) [1872 bp, 623 aa] {ON} simila...    34   0.88 
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    34   0.96 
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    34   1.1  
ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic ho...    34   1.2  
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    33   1.4  
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    33   1.6  
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    33   1.7  
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    33   2.2  
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    33   2.2  
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    33   2.5  
TPHA0J02430 Chr10 complement(535317..537080) [1764 bp, 587 aa] {...    33   2.5  
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    33   2.8  
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    33   2.9  
SAKL0D14630g Chr4 (1206755..1207567) [813 bp, 270 aa] {ON} highl...    32   3.1  
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    32   3.6  
TDEL0E00380 Chr5 complement(89449..90966) [1518 bp, 505 aa] {ON}...    32   3.8  
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    32   4.1  
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    32   4.3  
TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {O...    32   4.6  
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    32   5.3  
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    32   6.7  
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    32   6.7  
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    32   6.8  
KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.1...    31   9.6  

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score = 1177 bits (3045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/588 (96%), Positives = 568/588 (96%)

Query: 1   MSVASIITFRRSTSTAVTTNFANLKQLNKMATCTYXXXXXXXXXXXXXXXXXXXXQVKKS 60
           MSVASIITFRRSTSTAVTTNFANLKQLNKMATCTY                    QVKKS
Sbjct: 1   MSVASIITFRRSTSTAVTTNFANLKQLNKMATCTYSIKANVSNSNSNNIKTINSNQVKKS 60

Query: 61  PLIIKATTTAIPEYQFFDAKRALMTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAK 120
           PLIIKATTTAIPEYQFFDAKRALMTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAK
Sbjct: 61  PLIIKATTTAIPEYQFFDAKRALMTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAK 120

Query: 121 YAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPD 180
           YAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPD
Sbjct: 121 YAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPD 180

Query: 181 ILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGG 240
           ILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGG
Sbjct: 181 ILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGG 240

Query: 241 EPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLD 300
           EPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLD
Sbjct: 241 EPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLD 300

Query: 301 EKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIV 360
           EKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIV
Sbjct: 301 EKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIV 360

Query: 361 VIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGY 420
           VIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGY
Sbjct: 361 VIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGY 420

Query: 421 MELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSEL 480
           MELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSEL
Sbjct: 421 MELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSEL 480

Query: 481 SIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDA 540
           SIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDA
Sbjct: 481 SIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDA 540

Query: 541 TGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEFYDNYRD 588
           TGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEFYDNYRD
Sbjct: 541 TGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEFYDNYRD 588

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/534 (76%), Positives = 466/534 (87%), Gaps = 6/534 (1%)

Query: 59  KSPLIIKATTTAIPEYQFFDAKRALMTRSISHHSLKVA----KGKDFAPAEQLTLADLNE 114
           K P  ++ +T+  P+Y +F+ KR + + +    +           +F PA+QLTLA+LN+
Sbjct: 37  KMPHFMEPSTS--PQYPYFETKRTISSAATKLKTKPKPTTKKNHNNFLPADQLTLAELND 94

Query: 115 NVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLS 174
           NVLKAKYAVRG+IPMRAEELK+QL+ +PS+LPF  IVNANIGNPQQL QKPLSFYRQVLS
Sbjct: 95  NVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLNQKPLSFYRQVLS 154

Query: 175 ILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFI 234
           +LQYP+ILK++E  L+ + ++K+DA++RAK LL EIGG+VGAYSASQGVYGIRKTVANFI
Sbjct: 155 LLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQGVYGIRKTVANFI 214

Query: 235 TERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHA 294
           T+RD GEPAYPEDIFLT        YLLSILC+GP+TGVLIPIPQYPLYTA+LALNNSHA
Sbjct: 215 TKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHA 274

Query: 295 LPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIA 354
           LPYYLDEKSGWSTNPKEIEEVV  A ++ I PSVLVVINPGNPTGAVL+E+SIEHIFEIA
Sbjct: 275 LPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIA 334

Query: 355 AKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGEC 414
           AKYGIVVIADEVYQEN+ + VKF+SMKKVLR LQK HPG +D VQLASLHSTSKGVSGEC
Sbjct: 335 AKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASLHSTSKGVSGEC 394

Query: 415 GQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERR 474
           GQRGGYMEL GFTHEVR VILKLASISLCPVVTGQALVDLMVSPPKKGD S+EQDQAER+
Sbjct: 395 GQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPKKGDESFEQDQAERK 454

Query: 475 HIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYC 534
           HIKSEL  RA QLY+ F  LEGIECQKPQGAMYLFP+LDLPFKAVQ+AQHLEM+PDEFYC
Sbjct: 455 HIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQKAQHLEMSPDEFYC 514

Query: 535 KSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEFYDNYRD 588
           KSLL+ATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWI+KW+ FH++FY+ YRD
Sbjct: 515 KSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQDFYNTYRD 568

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/499 (76%), Positives = 437/499 (87%), Gaps = 1/499 (0%)

Query: 90  HHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQ 149
           HH+LK +   +F PAEQLTL D+NENVLKAKYAVRG+IPMRAEELK QLE +P +LPF +
Sbjct: 95  HHTLKTSNN-EFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDR 153

Query: 150 IVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSE 209
           I+NANIGNPQQL+QKPL++YRQVLS+LQYP++L +NEQ L+D+K++K DAI RAK L+ +
Sbjct: 154 IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMED 213

Query: 210 IGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGP 269
           IGGSVGAYS+SQGV GIRK+VA FIT+RD GE +YPEDIFLT        YLLSI C+GP
Sbjct: 214 IGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGP 273

Query: 270 KTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVL 329
           +TGVLIPIPQYPLYTATLALNNS ALPYYLDE SGWSTNP+EIE VV++A++  I P+VL
Sbjct: 274 ETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVL 333

Query: 330 VVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQK 389
           VVINPGNPTGAVL+ ESI  IFE+AAKYG VVIADEVYQENI  G KF+SMKK+LR LQ+
Sbjct: 334 VVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQR 393

Query: 390 SHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQ 449
            HPGKFDNVQLASLHSTSKGVSGECGQRGGYMEL GF+HE+R+VILKLASISLCPVVTGQ
Sbjct: 394 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453

Query: 450 ALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLF 509
           ALVDLMV PP +G+ S+E DQAER  I  +L  RA  LYETF  LEGIECQKPQGAMYLF
Sbjct: 454 ALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLF 513

Query: 510 PKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGT 569
           PK+DLPFKAVQEA+HLE+TPDEFYCK LL++TGICTVPGSGFGQEPGTYHLRTTFLAPG 
Sbjct: 514 PKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 573

Query: 570 EWIKKWEAFHKEFYDNYRD 588
           EWIKKWE+FHKEF+D YRD
Sbjct: 574 EWIKKWESFHKEFFDQYRD 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/499 (76%), Positives = 437/499 (87%), Gaps = 1/499 (0%)

Query: 90  HHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQ 149
           HH+LK     DF PAEQLTL D+NENVLKAKYAVRG+IPMRAEELK QLE +P +LPF +
Sbjct: 95  HHTLKTG-NDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDK 153

Query: 150 IVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSE 209
           I+NANIGNPQQL+QKPL++YRQVLS+LQYP++L +NEQ L+D+K++K DAI RAK L+ +
Sbjct: 154 IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMED 213

Query: 210 IGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGP 269
           IGGSVGAYS+SQGV GIRK+VA FIT+RD GE +YPEDIFLT        YLLSI C+GP
Sbjct: 214 IGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGP 273

Query: 270 KTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVL 329
           +TGVLIPIPQYPLYTATLALNNS ALPYYLDE+SGWSTNP+EIE VV++A++  I P+VL
Sbjct: 274 ETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVL 333

Query: 330 VVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQK 389
           VVINPGNPTGAVL+ ES+  IFE+AAKYG VVIADEVYQENI  G KF+SMKK+LR LQ+
Sbjct: 334 VVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQR 393

Query: 390 SHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQ 449
            HPGKFDNVQLASLHSTSKGVSGECGQRGGYMEL GF+HE+R+VILKLASISLCPVVTGQ
Sbjct: 394 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453

Query: 450 ALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLF 509
           ALVDLMV PP +G+ S+E DQAER  I  +L  RA  LY+TF  LEGIECQKPQGAMYLF
Sbjct: 454 ALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLF 513

Query: 510 PKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGT 569
           PK+DLPFKAVQEA+HLE+TPDEFYCKSLL++TGICTVPGSGFGQEPGTYHLRTTFLAPG 
Sbjct: 514 PKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 573

Query: 570 EWIKKWEAFHKEFYDNYRD 588
           EWIKKWE FHKEF+D YRD
Sbjct: 574 EWIKKWETFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/499 (76%), Positives = 437/499 (87%), Gaps = 1/499 (0%)

Query: 90  HHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQ 149
           HH+LK +   +F PAEQLTL D+NENVLKAKYAVRG+IPMRAEELK QLE +P +LPF++
Sbjct: 95  HHTLKTSNN-EFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNK 153

Query: 150 IVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSE 209
           I+NANIGNPQQL+QKPL++YRQVLS+LQYP++L +NEQ L+D+K++K DAI RAK L+ E
Sbjct: 154 IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEE 213

Query: 210 IGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGP 269
           IGGSVGAYS+SQGV GIR++VA FIT+RD GE +YPEDIFLT        YLLSI C+GP
Sbjct: 214 IGGSVGAYSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGP 273

Query: 270 KTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVL 329
           +TGVLIPIPQYPLYTATLALNNS ALPYYLDE SGWSTNP+EIE VV++A+E  I  +VL
Sbjct: 274 ETGVLIPIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVL 333

Query: 330 VVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQK 389
           VVINPGNPTGAVL+ ESI  IFE+AAKYG VVIADEVYQENI  G KF+SMKK+LR LQ+
Sbjct: 334 VVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQR 393

Query: 390 SHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQ 449
            HPGKFDNVQLASLHSTSKGVSGECGQRGGYMEL GF+HE+R+VILKLASISLCPVVTGQ
Sbjct: 394 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453

Query: 450 ALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLF 509
           ALVDLMV PP +G+ S+E DQAER  I  +L  RA  LY+TF  LEGIECQKPQGAMYLF
Sbjct: 454 ALVDLMVRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLF 513

Query: 510 PKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGT 569
           PK+DLPF+AVQEA+HLE+TPDEFYCK LL++TGICTVPGSGFGQEPGTYHLRTTFLAPG 
Sbjct: 514 PKIDLPFRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 573

Query: 570 EWIKKWEAFHKEFYDNYRD 588
           EWIKKWE FHKEF+D+YRD
Sbjct: 574 EWIKKWETFHKEFFDHYRD 592

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/516 (75%), Positives = 439/516 (85%), Gaps = 3/516 (0%)

Query: 76  FFDAKRALMTRSIS---HHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAE 132
           + + KRA  T S +   HH       +DF PAE LT+ DLNENVLKAKYAVRGSIPMRAE
Sbjct: 44  YMNIKRARSTSSTAAGLHHIYHKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAE 103

Query: 133 ELKVQLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDA 192
           EL+ QL+ +PS+LPF +IVNANIGNPQQL QKPLSFYRQVLSILQYP++L++ E+ LI  
Sbjct: 104 ELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISK 163

Query: 193 KVYKRDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTV 252
            V+KRDAI+RAK +L ++GGSVGAYS+SQGVYGIRKTVA+FITERD GEPAYPEDIFLT 
Sbjct: 164 GVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTA 223

Query: 253 WCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEI 312
                  YLLSILC+G +TGVLIPIPQYPLYTATLALNNSH LPYYLDE+SGWSTN  EI
Sbjct: 224 GASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEI 283

Query: 313 EEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIA 372
           E VV +++E  I PSVLVVINPGNPTG+VL+ E+IE IF++AAKYGIVVIADEVYQENI 
Sbjct: 284 EGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIF 343

Query: 373 DGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRK 432
            G +F+SMKKVLR+LQK HPG +DNVQL SLHSTSKGVSGECGQRGGYMEL GFTHE+R+
Sbjct: 344 AGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQ 403

Query: 433 VILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFV 492
           V+LKLASISLCPVVTGQALVDLMV PPK GD SYEQD+ ER  I  EL  RA  L++TF 
Sbjct: 404 VVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFN 463

Query: 493 GLEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFG 552
            LEGIECQKP+GAMYLFP++ LP+KA+Q AQHLE TPDEFYC+ LL+ATGICTVPGSGFG
Sbjct: 464 SLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFG 523

Query: 553 QEPGTYHLRTTFLAPGTEWIKKWEAFHKEFYDNYRD 588
           QEPGTYHLRTTFLAPGTEWIKKWE FHK+FYD YRD
Sbjct: 524 QEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYRD 559

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/499 (76%), Positives = 435/499 (87%), Gaps = 1/499 (0%)

Query: 90  HHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQ 149
           HH+LK A   +F PAEQLTL D+NENVLKA+YAVRG+IPMRAEELK QLE +P +LPF++
Sbjct: 95  HHTLKTANN-EFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNK 153

Query: 150 IVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSE 209
           I+NANIGNPQQL+QKPL++YRQVLS+LQYP++L  NEQ L+ +K++K DAI RAK L+ +
Sbjct: 154 IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKD 213

Query: 210 IGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGP 269
           IGGSVGAYS+SQGV GIRK+VA+FIT+RDGGE AYPEDIFLT        YLLSI C+GP
Sbjct: 214 IGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGP 273

Query: 270 KTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVL 329
           +TGVLIPIPQYPLYTATLALNNS  LPYYLDE SGWSTNP+EIE VV++A++  I P+VL
Sbjct: 274 ETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVL 333

Query: 330 VVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQK 389
           VVINPGNPTGAVL+ ESI  IFE+AAKYG VVIADEVYQENI  G +F SMKKVLR LQ+
Sbjct: 334 VVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQR 393

Query: 390 SHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQ 449
            HPGKFDNVQLASLHSTSKGVSGECGQRGGYMEL GF+HE+R+VILKLASISLCPVVTGQ
Sbjct: 394 DHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453

Query: 450 ALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLF 509
           ALVDLMV PP +G+ S+E DQ+ER  I  +L+ RA  LYETF  LEGIECQKPQGAMYLF
Sbjct: 454 ALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLF 513

Query: 510 PKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGT 569
           PK+D+PFKA+QEA HLE+TPDEFYCK LL++TGICTVPGSGFGQEPGTYHLRTTFLAPG 
Sbjct: 514 PKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGV 573

Query: 570 EWIKKWEAFHKEFYDNYRD 588
           EW+KKWE FHKEF+D YRD
Sbjct: 574 EWMKKWEIFHKEFFDQYRD 592

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/490 (77%), Positives = 424/490 (86%), Gaps = 2/490 (0%)

Query: 101 FAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQ 160
           F PA Q+ +ADLNENVLKAKYAVRGSIPMRAE+L+ QL+ +P +LPF +I+NANIGNPQQ
Sbjct: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161

Query: 161 LKQKPLSFYRQVLSILQYPDILKENEQNLIDA-KVYKRDAIDRAKLLLSEIGGSVGAYSA 219
           L QKPLSFYRQVLS+LQ+P++L   ++N   A  +YK DA+ RA+ LL +IGGSVGAYS 
Sbjct: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221

Query: 220 SQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQ 279
           SQGV GIRKTVA+FIT RD  EPAYPEDIFLT        YLLSI C+G KTGVLIPIPQ
Sbjct: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281

Query: 280 YPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTG 339
           YPLYTATLALNNSH LPYYLDEKSGWSTN KEI+ VV DA++R I PSVLVVINPGNPTG
Sbjct: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341

Query: 340 AVLTEESIEHIFEIAAKYGIVVIADEVYQENIAD-GVKFYSMKKVLRKLQKSHPGKFDNV 398
           AVL+E++I  IFEIAAKYGIVVIADEVYQENI D  VKF+SMKKVLRKLQ+ HPGKFD V
Sbjct: 342 AVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401

Query: 399 QLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSP 458
           QLASLHSTSKGVSGECGQRGG+MEL GF+HE+R+VILKLASISLCPVVTGQALVDLMV P
Sbjct: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461

Query: 459 PKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKA 518
           P++G+ SYE DQAER HI SEL  RA++L+ETF  LEGI+CQKPQGAMYLFP+L+LPFKA
Sbjct: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521

Query: 519 VQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAF 578
           VQ+AQH+EMT DEFYCK LL+ TGICTVPGSGFGQ PGTYHLRTTFLAPGTEWI  WE F
Sbjct: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581

Query: 579 HKEFYDNYRD 588
           HKEFY+ YRD
Sbjct: 582 HKEFYNKYRD 591

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/486 (75%), Positives = 421/486 (86%)

Query: 103 PAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLK 162
           PAE+L L+++NENVLKAKYAVRG+IPM A EL  +L+ +P +LPF  IV+ANIGNPQ LK
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 163 QKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQG 222
           QKPL+FYRQVLS+LQYP +L+ENEQ LID+K+Y++DAI RA+ LL++IG SVGAYS SQG
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168

Query: 223 VYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPL 282
           + GIR+TVA FITERDGGE AY EDIFLT        YLLSILC+G +TGVLIPIPQYPL
Sbjct: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228

Query: 283 YTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVL 342
           YTA+LALNNSH LPYYLDEKSGWSTNP EIE+VV +A+E+ I PSVLVVINPGNPTGAVL
Sbjct: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288

Query: 343 TEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLAS 402
           +EE I  IF IAAKYGIVVIADEVYQEN+ DG +F+SMKK+LRKLQKS+PG FDNVQLAS
Sbjct: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348

Query: 403 LHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKG 462
           LHSTSKGVSGECGQRGGYME+ GF +++R+VILKLASISLCPVVTGQALVDLMVSPPK G
Sbjct: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408

Query: 463 DASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEA 522
           D SYE DQ ER+ I   L+ RA +L+ TF  LEGIECQKP+GAMYLFP+L LPFKA+Q A
Sbjct: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468

Query: 523 QHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEF 582
           +H  MTPD FYCK LL+ATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWI++WE FHK F
Sbjct: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528

Query: 583 YDNYRD 588
           Y+ YRD
Sbjct: 529 YEEYRD 534

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/488 (74%), Positives = 421/488 (86%), Gaps = 1/488 (0%)

Query: 101 FAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQ 160
           F PA++L+L DLNENVL+AKYAVRG IP +AEELK QL  +P +LPF +I+NANIGNPQQ
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 161 LKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSAS 220
           L QKPL+FYRQVLS+LQ PD+L+E  +  + +++YK DAIDRA  LLS IGGSVGAYS S
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQL-SQIYKPDAIDRAARLLSNIGGSVGAYSHS 163

Query: 221 QGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQY 280
           QGVYG RKTVA+FIT+RDGGE AY EDIFLT        Y+LSILC+GP+TGVLIPIPQY
Sbjct: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223

Query: 281 PLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGA 340
           PLYTA+LALNNSHALPYYLDE+S WSTNP+EIE+VV +++ + + P  LVVINPGNPTGA
Sbjct: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283

Query: 341 VLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQL 400
           +L+ ESIE IFE+AAKYGIVVIADEVYQEN+ +G +F+SM+KVL+ LQ+ H GKFDN+QL
Sbjct: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343

Query: 401 ASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPK 460
           ASLHSTSKGVSGECGQRGGYMEL+GF+H+VR+V LKLASISLCPVVTGQALVDLMV PPK
Sbjct: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403

Query: 461 KGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQ 520
            GDASYEQDQ ER  I   L  RAS LYETF  LEGIECQKPQGAMYLFP+LDL +KAVQ
Sbjct: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463

Query: 521 EAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHK 580
           +A+HL ++PDEFYC+ LL+ATGICTVPGSGFGQ PGTYHLRTTFLAPGT+WIK WE FHK
Sbjct: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523

Query: 581 EFYDNYRD 588
           +FY+ YRD
Sbjct: 524 KFYNEYRD 531

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/486 (73%), Positives = 420/486 (86%), Gaps = 2/486 (0%)

Query: 103 PAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLK 162
           PA +L+L D+NENVLKAKYAVRG IPMRAEEL+ QL+ +PS+LPFS+I++ANIGNPQQL 
Sbjct: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104

Query: 163 QKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQG 222
           QKPL+FYR+VLS+LQ+P++L+E ++ L    +YK D+I RAK LLSE+GGSVGAYS SQG
Sbjct: 105 QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162

Query: 223 VYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPL 282
           V GIR+TVA+FIT+RD GE +YPEDI+LT        Y+LSILC+GP TGVLIPIPQYPL
Sbjct: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222

Query: 283 YTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVL 342
           YTA+LALNNS  LPYYL E+  WST+P+EIE+VV DA+++ I P+ LVVINPGNPTGA+L
Sbjct: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282

Query: 343 TEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLAS 402
           +E+SI+ IFE+AAKYGIVVIADEVYQEN+  G KFYSMKKVLR LQK++ G++DN+QLAS
Sbjct: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342

Query: 403 LHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKG 462
           LHSTSKGVSGECGQRGGYMEL+GF H++R+V LKLASISLCPVVTGQALVDLMVSPP+ G
Sbjct: 343 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402

Query: 463 DASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEA 522
           D SYEQDQ ER  I   L  RAS+L+ETF  LEGIEC+KPQGAMYL+PKLDLP+K +QEA
Sbjct: 403 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462

Query: 523 QHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEF 582
           QHLEM PDEFYCK+LL+ TGICTVPGSGFGQ PGTYHLRTTFL PGTEW++ WE FHK F
Sbjct: 463 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522

Query: 583 YDNYRD 588
           +D YRD
Sbjct: 523 FDKYRD 528

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/509 (71%), Positives = 426/509 (83%), Gaps = 11/509 (2%)

Query: 83  LMTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNP 142
            +   I HHS        F PAEQ TL D+NE VL AKYAVRG+IPMRAEELK QL  NP
Sbjct: 74  FLNTEIHHHS---HNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENP 130

Query: 143 STLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDI---LKENEQNLIDAKVYKRDA 199
            +LPF+ I+NANIGNPQQLKQKPLSFYRQVLS+LQYP++   L+ N Q +I     K+DA
Sbjct: 131 HSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-----KQDA 185

Query: 200 IDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCC 259
           IDRAK LL +IGGSVGAYS+SQGV GIRKTVA+FIT RD G  AYPEDIFLT        
Sbjct: 186 IDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVD 245

Query: 260 YLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDA 319
           YLLSI C+G +TGVLIPIPQYPLYTATLAL NSHALPYYL+E++GWST+P+E+E ++ D+
Sbjct: 246 YLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDS 305

Query: 320 MERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYS 379
           +E  I PSVLVVINPGNPTGAVL+EE+IE IF +AAKYGI+VIADEVYQEN+ + VKF+S
Sbjct: 306 IENNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHS 365

Query: 380 MKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLAS 439
           MKKVLR+LQ   PG +DNVQLASLHSTSKGVSGECGQRGGYMEL+GFTH++R+V+LKLAS
Sbjct: 366 MKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLAS 425

Query: 440 ISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIEC 499
           ISLCPVVTGQALVDLMV PP+KG+ SYEQDQ ERR+I  EL  RA+ L++ FV L+GI C
Sbjct: 426 ISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISC 485

Query: 500 QKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYH 559
           QKPQGAMYLFPKL+LP+KA+QEA H +M+PDEFYCKSLL+ TGICTVPGSGFGQEPGTYH
Sbjct: 486 QKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYH 545

Query: 560 LRTTFLAPGTEWIKKWEAFHKEFYDNYRD 588
           LRTTFLAPGT+WI+ W  FH+EFY+ +++
Sbjct: 546 LRTTFLAPGTKWIEDWVDFHQEFYNKFKN 574

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/487 (74%), Positives = 415/487 (85%)

Query: 100 DFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQ 159
           +F PA QLT+ DLNENVLKAKYAVRG IP RAEELK QL   P++LPF +I+NANIGNPQ
Sbjct: 51  NFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQ 110

Query: 160 QLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSA 219
           QL+Q+PLSFYRQVLS+LQYP +L   E     + VYK+DAI RAK +L +IGGSVGAYS 
Sbjct: 111 QLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSE 170

Query: 220 SQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQ 279
           SQGVYGIR+TVANFITERDGGEPAYPEDIFLT        YLLSILC+G KTGVLIPIPQ
Sbjct: 171 SQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQ 230

Query: 280 YPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTG 339
           YPLYTATLALNNSHALPY+LDE +GWS NP EIE V++ A++  I P VLVVINPGNPTG
Sbjct: 231 YPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTG 290

Query: 340 AVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQ 399
           AVL++E+I  I EIAAKYGIVVIADEVYQENI DG+KF+S+K VLR+LQ+  PGKFDNVQ
Sbjct: 291 AVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQ 350

Query: 400 LASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPP 459
           LASLHSTSKGVSGECGQRGGYME+IGFTHEVR+VILKLASISLCPVVTGQALVDLMVSPP
Sbjct: 351 LASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPP 410

Query: 460 KKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAV 519
           K+G+ S+  DQA+R+ I S+LS RA  L++TF  L+GIECQKP GAMYLFPKL+LP++A+
Sbjct: 411 KRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAI 470

Query: 520 QEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFH 579
           QEAQ LE++PDEFYCK LL+ TGICTVPGSGFGQ  GTYHLRTTFLAPG EWI  W+ FH
Sbjct: 471 QEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFH 530

Query: 580 KEFYDNY 586
            EF + Y
Sbjct: 531 IEFMEKY 537

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/526 (65%), Positives = 422/526 (80%), Gaps = 14/526 (2%)

Query: 63  IIKATTTAIPEYQFFDAKRALMTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYA 122
           ++++   +I   +    +R  ++ ++  H   V       PA++L + DLN+NVLKAKYA
Sbjct: 1   MLRSGNCSISLVRRVGVRRLTLSTTLYEHKHNVY------PAQKLRMDDLNKNVLKAKYA 54

Query: 123 VRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDIL 182
           VRGSIP+RAEELK+ LE     LPF  ++NANIGNPQQLKQKPL+FYRQVLSILQYP++L
Sbjct: 55  VRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQQLKQKPLTFYRQVLSILQYPELL 113

Query: 183 KENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEP 242
           +        + ++K+DAI+RA+ LL EIG SVG+YS+SQG+  IRKTVANFIT+RD GE 
Sbjct: 114 ESG------SNIFKKDAIERARKLLKEIG-SVGSYSSSQGIPAIRKTVANFITKRDDGEI 166

Query: 243 AYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEK 302
           + P DIFLT        YLLSILC+  K+GVLIPIPQYPLYTATLALNN+HALPYYLDE 
Sbjct: 167 STPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPLYTATLALNNAHALPYYLDES 226

Query: 303 SGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVI 362
            GWST+  EIEEV+ D++++ I P+ LV+INPGNPTG++L+ ES+E I E+AA +GIV+I
Sbjct: 227 KGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVII 286

Query: 363 ADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYME 422
           ADEVYQEN+ +  KF+SMKKVLR LQK+ PG++D VQLASLHSTSKGVSGECGQRGGYME
Sbjct: 287 ADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYME 346

Query: 423 LIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSI 482
           L GF  E+++VILKL SISLCPVVTGQALVDLMVSPP+KGD SYEQDQ ER  I ++LS 
Sbjct: 347 LTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGDESYEQDQLERSTILNDLSN 406

Query: 483 RASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATG 542
           RA  L+E F  +EG+ CQKP+GAMYLFPK+DLPFK +Q++Q L++TPDEFYCK+LL+ATG
Sbjct: 407 RAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQELDITPDEFYCKALLEATG 466

Query: 543 ICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEFYDNYRD 588
           ICTVPGSGFGQ+PGTYHLRTTFLAPGTEWI +W  FH EFYD YRD
Sbjct: 467 ICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEFYDKYRD 512

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/489 (68%), Positives = 403/489 (82%), Gaps = 1/489 (0%)

Query: 100 DFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQ 159
           DF PA +L+L D+NENV+ AK+A+RGSI ++AE+L+VQL  NP  LPF +I  ANIGNPQ
Sbjct: 10  DFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQ 69

Query: 160 QLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSA 219
           +L QKPL+F RQV+SILQYP++L  N   L   K++  D+ DRA+ LL +IGGSVGAYSA
Sbjct: 70  ELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSA 128

Query: 220 SQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQ 279
           SQGVYGIRKT A +IT+RDGGEP+YPEDIFLT        YLLS+LC+GP+TGVLIPIPQ
Sbjct: 129 SQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQ 188

Query: 280 YPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTG 339
           YPLYTATLALN S  +PYYLDE+S WSTN  EIE++V D++++ I PSV+VVINPGNPTG
Sbjct: 189 YPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTG 248

Query: 340 AVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQ 399
           AVL+E +I  IF+IAAKYGIVV+ADEVYQENI DGV+F+S KKVLR LQK +PGKFDN+Q
Sbjct: 249 AVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQ 308

Query: 400 LASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPP 459
           LAS+HSTSKGV GECGQRGGYMEL+GFT EVR+++LKLA +++C VVTGQA+VDLM+ PP
Sbjct: 309 LASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPP 368

Query: 460 KKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAV 519
           KKGDASYE D+ ER+ I   +  RA +LY  F  L+GIECQKPQGAMYL+P L L  KA+
Sbjct: 369 KKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAI 428

Query: 520 QEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFH 579
            +A+ L +TPDEFYC  LLDATGICTVPGSGFGQ+ GTYHLRTTFLAPG EWI KWE FH
Sbjct: 429 AKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFH 488

Query: 580 KEFYDNYRD 588
           K FY+ Y+D
Sbjct: 489 KHFYEKYQD 497

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/505 (65%), Positives = 403/505 (79%)

Query: 84  MTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPS 143
           MT      S+ +AK  DF PA ++T  DLN +V KA+YAVRGSIP RA+ELK +L+ NP 
Sbjct: 3   MTHQQDLKSVFIAKDLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPG 62

Query: 144 TLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRA 203
            LPF  I+NANIGNPQQL QKPL+F RQVLSIL+YP+IL+ + + L    ++ +DA+ RA
Sbjct: 63  LLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRA 122

Query: 204 KLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLS 263
           + LL +IGGSVGAYS SQGV GIR+TVA+FIT RDGGEPA PEDI+LT         LLS
Sbjct: 123 ECLLKDIGGSVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLS 182

Query: 264 ILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERA 323
           +LC+  +TG+LIPIPQYPLYTA+ +L N+  LPYYLDE+  WST   EIE+VVQDA+E+ 
Sbjct: 183 LLCKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKG 242

Query: 324 INPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKV 383
           I PSVL+VINPGNPTGAVLTEE+I  I  IAAKYGI VI+DEVYQEN+ +  KF+SMKKV
Sbjct: 243 IRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKV 302

Query: 384 LRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLC 443
           LRKLQ  +PGKFDNVQLASLHS SKG  GECGQRGGYME++GF+ ++R  + KL SIS+C
Sbjct: 303 LRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISIC 362

Query: 444 PVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQ 503
            VVTGQA+VDLMV+PP+ GD SYEQD+ ER  I +E+  RA+ LYETF GLEGIECQ PQ
Sbjct: 363 SVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQ 422

Query: 504 GAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTT 563
           GAMYLFP+L LP KA +E++ L + PDEFYC SLL++TGICTVPGSGFGQ+PGTYH+RTT
Sbjct: 423 GAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTT 482

Query: 564 FLAPGTEWIKKWEAFHKEFYDNYRD 588
           FLAPGT+WI+ W+ FH+ F++ YRD
Sbjct: 483 FLAPGTQWIQNWKNFHQSFFNEYRD 507

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/512 (67%), Positives = 414/512 (80%), Gaps = 7/512 (1%)

Query: 77  FDAKRALMTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKV 136
              KR L   +IS       K K+F PA++LT+ DLNENVLKAKYAVRG IP RAE LK 
Sbjct: 18  LSGKRLLSLTTIS------LKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQ 71

Query: 137 QLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYK 196
           QL +NPS+LPF +++NANIGNPQQL QKPL+FYRQVLS+LQYP +L E         +YK
Sbjct: 72  QLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKT-LYK 130

Query: 197 RDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFR 256
           +DAI+RAK +L++IG SVG+YS+SQGV+G+RKTVA +I+ RDGGE AY EDIFLT     
Sbjct: 131 QDAIERAKRILNDIGSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASS 190

Query: 257 CCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVV 316
              YLL+ILC+G ++GVLIPIPQYPLYTATLALNN++ALPYYL+E SGWSTN +EIE VV
Sbjct: 191 AVSYLLNILCKGKESGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVV 250

Query: 317 QDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVK 376
            +A+   I P VLVVINPGNPTGA+L+ ESIE IF++AA +GIVVIADEVYQENI  G +
Sbjct: 251 HNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNE 310

Query: 377 FYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILK 436
           F+SMKKVLR LQ+  PGK++NVQLASLHSTSKGVSGECGQRGGYMEL GF+ E++  ILK
Sbjct: 311 FHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILK 370

Query: 437 LASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEG 496
           L SISLCPVVTGQALVDLM  PPKKG+ASYEQDQ ER  I SEL  RA+ L++ F  +EG
Sbjct: 371 LCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEG 430

Query: 497 IECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPG 556
           + CQKPQG+MYLFPK+D+P KA+++AQ L++TPDE YC  LL+ATGICTVPGSGFGQ+PG
Sbjct: 431 VSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPG 490

Query: 557 TYHLRTTFLAPGTEWIKKWEAFHKEFYDNYRD 588
           T+HLRTTFLAPGT WI +W  FH+ F + YRD
Sbjct: 491 TFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/492 (66%), Positives = 396/492 (80%), Gaps = 2/492 (0%)

Query: 98  GKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGN 157
           G  F PA +L   DLN+N++ A+YAVRG+IPM+AEEL++QL   P  LPF+ I  ANIGN
Sbjct: 31  GLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGN 90

Query: 158 PQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAY 217
           PQQL QKPL+F RQV+SILQYP +L   EQ L+ +  YKRDA  RA +LL +IGGSVGAY
Sbjct: 91  PQQLDQKPLTFSRQVVSILQYPPLLDYEEQ-LVTSGAYKRDAFKRAAVLLEQIGGSVGAY 149

Query: 218 SASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPI 277
           S +QGVYGIR++VA+FIT RD GE A P+DIFLT    +   YLLSILC+   TG++IPI
Sbjct: 150 SLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPI 209

Query: 278 PQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNP 337
           PQYPLYTA++ + NS  LPYYLDE+SGWST  +EIE+ V D+++R + P V+VVINPGNP
Sbjct: 210 PQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNP 269

Query: 338 TGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHP-GKFD 396
           TGAVL+ ++I  I  IAAKYGIVV+ADEVYQ NI  GVKF+SMKKVLR LQ+ HP G++D
Sbjct: 270 TGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYD 329

Query: 397 NVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMV 456
           NVQLAS+HSTSKGVSGECGQRGGYMEL+GF++EVR+VILKLASIS+C VVTGQALVDLM+
Sbjct: 330 NVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLML 389

Query: 457 SPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPF 516
           +PP++GD SYE D  ER+ I + +  R   LY+TF  LEGIECQ+PQGAMYLFPKL L  
Sbjct: 390 NPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSK 449

Query: 517 KAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWE 576
           KA++EA+ L + PDEFYC  LLD TGICTVPGSGFGQ+ GTYH+RTTFLAPGT+WIK WE
Sbjct: 450 KAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWE 509

Query: 577 AFHKEFYDNYRD 588
            FHK FYD YRD
Sbjct: 510 TFHKAFYDKYRD 521

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/505 (65%), Positives = 398/505 (78%)

Query: 84  MTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPS 143
           MT       +  AK  DF PA ++T  DLN  V KA+YAVRG+IP RA+ELK +L+ NP 
Sbjct: 3   MTHQQDLKGVFTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPE 62

Query: 144 TLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRA 203
            LPF  I+NANIGNPQQL QKPL+F RQVL+IL+YP+IL+     L    ++ RDA++RA
Sbjct: 63  VLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERA 122

Query: 204 KLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLS 263
           + LL++IGGS+GAYS SQGV GIR+TVA+FIT RDGGEPA PEDI+LT         LLS
Sbjct: 123 ERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLS 182

Query: 264 ILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERA 323
           +LC+  +TG+LIPIPQYPLYTA+ +L N+  LPYYLDE+S WSTN  EIE+VVQDA+++ 
Sbjct: 183 LLCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQ 242

Query: 324 INPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKV 383
           I PSVL+VINPGNPTGAVL+EE+I  I  IAAKYGI +I+DEVYQENI + VKF+SMKKV
Sbjct: 243 IRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKV 302

Query: 384 LRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLC 443
           LRKLQ  +PGKFDNVQLASLHS SKG   ECGQRGGYME+IGF+ E+R  + KL SIS+C
Sbjct: 303 LRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISIC 362

Query: 444 PVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQ 503
            VVTGQA+VDLMV PP+ GD SYEQD  ER  I  E+  RA+ LYETF  LEGIECQKPQ
Sbjct: 363 SVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQ 422

Query: 504 GAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTT 563
           GAMYLFP+L LP KA+ E++ L + PDEFYC SLL++TGICTVPGSGFGQ PGTYH+RTT
Sbjct: 423 GAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTT 482

Query: 564 FLAPGTEWIKKWEAFHKEFYDNYRD 588
           FLAPGT+WI+ W+ FH++F+  YR+
Sbjct: 483 FLAPGTKWIQDWKEFHQDFFSKYRN 507

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/516 (64%), Positives = 408/516 (79%), Gaps = 16/516 (3%)

Query: 75  QFFDAKRALMTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEEL 134
           Q+F  ++AL   +I           +F PA+++TL DLN+NVLK++YAVRGSIP RAEEL
Sbjct: 12  QYFPVRKALDDDTI----------HNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEEL 61

Query: 135 KVQLENNPST--LPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQN-LID 191
           + +L NN S+  L F  IV+ANIGNPQQL QKPL+F RQV+SILQYP++L  N++N L+ 
Sbjct: 62  EFELLNNDSSDSLAFENIVHANIGNPQQLDQKPLTFSRQVISILQYPELL--NQRNILVS 119

Query: 192 AKVYKRDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLT 251
             ++K DA++RA+ LL  IGGSVGAYS+SQGVYGIR+TVAN+IT RD GE A P+DIFLT
Sbjct: 120 TGIFKSDAMERAETLLCHIGGSVGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLT 179

Query: 252 VWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKE 311
               +   YLLS+LC+   TGVLIPIPQYPLYTAT+ L ++  LPYYL+E+SGWSTN  E
Sbjct: 180 EGASKAASYLLSLLCKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNE 239

Query: 312 IEEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENI 371
           IE+VV DA+   + PSV+VVINPGNPTG+VL+++ I HI  I AKYGIV+IADEVYQENI
Sbjct: 240 IEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENI 299

Query: 372 ADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVR 431
            DG +F+SMKKVLR LQK +PGK+D VQLASLHSTSKGVSGECGQRGGYMEL+GF  E+R
Sbjct: 300 FDG-EFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIR 358

Query: 432 KVILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETF 491
           + ILKLASISLC V+TGQALVDLMV+PPKKGD SYE D  ER++I   L  RA +LY  F
Sbjct: 359 QAILKLASISLCSVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLF 418

Query: 492 VGLEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGF 551
             L+G+ECQKPQGAMYLFPKL  P   + EA +  M+PDEFYC +LL+ATGICTVPGSGF
Sbjct: 419 CQLKGVECQKPQGAMYLFPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGF 478

Query: 552 GQEPGTYHLRTTFLAPGTEWIKKWEAFHKEFYDNYR 587
           GQ+ GTYHLRTTFLAPG +W +KW+ FH+EF+  Y+
Sbjct: 479 GQKEGTYHLRTTFLAPGNQWTEKWKLFHEEFFSKYQ 514

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/505 (63%), Positives = 400/505 (79%)

Query: 84  MTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPS 143
           MT      S+   K  +F PA ++T  DLN  V KA+YAVRG+IP RA+ELK +L+  P 
Sbjct: 3   MTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPG 62

Query: 144 TLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRA 203
            LPF  I+NANIGNPQQL QKPL+F RQVLSIL+YP+IL+     L    ++++DA+ RA
Sbjct: 63  VLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRA 122

Query: 204 KLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLS 263
           + LL +IGGS+GAYS SQGV GIR++VA FIT+RD GEPA PE+I+LT         LLS
Sbjct: 123 EHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLS 182

Query: 264 ILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERA 323
           +LC+  +TG+LIPIPQYPLYTA+ +L N+  LPYYLDE S WST   EIE+VV+DA+E+ 
Sbjct: 183 LLCKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKG 242

Query: 324 INPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKV 383
           I PSVL+VINPGNPTGAVL+E++I  I  IAAKYGI +I+DEVYQEN+ +GVKF+SMKKV
Sbjct: 243 IKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKV 302

Query: 384 LRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLC 443
           LRKLQ+ +PGKFDNVQLASLHS SKG  GECGQRGGYME++GF+ ++R  + KL SIS+C
Sbjct: 303 LRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISIC 362

Query: 444 PVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQ 503
            VVTGQA+VDLMV PP+ GD SY+QD +ER  I  E+  RA+ L+ETF  LEGIECQKPQ
Sbjct: 363 SVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQ 422

Query: 504 GAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTT 563
           GAMYLFP+L LP KA++E++ L + PDEFYC SLL++TGICTVPGSGFGQ+PGTYH+RTT
Sbjct: 423 GAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTT 482

Query: 564 FLAPGTEWIKKWEAFHKEFYDNYRD 588
           FLAPGT+WI+ W+ FH++F++ YRD
Sbjct: 483 FLAPGTQWIQDWKHFHQDFFNKYRD 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/505 (63%), Positives = 396/505 (78%)

Query: 84  MTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPS 143
           MT      S+   K  DF PA +LT  DLN +V KA+YAVRG+IP RAEELK +L+ + +
Sbjct: 3   MTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSN 62

Query: 144 TLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRA 203
           +LPF+ I+NANIGNPQQL QKPL+F RQVLSIL+YP+IL+ +   L    ++ +DA+ RA
Sbjct: 63  SLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRA 122

Query: 204 KLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLS 263
           + LL +IGGSVGAYS SQGV GIR+TVA+FITERDGGEPA PEDI+LT         LLS
Sbjct: 123 QRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLS 182

Query: 264 ILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERA 323
           +LC+  +TG+L+PIPQYPLYTA+ +L N+  LPYYLDE++ WST   EIE VV DA+++ 
Sbjct: 183 LLCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKG 242

Query: 324 INPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKV 383
           I PSVLVVINPGNPTGAVLTE +I  I  IAAKYGI +I+DEVYQENI   VKF+SMKK+
Sbjct: 243 IRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKI 302

Query: 384 LRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLC 443
           LRKLQ  HPGKFDNVQLASLHS SKG  GECGQRGGYME++GF+ ++R  + KL SIS+C
Sbjct: 303 LRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISIC 362

Query: 444 PVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQ 503
            V TGQA++DLMV PP+ GD SY+QD+ ER  I +E+  RA+ LYETF  LEGI+CQKPQ
Sbjct: 363 SVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQ 422

Query: 504 GAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTT 563
           GAMYLFPKL LP KA++E++ L + PD  YC SLL++TGICTVPGSGFGQ+ GTYH+RTT
Sbjct: 423 GAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTT 482

Query: 564 FLAPGTEWIKKWEAFHKEFYDNYRD 588
           FL PGT+WI+ W  FH++F++ YRD
Sbjct: 483 FLPPGTQWIQDWRQFHQDFFNKYRD 507

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/515 (63%), Positives = 400/515 (77%), Gaps = 12/515 (2%)

Query: 84  MTRSISHHSL-------KVAKGKDF---APAEQLTLADLNENVLKAKYAVRGSIPMRAEE 133
           +TR++ H  L       K A   D    A   + TL D+N+ VL AKYAVRG IP+RAEE
Sbjct: 7   LTRTMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEE 66

Query: 134 LKVQLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAK 193
           L+ +L   P +LPF++I+NANIGNPQQL QKPL+FYRQVLS+LQ P +++      +  K
Sbjct: 67  LRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGELH-K 125

Query: 194 VYKRDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVW 253
           ++K DA++RAK +L ++GGSVGAYSASQGV G R++VA FI ERDG EPA   DIFLT  
Sbjct: 126 LFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-EPASANDIFLTAG 184

Query: 254 CFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIE 313
                  +LS+ C G + G LIPIPQYPLYTATLALN++HALPYYLDE SGWS + +++E
Sbjct: 185 ASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVE 244

Query: 314 EVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIAD 373
           +VV+DA+ + + P+ LVVINPGNPTGA+L+ E+IE I  +AAKY +VVIADEVYQEN  D
Sbjct: 245 QVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFD 304

Query: 374 GVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKV 433
              F SMKKVLR LQK+ PGK+DNVQLASLHSTSKGVSGECGQRGGYMEL+GF+ EV++V
Sbjct: 305 DADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQV 364

Query: 434 ILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVG 493
            LKLASISLCPVVTGQALVDLMV PPKKGDASYE D+ ER  I + L  +++ LYETF  
Sbjct: 365 FLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQS 424

Query: 494 LEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQ 553
           LEG+ CQKPQGAMYLFPKLDL  KA+++A+ L M PDE+YCK LL+ATGICTVPGSGF Q
Sbjct: 425 LEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQ 484

Query: 554 EPGTYHLRTTFLAPGTEWIKKWEAFHKEFYDNYRD 588
            PGTYHLRTTFLAPGTEW+  W+ FH++F D +RD
Sbjct: 485 VPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/504 (63%), Positives = 400/504 (79%), Gaps = 5/504 (0%)

Query: 88  ISHHSLKVAKGKDFAP---AEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPST 144
           + H S +    KD++      + TL D+NE VL AKYAVRG IP+RAEELK +L   P +
Sbjct: 17  LRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGS 76

Query: 145 LPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAK 204
           LPF +I+NANIGNPQQL QKPL+FYRQVL++LQ PD++ +     +  K +K DA++RAK
Sbjct: 77  LPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELH-KFFKPDAVERAK 135

Query: 205 LLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSI 264
            +L ++GGSVGAYS SQGV G R++VA FI ERDG EPA  +DIFLT        Y+LS+
Sbjct: 136 KMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSL 194

Query: 265 LCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAI 324
            C GP+ G LIPIPQYPLYTA+LALNNSHALPYYLDE+SGWS + ++IE+VVQD++++ I
Sbjct: 195 FCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGI 254

Query: 325 NPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVL 384
            P+ LVVINPGNPTGA+L  ++IE++ ++AAKY +V+IADEVYQEN  +  +F SMKKVL
Sbjct: 255 RPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVL 314

Query: 385 RKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCP 444
           R LQK+ PGK+DNVQLASLHSTSKGVSGECGQRGGYMEL+GF+ EV++V LKLASISLCP
Sbjct: 315 RVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCP 374

Query: 445 VVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQG 504
           VVTGQAL+DLMV PPKKGDASYEQD+ ER  I   L  R+  LY+ F  +EG+ CQ+PQG
Sbjct: 375 VVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQG 434

Query: 505 AMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTF 564
           AMYLFPKL+L  KA+ +A+   + PDE+YCK LL+ATGICTVPGSGFGQ PGT+HLRTTF
Sbjct: 435 AMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTF 494

Query: 565 LAPGTEWIKKWEAFHKEFYDNYRD 588
           LAPGTEWI  W+ FH++F +++RD
Sbjct: 495 LAPGTEWIDSWKKFHEKFTEDHRD 518

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/484 (65%), Positives = 395/484 (81%), Gaps = 2/484 (0%)

Query: 104 AEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLKQ 163
           AE+L   DLN NV+KAKYAVRG+IP  A++LK+QL  +P TLPF  ++N+NIGNPQQL Q
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 164 KPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQGV 223
           KPLSF RQVLSIL+YP +L ++E+ L+D+  Y  D+I+RAK LL++IG S+GAYS SQGV
Sbjct: 141 KPLSFGRQVLSILEYPALL-DHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGV 198

Query: 224 YGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLY 283
           +GIR+TVA+FIT RD GE AYP+DIFLT         +LSILC+G +TGVLIPIPQYPLY
Sbjct: 199 HGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPLY 258

Query: 284 TATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVLT 343
           TATL LN++ ALPYYLDE +GWST+  EI +V QD++E  I P+ LVVINPGNPTG+VLT
Sbjct: 259 TATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLT 318

Query: 344 EESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLASL 403
            E+I+++F++AAKYG+VVIADEVYQ+NI  G +F+SMKK+LR LQK  P K+DN+QLASL
Sbjct: 319 VEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASL 378

Query: 404 HSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKGD 463
           HS SKG+ GECG RGGY E IGFT EV++VI KL+SISLC  V GQALVDLM  PPKKG+
Sbjct: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438

Query: 464 ASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEAQ 523
            SYE DQ ER+ I++    R+++LYE F  LEG+ CQKPQGAMY+FP + LPF A++ AQ
Sbjct: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498

Query: 524 HLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEFY 583
           +L++TPDEFYC+ LL ATGICTVPGSGFGQ+PGTYH+RTTFLAPG EW+K+WE FH EF+
Sbjct: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558

Query: 584 DNYR 587
           + YR
Sbjct: 559 EKYR 562

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/489 (64%), Positives = 391/489 (79%), Gaps = 2/489 (0%)

Query: 100 DFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQ 159
           DF PA +L++ DLN NV+KA++AVRG+IPM+A+EL+ QL  NP +LPF++I  ANIGNPQ
Sbjct: 12  DFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQ 71

Query: 160 QLKQKPLSFYRQVLSILQYPDIL-KENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYS 218
           +L QKPL+F RQV+SILQYP++L + NE       +Y  D+ DRA+ LL+EIGGSVGAYS
Sbjct: 72  ELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYS 131

Query: 219 ASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIP 278
           ASQGVYGIRKT+AN+IT+RD GE A P DIF+T        YLLSIL  GP+TGVL+PIP
Sbjct: 132 ASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIP 191

Query: 279 QYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQ-DAMERAINPSVLVVINPGNP 337
           QYPLYTA LAL+N+  LPYYL+E+SGWS +  EIE+ ++ +AM + I P V+V+INPGNP
Sbjct: 192 QYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNP 251

Query: 338 TGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDN 397
           TG++L+E+S+  IF IAAKYGIV+IADEVYQEN+ +G KF+S KKVLR LQK  P +++N
Sbjct: 252 TGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNN 311

Query: 398 VQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVS 457
           VQLASLHSTSKG+ GECGQRGGYME+IGF ++VR +ILKLA I +CPVVTGQA++DLM+ 
Sbjct: 312 VQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMIL 371

Query: 458 PPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFK 517
           PPK+GD SY+ D  ER+ I +++  RA +LY+ F  +EGI+CQKPQGAMYLFP+L L  K
Sbjct: 372 PPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTK 431

Query: 518 AVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEA 577
            + EA+  EM PDEFYC  LL+ TGICTVPGSGFGQ+P TYHLRTTFLAPG +WI KWE 
Sbjct: 432 VIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEK 491

Query: 578 FHKEFYDNY 586
           FHK F   Y
Sbjct: 492 FHKAFLKRY 500

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/489 (64%), Positives = 384/489 (78%), Gaps = 3/489 (0%)

Query: 101 FAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQ 160
           F PAE+L++ DLN++ + A YAVRGSIPMRAE+L  Q+ N+P +LPF +I+ ANIGNPQQ
Sbjct: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62

Query: 161 LKQKPLSFYRQVLSILQYPDILKENE--QNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYS 218
           + QKPL+F RQVLSIL+YP+IL + E  + L+   VY+RD I+RA+ +L  IGGSVGAYS
Sbjct: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122

Query: 219 ASQGVYGIRKTVANFITERDG-GEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPI 277
           ASQGV G R+TVA+FI +RDG  + A P DIFLT        YLLSILC GP+ GVLIPI
Sbjct: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182

Query: 278 PQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNP 337
           PQYPLYTATL L+NS A+PYYL E + WSTN KEIE  ++++M   + P  +V+INPGNP
Sbjct: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242

Query: 338 TGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDN 397
           TGA+L+E  +  I  I+AKYGI +IADEVYQENI  G +F+SM+KVL  LQ   PG +DN
Sbjct: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302

Query: 398 VQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVS 457
           VQLASLHSTSKG  GECGQRGGYMELIGF  EV  ++LKLASIS+C VVTGQAL+DL+  
Sbjct: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362

Query: 458 PPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFK 517
           PP+ GDASY+ DQ ER  IK +L  RA +LY  F  LEG+ECQ+PQGAMYLFPKL LP K
Sbjct: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422

Query: 518 AVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEA 577
           A+++A  LE+ PDE+YC+ LLDATGICTVPGSGFGQ+PGTYHLRTTFL PGTEWI++W  
Sbjct: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482

Query: 578 FHKEFYDNY 586
           FH++FY+ +
Sbjct: 483 FHQQFYERF 491

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/490 (63%), Positives = 391/490 (79%), Gaps = 4/490 (0%)

Query: 100 DFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQL--ENNPSTLPFSQIVNANIGN 157
           DF PA ++++ADLN+ ++ A+YAVRGSI MRAEEL+ +L  +  P + PF +I+ ANIGN
Sbjct: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82

Query: 158 PQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAY 217
           PQQL QKPL+F RQV+SIL+YP +LK  +  L+   +YK+DA++RA+LL S+IG SVGAY
Sbjct: 83  PQQLDQKPLTFSRQVMSILEYPGLLKFKDV-LLSQGIYKKDALERAELLQSQIGASVGAY 141

Query: 218 SASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPI 277
           S +QGVYGIR+T A FI++RD  E A  +DIFLT    +   YL+  LCQ   TG+LIPI
Sbjct: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201

Query: 278 PQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNP 337
           PQYPLYTA++ ++N+  LPYYLDE+SGWST  +EIE  V +A+E  I PS +VVINPGNP
Sbjct: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261

Query: 338 TGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDN 397
           TGAVL+ + I+ I  +AAKYGIV+IADEVYQ+NI +G +F+SMKK+LR+LQK +PGK+DN
Sbjct: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320

Query: 398 VQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVS 457
           VQLASLHSTSKGVSGECGQRGGYME++GF+ EVR ++LKLASI++C VVTGQALVDLMV 
Sbjct: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380

Query: 458 PPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFK 517
           PP  GD SYE+DQ ER  I S L  RA +LY+TF  LEGIECQKPQGAMYLFP+L LP +
Sbjct: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440

Query: 518 AVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEA 577
           A++EA+ L+M  DEFYC  LL+ TGICTVPGSGFGQ  GTYH+RTTFL+PGTEWI  W+ 
Sbjct: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500

Query: 578 FHKEFYDNYR 587
           FH++F   Y+
Sbjct: 501 FHEKFMKEYQ 510

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/503 (61%), Positives = 388/503 (77%), Gaps = 7/503 (1%)

Query: 86  RSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTL 145
           RSIS  + ++     F P + L L DLN NVL+AKYAVRG IP RA EL+ QL  +P +L
Sbjct: 39  RSISSGTSRIR----FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSL 94

Query: 146 PFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKL 205
           PF +I+ ANIGNPQQL QKPLSF R+VLS+L+ P++L+   + L    +YK DA+ RAK 
Sbjct: 95  PFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVL--NLIYKPDAVRRAKR 152

Query: 206 LLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSIL 265
           ++ ++  S+GAYS SQGV G RKTVA +++ RDG EPA  EDIFLT         ++ +L
Sbjct: 153 MMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELL 211

Query: 266 CQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAIN 325
           C+G ++GVLIPIPQYPLYTAT+ LNN+ ALPYYLDE+SGWS N  ++E ++ +++E+ + 
Sbjct: 212 CKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVK 271

Query: 326 PSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLR 385
           P+ LVVINPGNPTGA+L  ES+E IF IAAKY IVVIADEVYQEN+ +G+KFYSMKKVLR
Sbjct: 272 PACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLR 331

Query: 386 KLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPV 445
            LQ+ +   F NVQL SLHSTSKG+SGECGQRGGYMEL+GF+ ++R+VILK+ASI LC  
Sbjct: 332 SLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSP 391

Query: 446 VTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGA 505
           V GQALVDLM+S PK GD SYE+D +ER  I++ L  R+  L+ETF  LEG+EC+KPQG+
Sbjct: 392 VGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGS 451

Query: 506 MYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFL 565
           MYLFP+L LP KA++ A+ L+M PDEFYC  LL++TGICTVPGSGFGQ P T HLRTTFL
Sbjct: 452 MYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFL 511

Query: 566 APGTEWIKKWEAFHKEFYDNYRD 588
            PGTEWI+ WE FHK FYD YRD
Sbjct: 512 CPGTEWIESWELFHKSFYDKYRD 534

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/508 (63%), Positives = 385/508 (75%), Gaps = 7/508 (1%)

Query: 81  RALMTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLEN 140
           R L TR +S     V  G  F PAE +TLAD+NENV+KAKYAVRG IP RAEEL+ +LE 
Sbjct: 21  RVLRTRRLS----SVKDGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEE 76

Query: 141 NPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAI 200
           +P +LPFS+I+ ANIGNPQQL QKPL+FYRQV+S++Q P +L+   + L  A  +K D +
Sbjct: 77  HPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQA--FKADVV 134

Query: 201 DRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCY 260
            RA+ +L + GGSVGAYSASQGV G R+TVA FI  RDG  PA P++++LT         
Sbjct: 135 VRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSC 193

Query: 261 LLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAM 320
           LLS  C+GP+TGVLIPIPQYPLYTAT+  NN+ ALPYYL+E  GWSTNP E+E V+ D+ 
Sbjct: 194 LLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSK 253

Query: 321 ERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSM 380
           +R I P  LVVINPGNPTG+VL+ + +E I  +AAKYGIVVIADEVYQ+N+    KF+SM
Sbjct: 254 KRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSM 313

Query: 381 KKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASI 440
           +KVL+ LQ   P  + NVQLASLHS SKG+SGECGQRGGYMELIGF  E+RKV +KLASI
Sbjct: 314 RKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASI 373

Query: 441 SLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQ 500
           SLCPVVTGQALVDLMV PP +GD SYEQ   E R I  EL  R+  L++TF  LEGIEC 
Sbjct: 374 SLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECN 433

Query: 501 KPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHL 560
            PQGA+YLFPKL LP KA++ AQ L +  DE YC  LLD TGICTVPG+GFGQ PGTYH+
Sbjct: 434 MPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHV 493

Query: 561 RTTFLAPGTEWIKKWEAFHKEFYDNYRD 588
           RTTFL PGT+WI+ W+ FHK+FYD YRD
Sbjct: 494 RTTFLPPGTKWIESWKDFHKKFYDKYRD 521

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/490 (60%), Positives = 379/490 (77%), Gaps = 2/490 (0%)

Query: 100 DFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQ 159
           DF P  ++TL DLN  ++K +YAVRG IP RAEELK+QLE +P +LPF++I+NANIGNPQ
Sbjct: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67

Query: 160 QLKQKPLSFYRQVLSILQYPDILKENE--QNLIDAKVYKRDAIDRAKLLLSEIGGSVGAY 217
           QL QKPLSF R+VLSILQYPDIL++    Q LI+ +VY++D + RA+ LL EIGGSVGAY
Sbjct: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127

Query: 218 SASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPI 277
           S SQGV GI++TVA++IT+RD GE AYPEDIFLT        ++L + C GP TGVLIPI
Sbjct: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187

Query: 278 PQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNP 337
           PQYPLYTAT+ L  + A+ YYL+E+  WS N  E+E  +Q++++  I P+ +V+INPGNP
Sbjct: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247

Query: 338 TGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDN 397
           TG++LTE+ I +I  I+AKYG+++IADEVYQEN+  G +F+S+KKVLRKLQ+ + G ++ 
Sbjct: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307

Query: 398 VQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVS 457
           VQLASLHSTSKG+ GECGQRGGYMELIG T +VR  ++KL SIS+C VVTGQAL+D++VS
Sbjct: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367

Query: 458 PPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFK 517
           PP+ GD SYE DQ ER +IK++L  R+ +L++ F+ LEG+EC +PQGAMYLFPK   P K
Sbjct: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427

Query: 518 AVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEA 577
            +  AQ L    D  YCK LL+ TGICTVPGSGFGQ+P TYHLRTTFL PG  WI  W  
Sbjct: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487

Query: 578 FHKEFYDNYR 587
           FH EF + YR
Sbjct: 488 FHTEFCERYR 497

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/496 (59%), Positives = 377/496 (76%), Gaps = 8/496 (1%)

Query: 99  KDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNP 158
           K F PA + +L D+NE++LKA+YA+RG+IP RAEEL +QL  N  +LPF++IV ANIGNP
Sbjct: 6   KTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNP 65

Query: 159 QQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYS 218
           QQL Q+PL+F RQV+S++Q+PD+LK  +  L+  K+Y +D+I+RA  LL+ IGGSVGAYS
Sbjct: 66  QQLDQQPLTFQRQVMSLVQFPDLLKSKDI-LLAQKIYSKDSIERATKLLNSIGGSVGAYS 124

Query: 219 ASQGVYGIRKTVANFITERD-GGEPAY------PEDIFLTVWCFRCCCYLLSILCQGPKT 271
           +SQGV  IRK VA FI +RD   +P          ++FLT        ++L +  +    
Sbjct: 125 SSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESC 184

Query: 272 GVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVV 331
           GVL+PIPQYPLYTA + L  S  LPYYL+E + WST+PK+IE++V DA+++ I P+ LVV
Sbjct: 185 GVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVV 244

Query: 332 INPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSH 391
           INPGNPTGA+LT++SI  I +IAA+YGIV+IADEVYQEN+ +  +F+S KKVL +L+K++
Sbjct: 245 INPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNY 304

Query: 392 PGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQAL 451
           P K+DNVQLASLHS SKGV+GECGQRGGYME+ GF+++V+KV+LK+ASIS+C VVTGQ L
Sbjct: 305 PSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQIL 364

Query: 452 VDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPK 511
           VDLMV+PP+ GD SYE DQ ER  I S L ++++ LY+ F  L GI CQKPQGAMYLFP+
Sbjct: 365 VDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPR 424

Query: 512 LDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEW 571
           L L   A+  A  L + PDEFYC  LL+ TGICTVPGSGFGQ PGTYHLRTTFL PG EW
Sbjct: 425 LHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEW 484

Query: 572 IKKWEAFHKEFYDNYR 587
           I  WE FH EF + Y+
Sbjct: 485 INSWEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/500 (56%), Positives = 367/500 (73%), Gaps = 12/500 (2%)

Query: 98  GKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGN 157
            KD  PA + +L D+++++L  +YA+RG+IP RA+EL+ QL  +P+ LPF +I+ ANIGN
Sbjct: 3   AKDCTPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGN 62

Query: 158 PQQLKQKPLSFYRQVLSILQYPDILKENEQN-LIDAKVYKRDAIDRAKLLLSEIGGSVGA 216
           PQQL+Q+PL+F RQVLS+++YP+++  N +N L++ K+Y  DAI RA+ +L+ IGGSVGA
Sbjct: 63  PQQLEQEPLTFQRQVLSLVEYPNLV--NSKNILVENKIYAPDAIKRAETILNSIGGSVGA 120

Query: 217 YSASQGVYGIRKTVANFITERDGGEPAYPE---------DIFLTVWCFRCCCYLLSILCQ 267
           YS+SQG+  IRK VA  I +RD  E    +         +IFLT        Y+L +  +
Sbjct: 121 YSSSQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAK 180

Query: 268 GPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPS 327
               GVL+PIPQYPLYTA + L NS  LPYYL+E   WST+P+EIE +++DA+ R I P+
Sbjct: 181 DENCGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPT 240

Query: 328 VLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKL 387
            LV+INPGNPTGA+L+ ESI  I  IAAKYGIV+IADEVYQ NI    KF+S KK+L  L
Sbjct: 241 TLVIINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSL 300

Query: 388 QKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVT 447
           +  +P K+DNVQLASLHS SKGV+GECGQRGGY EL+GF+ E++K+ILKLASI +C VVT
Sbjct: 301 KLQYPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVT 360

Query: 448 GQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMY 507
           GQ LVDLM  PP+KGD SY+ DQ ER +I+S L ++++ LY+ F  L GI CQKPQGAMY
Sbjct: 361 GQILVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMY 420

Query: 508 LFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAP 567
           LFP+L L    + EA+   + PDEFYC  LL+ TGICTVPGSGFGQ+ GTYH+RTTFL  
Sbjct: 421 LFPRLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPS 480

Query: 568 GTEWIKKWEAFHKEFYDNYR 587
           G EWIK WE FH EF + Y+
Sbjct: 481 GIEWIKLWEKFHLEFMNQYK 500

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 73/159 (45%), Gaps = 25/159 (15%)

Query: 217 YSASQGVYGIRKTVANFITERDGGEPAYPEDIFLT---VWCFRCCCYLLS-----ILCQG 268
           Y A QG + +RK +A   +  D       E++ LT   +       Y L+      +C  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNED--VTLSEENVILTNGAIAANFLTHYTLAGKGDHFICIS 112

Query: 269 PKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSV 328
           P    L  IPQ  ++ A + L        +L +++ +  N  E+E +++       N   
Sbjct: 113 PTYQQLSSIPQ--MFGAEVEL-------LHLRKETNYQPNIVELERMIKP------NTKC 157

Query: 329 LVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           +V+  P NP  +V+  E++  I E+A K+GIVV  DEVY
Sbjct: 158 IVLNTPNNPLSSVIPTETLREIAELADKHGIVVFCDEVY 196

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 73/159 (45%), Gaps = 19/159 (11%)

Query: 242 PAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSH--ALPYYL 299
           P   E++ L V    C   L+   C   K  +LI  P Y +Y+    +N+     +P  +
Sbjct: 84  PLTHENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVV 143

Query: 300 DEKSGWSTNPKEIEEVVQDAMERAINPSVLVVI--NPGNPTGAVLTEESIEHIFEIAAKY 357
           ++ S      K IE +  D       PS+ +V   +PGNPTGA++  E+IE +     + 
Sbjct: 144 EDNSFQMDTEKVIETLQND-------PSIKLVFITSPGNPTGALIKPENIEKLLS-QWQS 195

Query: 358 GIVVIADEVYQE------NIADGVKFYSMKKVLRKLQKS 390
           G VV+ DE Y +      ++A  V  Y    VL+ L KS
Sbjct: 196 GFVVV-DEAYIDFCTTGGSVAPLVNKYPNLAVLQTLSKS 233

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 138/325 (42%), Gaps = 37/325 (11%)

Query: 247 DIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLAL--NNSHALPYYLDEKSG 304
           D+  T+        +L I C     G  I   Q+   ++  A      +  P  LDE   
Sbjct: 134 DVLATIGNTGAWESVLRIFCN---RGDTILAEQFAFSSSISAAEAQGVNVFPIPLDEHG- 189

Query: 305 WSTNPKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIA 363
               P ++E ++ +  E A  P +L  +  G NPTG+ L+ +  E I+ IA K+  ++I 
Sbjct: 190 --IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIIIE 247

Query: 364 D--------EVYQENIADGV--KFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGE 413
           D        E Y+++ A+ V   +   K+ ++ L+KS        ++  L S SK ++  
Sbjct: 248 DEPYYFLQMEKYEKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLDSLSKVLA-- 305

Query: 414 CGQRGGYMELIGFTHEVRKVILKLASISL-CPVVTGQALVDLMVSPPKKGDASYEQDQAE 472
            G R G+  ++G   ++   IL L  +++  P    Q+++   ++  + G   Y      
Sbjct: 306 PGTRFGW--IVG-AKDILARILSLQEMTIQAPAGFTQSIIAGTMN--RWGQEGYLDWLIG 360

Query: 473 RRH---IKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDL---PFKAVQEAQHLE 526
            RH    K +  I A  LY+    ++ I+   P   M+    +D    P  A +     E
Sbjct: 361 LRHEYTKKRDCCIDA--LYKYLPQVDYIKINPPIAGMFFTVNIDASKHPEFATKYGSDPE 418

Query: 527 MTPDEFYCKSLLDATGICTVPGSGF 551
                 + +S+  A+G+  VPG+ F
Sbjct: 419 KVEKAIFDRSI--ASGVLVVPGNWF 441

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 69/157 (43%), Gaps = 15/157 (9%)

Query: 242 PAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHAL--PYYL 299
           P   +++ L V        L+   C   K  +LI  P Y +Y+    +N+   +  P  +
Sbjct: 84  PLSADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIV 143

Query: 300 DEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGI 359
           ++ S      K IE +  D+     N  +  V +PGNPTGA++   SIE I     + GI
Sbjct: 144 EDNSFQMNTDKVIETLQGDS-----NIKIAFVTSPGNPTGALIDIASIEKILS-QWQSGI 197

Query: 360 VVIADEVYQENIADG------VKFYSMKKVLRKLQKS 390
           V I DE Y +  + G      V  Y    VL+ L KS
Sbjct: 198 VAI-DEAYIDFCSTGGSAAPLVNKYPNLAVLQTLSKS 233

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 308 NPKEIEEVVQ-DAMERAINPSV--LVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIAD 364
           N K  E  V  D +E AI P    L++  P NP G V T E +  I EI  K+ +V+I+D
Sbjct: 177 NTKGTEWTVNYDELEAAITPKTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISD 236

Query: 365 EVYQ 368
           EVY+
Sbjct: 237 EVYE 240

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 83/184 (45%), Gaps = 19/184 (10%)

Query: 232 NFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNN 291
           N + +  G EP   +++ L V    C   L+   C+     +L   P Y +Y+    +N+
Sbjct: 71  NRLDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANIND 130

Query: 292 SHALPY-YLDEKSGWSTNPKEIEEVVQDAMERAINPSV--LVVINPGNPTGAVLTEESIE 348
              +    + E + +  N  E+   +++      +P +  L + +PGNPTG ++ ++ IE
Sbjct: 131 VEIVECPLITEDNSFQMNVPEVLSTLKN------DPKIKLLFITSPGNPTGKLVNKKDIE 184

Query: 349 HIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSK 408
            I E     G+VV+ DE Y +        YSM K++         K+ N+ +    S S 
Sbjct: 185 FILENWTN-GLVVV-DEAYIDFADAEGTTYSMAKLVT--------KYPNLTVLQTLSKSF 234

Query: 409 GVSG 412
           G++G
Sbjct: 235 GLAG 238

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 54/108 (50%), Gaps = 6/108 (5%)

Query: 260 YLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDA 319
           +L+     GP   ++   P Y   ++  ++  +     +L+ + G++ N ++++  V+  
Sbjct: 95  FLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVR-- 152

Query: 320 MERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
                N   +V+ NP NP G+V++ E +  I + A +  I ++ DEVY
Sbjct: 153 ----ANTKYIVLNNPNNPLGSVISTEKMTEIIDYAERNEIFIVCDEVY 196

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 39/60 (65%), Gaps = 1/60 (1%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+++E+++ +  E A  P +L  I  G NPTG+ L+++  E I+++A K+  ++I DE Y
Sbjct: 190 PEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDEPY 249

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 76/171 (44%), Gaps = 30/171 (17%)

Query: 214 VGAYSASQGVYGIRKTVANFITERDGGEPAY-----PEDIFLTVWCFR--CCCYLLSILC 266
           V  YS ++G    R T+   +T  D   P Y     PE++ +T         C L+ IL 
Sbjct: 84  VNQYSPTRG----RPTLIKSLT--DLYSPLYKLTLKPENVLVTTGANEGILAC-LMGILN 136

Query: 267 QGPKTGVLIP-----IPQYPLYTATLA---LNNSHALPYYLDEKSGWSTNPKEIEEVVQD 318
           Q  +  V  P     IP   L    +    +N    L   + + + W+ + ++ E V+  
Sbjct: 137 QNDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVIT- 195

Query: 319 AMERAINPSVLVVIN-PGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
                 N +  ++IN P NP G V T E ++ I +I  K+ +++I+DEVY 
Sbjct: 196 ------NKTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYD 240

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+++E ++ +    +  P +L  I  G NPTG+ L++E  E I++IA K+  ++I DE Y
Sbjct: 190 PEKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDEPY 249

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 110/274 (40%), Gaps = 46/274 (16%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+++ +V+++    A  P +L  I  G NPTG  + +   E I++IA KY  +++ DE Y
Sbjct: 192 PEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDEPY 251

Query: 368 QENIADGVKFYSMKKVLRKLQ-----KSHPGKFDNVQLASLHSTSKGVSGEC-------- 414
                    F  M   ++ L+     +S P +  +  L SL +T   +  E         
Sbjct: 252 Y--------FLQMNPYIKDLKEREKAQSSPKQDHDEFLKSLANTFLSLDTEGRVIRMDSF 303

Query: 415 ------GQRGGYMELIGFTHEVRKVILKLASISL-CPVVTGQALVDLMVSPPKKGDASYE 467
                 G R G+   I  + ++ K  L L  +++  P    Q LV+  +S  + G   Y 
Sbjct: 304 SKVLAPGTRLGW---ITGSSKILKPYLSLHEMTIQAPAGFTQVLVNATLS--RWGQKGYL 358

Query: 468 QDQAERRH---IKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLP----FKAVQ 520
                 RH   +K + +I A  LY+     +      P   M+    +D      FK   
Sbjct: 359 DWLLGLRHEYTLKRDCAIDA--LYKYLPQSDAFVINPPIAGMFFTVNIDASVHPEFKTKY 416

Query: 521 EAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQE 554
            +   ++     Y K +    G+  VPGS F  E
Sbjct: 417 NSDPYQLE-QSLYHKVV--ERGVLVVPGSWFKSE 447

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 318 DAMERAINPSVLVVI--NPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           +  E+AI P    VI   P NP G V T E +  +  I  K+ +++I+DEVY+
Sbjct: 189 EQFEKAITPKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVIIISDEVYE 241

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 38/82 (46%), Gaps = 9/82 (10%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P ++E ++ +    A  P +L  I  G NPTG  L +E    IF IA K+  ++I D  Y
Sbjct: 191 PAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDAPY 250

Query: 368 QENIADGVKFYSMKKVLRKLQK 389
                    F  M K  R LQK
Sbjct: 251 Y--------FLQMDKYERDLQK 264

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/246 (20%), Positives = 103/246 (41%), Gaps = 32/246 (13%)

Query: 314 EVVQDAMERAINPSV--LVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENI 371
           ++  D+++ A+N     +++  P NP G V TE  +  + +I  K  +V+I+DEVY+   
Sbjct: 176 QIDWDSLQAAMNSKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEH-- 233

Query: 372 ADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVR 431
                    K    ++    P      ++  L + + G +G+     G+   IG+   + 
Sbjct: 234 ------LYFKDSFTRIATLSP------EIGQL-TLTVGSAGKSFAATGWR--IGWALSLN 278

Query: 432 KVILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETF 491
           + +L  A+ +   +           SP ++  A+   D AE+     E  ++  + YE F
Sbjct: 279 QELLSYAAKAHTRICFASP------SPLQEAVANAFND-AEKVEYFKETRLQYIRKYEIF 331

Query: 492 VGL---EGIECQKPQGAMYL---FPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICT 545
             +    G+   +P+G  ++   F K+ +P       + L    D      L++  G+  
Sbjct: 332 TNVLNELGLPYTEPEGTYFILVNFSKVKIPPDYKYPEELLNKAKDFRISYWLMNELGVVA 391

Query: 546 VPGSGF 551
           +P + F
Sbjct: 392 IPPTEF 397

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+++E ++ +  E A  P +L  I  G NPTG+ L  E  + I+ IA K+  ++I DE Y
Sbjct: 190 PEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDEPY 249

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+++EE++ +    A  P +L  I  G NPTG  L +E    I+ IA K+  ++I DE Y
Sbjct: 190 PEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIEDEPY 249

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 9/128 (7%)

Query: 242 PAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHAL--PYYL 299
           P   E+I L V        L+ + C   K  ++I  P Y +Y+    +N+   +  P   
Sbjct: 84  PLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVA 143

Query: 300 DEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGI 359
           ++ S      K +E + QD   + I      + +PGNPT A++    IE +       G 
Sbjct: 144 EDNSFQMDTSKVLETLAQDPTIKLI-----FITSPGNPTAALIDTAEIEKVLN--NWTGG 196

Query: 360 VVIADEVY 367
           +V+ DE Y
Sbjct: 197 LVVVDEAY 204

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 314 EVVQDAMERAINPSVLVVI--NPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           ++  DA+E+  N     VI   P NP G V TE+ +  + ++  ++  VVI+DEVY+
Sbjct: 174 QIDWDALEKTFNNKTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYE 230

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 11/71 (15%)

Query: 309 PKEIEEVVQ---------DAMERAINPSVLVVI--NPGNPTGAVLTEESIEHIFEIAAKY 357
           PKE++  V          D   RAI P    VI   P NP G V T E +  +  I  + 
Sbjct: 171 PKELDNRVTKGTEWTVDFDEFTRAITPKTKAVIINTPHNPIGKVFTREELTKLGNICVEN 230

Query: 358 GIVVIADEVYQ 368
            +++IADEVY+
Sbjct: 231 NVIIIADEVYE 241

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 314 EVVQDAMERAINPSV-LVVIN-PGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           E+  D +E+ IN     V+IN P NP G V T E +  + +I     IV+I+DEVY+
Sbjct: 174 EIDWDILEKTINSRTKCVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYE 230

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 61/124 (49%), Gaps = 9/124 (7%)

Query: 246 EDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHAL--PYYLDEKS 303
           +++ L V    C   L+   C+     +++  P Y +Y+    +N+   +  P  +++ S
Sbjct: 85  KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNS 144

Query: 304 GWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIA 363
                 + +E + +D + R     +L + +PGNPTG ++  + I ++ E   K G+VV+ 
Sbjct: 145 FQMDVKRTLETLKKDDLIR-----LLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV- 197

Query: 364 DEVY 367
           DE Y
Sbjct: 198 DEAY 201

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 79/176 (44%), Gaps = 21/176 (11%)

Query: 241 EPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSH--ALPYY 298
           +P   +++ L V        L+   C   K  +LI    Y +YT    +N+     +P  
Sbjct: 83  KPLDADNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLL 142

Query: 299 LDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVI--NPGNPTGAVLTEESIEHIFEIAAK 356
           L E+  +  + ++I E +Q+      +PS+ +V   +PGNPTG  +    IE I     +
Sbjct: 143 LSEEDKFQIDEEKILETLQN------DPSIKLVFITSPGNPTGTFIDVNRIEKILS-QWQ 195

Query: 357 YGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSG 412
            G+VV+ DE Y + +       S K  L  L      K++N+ +    S S G++G
Sbjct: 196 TGLVVV-DEAYIDFVEG-----SDKGSLAPLAT----KYENIAVLQTLSKSFGLAG 241

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 69/152 (45%), Gaps = 9/152 (5%)

Query: 217 YSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIP 276
           Y A +G   +R  VA+  +++   E    +D  L         +L+S    GP   V+  
Sbjct: 55  YGAIKGSDELRSLVASLYSDK---EVKLDKDNVLITNGAIGANFLVSYTLAGPGDHVICV 111

Query: 277 IPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGN 336
            P Y   ++   +  +      L+ ++ +  +  +++ +++       N   +V+ NP N
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKG------NTKCIVLNNPNN 165

Query: 337 PTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           P G+V+   ++E I  +A K  I VI DEVY+
Sbjct: 166 PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 11/71 (15%)

Query: 309 PKEIEEVVQ---------DAMERAINPSV--LVVINPGNPTGAVLTEESIEHIFEIAAKY 357
           PKE+E  V          D +  AI P    L++  P NP G V T E +  I  I  + 
Sbjct: 174 PKELENRVTHGTEWTVDYDELRAAITPKTKALILNTPHNPIGKVFTREELLEIGNICVEN 233

Query: 358 GIVVIADEVYQ 368
            +V+I+DEVY+
Sbjct: 234 NVVIISDEVYE 244

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 306 STNPKEIEE--VVQDAMERAINPSV--LVVINPGNPTGAVLTEESIEHIFEIAAKYGIVV 361
           S  P E  E  V  D +  AI P    L++  P NP G V T E +  I +I  +  +V+
Sbjct: 174 SVRPTEGTEWTVDYDELRAAITPKTKALILNTPHNPVGKVFTREELLQIGQICVENNVVI 233

Query: 362 IADEVYQ 368
           I+DEVY+
Sbjct: 234 ISDEVYE 240

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 330 VVIN-PGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           V+IN P NP G V T E +  I EI  K  +V+I+DEVY+
Sbjct: 201 VIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYE 240

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 11/71 (15%)

Query: 309 PKEIEEVVQDAME---------RAINPSVLVVI--NPGNPTGAVLTEESIEHIFEIAAKY 357
           PK++++ + +  E          AI P    VI  +P NP G V T+E +  + EI  + 
Sbjct: 175 PKDLDQRITEGTEWTIDFEQFRNAITPKTKAVIVNSPHNPIGKVFTKEELTKLGEICVEN 234

Query: 358 GIVVIADEVYQ 368
            +++I+DEVY+
Sbjct: 235 NVIIISDEVYE 245

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 74/162 (45%), Gaps = 17/162 (10%)

Query: 237 RDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHAL- 295
           +D  +P   E++ L V        ++   C   K  +L+  P Y +Y+    +N+   + 
Sbjct: 78  KDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVK 137

Query: 296 -PYYLDEKSGWSTNPKEIEEVVQDAMERAINPSV--LVVINPGNPTGAVLTEESIEHIFE 352
            P    + S +  N  E+ +  Q+      +PS+  + + +PGNPTGA +    IE I +
Sbjct: 138 CPLITSDNS-FQANTDEVIKTAQN------DPSIKLIFITSPGNPTGAKVETSRIEKILQ 190

Query: 353 IAAKYGIVVIADEVYQE----NIADGVKFYSMKKVLRKLQKS 390
              + G+VV+ DE Y +    + A  V  Y    VL+ L KS
Sbjct: 191 NWDR-GMVVV-DEAYIDFCGGSTAPLVTKYPNLCVLQTLSKS 230

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 80/186 (43%), Gaps = 25/186 (13%)

Query: 238 DGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPY 297
           +G  P   ++I L V        ++   C   +  V++  P Y +Y     +N+      
Sbjct: 80  EGLAPLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVG---- 135

Query: 298 YLDEKSGWSTNPKEIEE---VVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIA 354
           Y++     S N  +I+E   + Q  ++++I   V+ + +PGNPTGA +    +E +    
Sbjct: 136 YVEVPLISSDNSFQIDEDRILEQLNLDKSI--KVVFITSPGNPTGACIEVGRVEKLLR-N 192

Query: 355 AKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGEC 414
              GIVV+ DE Y       + F + K  L  L   HP       L  L + SK  SG  
Sbjct: 193 WTAGIVVV-DEAY-------IDFSADKPSLSPLVNKHP------NLVVLQTLSKA-SGLA 237

Query: 415 GQRGGY 420
           G R G+
Sbjct: 238 GIRLGF 243

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 12/90 (13%)

Query: 309 PKEIEEVVQDAMERAINPSVL----------VVIN-PGNPTGAVLTEESIEHIFEIAAKY 357
           PKE+ E V    E  I+  +L          +++N P NP G V T E +  + +I  K 
Sbjct: 171 PKELSERVTIGAEWKIDFDILNKTINERTKCIILNTPHNPIGKVFTREELTQLGDICVKN 230

Query: 358 GIVVIADEVYQENIADGVKFYSMKKVLRKL 387
            I +I+DEVY E++  G +F  +  + +++
Sbjct: 231 NIYIISDEVY-EHLYFGDEFTRIATISKEI 259

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+++E+++ +    A  P +L  I  G NPTG  L  +  E I+ IA K+  +++ DE Y
Sbjct: 189 PEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDEPY 248

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+++E+++ +    A  P +L  I  G NPTG  L ++  + I+ IA K+  ++I DE Y
Sbjct: 189 PEKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 293 HALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIF 351
           +  P  LDE   +   P+++E ++ +       P +L  I  G NPTG+ L+++    I+
Sbjct: 180 NVFPVPLDE---FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIY 236

Query: 352 EIAAKYGIVVIADEVY 367
            IA K+  ++I DE Y
Sbjct: 237 RIAQKHNFIIIEDEPY 252

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 318 DAMERAINPSVLVVI--NPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           +  E+AI      VI   P NP G V T E +  +  I  K+ +V+I+DEVY+
Sbjct: 189 EQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYE 241

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+ +E ++ +       P +L  I  G NPTG+ L+++  + I+ IA K+  ++I DE Y
Sbjct: 193 PERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDEPY 252

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 330 VVIN-PGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           V+IN P NP G V T E +  +  I  K+ +V+I+DEVY+
Sbjct: 218 VIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYE 257

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 318 DAMERAI--NPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           D +++AI  N  ++++ NP NP G V+++E +  I E+  +  + +  DEVY+
Sbjct: 143 DTLKKAIKSNTKLIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVYR 195

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 318 DAMERAINPSVLVVI--NPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           +  E+AI      VI   P NP G V T + +  +  I  K+ +V+I+DEVY+
Sbjct: 189 EQFEKAITSKTKAVIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVYE 241

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 111/274 (40%), Gaps = 46/274 (16%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+++ +++ +    A  P +L  I  G NPTG  + +   E I++IA K+  +++ DE Y
Sbjct: 192 PEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDEPY 251

Query: 368 QENIADGVKFYSMKKVLRKLQ-----KSHPGKFDNVQLASLHST--SKGVSGEC------ 414
                    F  M   ++ L+     +S P +  +  L SL +T  S    G        
Sbjct: 252 Y--------FLQMNPYIKDLKEREKAQSSPKQDHDEFLKSLANTFLSLDTDGRVIRMDSF 303

Query: 415 ------GQRGGYMELIGFTHEVRKVILKLASISL-CPVVTGQALVDLMVSPPKKGDASYE 467
                 G R G+   I  + ++ K  L L  +++  P    Q LV+  +S  + G   Y 
Sbjct: 304 SKVLAPGTRLGW---ITGSSKILKPYLSLHEMTIQAPAGFTQVLVNATLS--RWGQKGYL 358

Query: 468 QDQAERRH---IKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLP----FKAVQ 520
                 RH   +K + +I A  LY+     +      P   M+    +D      FK   
Sbjct: 359 DWLLGLRHEYTLKRDRAIDA--LYKYLPQCDTFVINPPIAGMFFTVNIDASAHPEFKTKY 416

Query: 521 EAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQE 554
            +   ++  ++     ++D  G+  VPGS F  E
Sbjct: 417 NSDPYQL--EQAIYHKVVD-RGVLVVPGSWFKSE 447

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 11/71 (15%)

Query: 309 PKEIEEVVQDAMERAIN----------PSVLVVIN-PGNPTGAVLTEESIEHIFEIAAKY 357
           PKE+++ V +  E  ++           +  V+IN P NP G V T E +  I  I  + 
Sbjct: 172 PKELDQRVTEGTEWTVDMEQFKNAITSKTKAVIINTPHNPIGKVFTREELLQIGNICVEK 231

Query: 358 GIVVIADEVYQ 368
            +++I+DEVY+
Sbjct: 232 NVIIISDEVYE 242

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+ +E ++ +       P +L  I  G NPTG+ L+++    I+ IA K+ +++I DE Y
Sbjct: 193 PERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIEDEPY 252

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 317 QDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           QD  ++     + +V    NPTGA+ +  S   + E+A KY I++I+D+VY 
Sbjct: 179 QDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVYD 230

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 11/71 (15%)

Query: 309 PKEIEEVVQDAMERAINPSVL----------VVIN-PGNPTGAVLTEESIEHIFEIAAKY 357
           P E+ + V +  E  I+  +L          V+IN P NP G V T E +  +  I  + 
Sbjct: 185 PAELSKRVTEGTEWVIDYDMLRQTINEKTKAVIINSPHNPIGKVFTREELLKLGNICVEK 244

Query: 358 GIVVIADEVYQ 368
           GI +I+DEVY+
Sbjct: 245 GIYIISDEVYE 255

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+++E+++ +    A  P +L  I  G NPTG  L    +E I+ IA K+  +++ D  Y
Sbjct: 191 PEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDAPY 250

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 326 PSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P +L  I  G NPTG  L++    HI+ +A +Y I++I D+ Y
Sbjct: 210 PKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIIIEDDPY 252

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 4/63 (6%)

Query: 309 PKEIEEVVQDAMERAIN---PSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIAD 364
           P+++EE++ +  +R      P +L  I  G NPTG  L+E     I+ +A KY I+++ D
Sbjct: 191 PEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIVED 250

Query: 365 EVY 367
           + Y
Sbjct: 251 DPY 253

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 309 PKEIEEVV---QDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIAD 364
           P+++EE++    D       P +L  I  G NPTG  L++    +I+ +A KY +++I D
Sbjct: 190 PEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIED 249

Query: 365 EVY 367
           E Y
Sbjct: 250 EPY 252

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 37.4 bits (85), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 54/105 (51%), Gaps = 15/105 (14%)

Query: 264 ILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERA 323
           ++C  P    L  +P+  ++ A ++L         L ++ G+  N + ++++++      
Sbjct: 105 VICVDPTYAQLYSVPK--MFGAEVSL-------LKLQKEDGFIPNIETLKKMIKS----- 150

Query: 324 INPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
            N  ++++ NP NP G+ ++ E++  I ++  +  I +  DEVY+
Sbjct: 151 -NTKLIIINNPNNPLGSAISTETLNDICQLCEENNIYLHCDEVYK 194

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 37.4 bits (85), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 299 LDEKSGWSTNPKEIEEVVQD-AMERAINPSVLVVI-NPGNPTGAVLTEESIEHIFEIAAK 356
           LD   G S  P    E++Q  A+ + I   VL  I    NP+G   + E+   + +IA K
Sbjct: 158 LDHHEGES-QPDSTTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARK 216

Query: 357 YGIVVIADEVYQ 368
           Y ++VI+D+VY 
Sbjct: 217 YDMLVISDDVYD 228

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+++ +++ +    A  P +L  I  G NPTG  +     E I++IA K+  +++ DE Y
Sbjct: 192 PEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDEPY 251

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 57/261 (21%), Positives = 102/261 (39%), Gaps = 30/261 (11%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+++  ++ +       P +L  I  G NPTG+ L  E    +++IA K+  +++ DE Y
Sbjct: 190 PEKLAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPY 249

Query: 368 Q-ENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQR----GGYME 422
               + D VK  S++K ++          D   L S+ +  + +  +   +    G  + 
Sbjct: 250 YFLQMEDYVKDPSLRKEVKLSHDEFLASLDQTFL-SIDTDGRVIRMDSFSKVLAPGSRLG 308

Query: 423 LIGFTHEVRKVILKLASISLCPVVT-GQALVDLMVSPPKKGDASYEQDQAERRH---IKS 478
            I  ++++ K  L L  +S+       Q++V   +S  K G   Y       RH   +K 
Sbjct: 309 WITCSNQIMKAYLALYEMSMQAAAGFTQSIVSATLS--KWGQHGYLDWLLGLRHEYTLKR 366

Query: 479 ELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPD-------- 530
           + +I A   Y+     +      P   M+     D        A+H E T          
Sbjct: 367 DNAIDAC--YKYIPQTDAFHINPPVAGMFFTITFD-------GAKHPEFTTKFKSDPLLL 417

Query: 531 EFYCKSLLDATGICTVPGSGF 551
           E Y       +G+   PGS F
Sbjct: 418 ESYLYEKAVESGVIIAPGSWF 438

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 51/103 (49%), Gaps = 7/103 (6%)

Query: 266 CQGPKTGVLIPIPQYPLYTATLALNNSHALPY-YLDEKSGWSTNPKEIEEVVQDAMERAI 324
           C   +  +L+  P Y +Y+    +N+   +    + E + +  +  ++ +++ +  E   
Sbjct: 108 CVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSFQMDSDKVLDILNNDQE--- 164

Query: 325 NPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
              +L + +PGNPTGA +    IE + +   + G+VV+ DE Y
Sbjct: 165 -IKLLFITSPGNPTGAQIETARIEKVLQNWDR-GLVVV-DEAY 204

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 326 PSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           PS+L  I+ G NPTG  ++ E+   I+++A KY  +++ D+ Y
Sbjct: 226 PSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 309 PKEIEEVVQDAMERAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P+++ +++ +    A  P +L  I  G NPTG  + +   E I++IA K+  +++ DE Y
Sbjct: 192 PEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIVEDEPY 251

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 336 NPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           NPTGA+ +  S   + E+A KY I++I+D+VY 
Sbjct: 199 NPTGAIYSRSSRLKLLELARKYDILIISDDVYD 231

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 64/129 (49%), Gaps = 13/129 (10%)

Query: 269 PKTG-VLIPIPQYPLYTATLALNNSHALPY-YLDEKSGWSTNPKEIEEVVQDAMERAINP 326
           PKT  VL+  P Y +Y+    +N++  +    + E + +  +   + E + +  + +I  
Sbjct: 110 PKTDKVLVLPPTYSMYSVFAMINDTEVVECPLITEDNSFDMDLDNVLETLSN--DDSI-- 165

Query: 327 SVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVY-----QENIADGVKFYSMK 381
            +L +  PGNPTGA ++ + IE +    +  GIVV+ DE Y      ++ A  V  Y   
Sbjct: 166 KLLFITTPGNPTGASISTQKIEMLLNNWSA-GIVVV-DEAYIDFSSSDSAAPLVNKYPNL 223

Query: 382 KVLRKLQKS 390
            V++ L KS
Sbjct: 224 VVIQTLSKS 232

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 60/129 (46%), Gaps = 11/129 (8%)

Query: 242 PAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPY-YLD 300
           P   E++ L V        ++   C   K  +L+  P Y +Y+    +N+   +    L 
Sbjct: 85  PLTSENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLY 144

Query: 301 EKSGWSTNPKEIEEVVQDAMERAINP--SVLVVINPGNPTGAVLTEESIEHIFEIAAKYG 358
           + + +  + + +  V+Q+      +P   +L + +PGNPTGA +  E IE + +     G
Sbjct: 145 KNNSFQMDTESVLTVLQN------DPLIKLLFITSPGNPTGARIETERIETVLQNWTD-G 197

Query: 359 IVVIADEVY 367
           +VV+ DE Y
Sbjct: 198 LVVV-DEAY 205

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 329 LVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           L++  P NP G V T+E +  I  +  +  +V+I+DEVY+
Sbjct: 209 LILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYE 248

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 336 NPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           NPTG   + E+   + EIA KY +++IAD+VY 
Sbjct: 202 NPTGTTYSTETKLKLIEIARKYDMLIIADDVYD 234

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 22/32 (68%)

Query: 336 NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           NP+G   T E+   + EIA KY ++++AD+VY
Sbjct: 205 NPSGQTYTLETRRRLIEIARKYDMLILADDVY 236

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 62/131 (47%), Gaps = 13/131 (9%)

Query: 266 CQGPKTGVLIPIPQYPLYTATLALNNSHAL--PYYLDEKSGWSTNPKEIEEVVQDAMERA 323
           C   K  +L+  P Y +Y+    +N+   +  P   ++ S    + K ++ +  D + + 
Sbjct: 108 CVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNSFQLNSDKVLDILKNDPLIK- 166

Query: 324 INPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQE----NIADGVKFYS 379
               ++ + +PGNPTG  +  + IE + +     G+VV+ DE Y +    ++A  V  Y 
Sbjct: 167 ----LVFITSPGNPTGVKIETKRIEKVLQ-NWDNGLVVV-DEAYIDFCGGSLAPLVTQYQ 220

Query: 380 MKKVLRKLQKS 390
              VL+ L KS
Sbjct: 221 NLIVLQTLSKS 231

>KLLA0F13640g Chr6 complement(1264781..1266037) [1257 bp, 418 aa]
           {ON} similar to uniprot|Q01802 Saccharomyces cerevisiae
           YKL106W AAT1 Mitochondrial aspartate aminotransferase
           catalyzes the conversion of oxaloacetate to aspartate in
           aspartate and asparagine biosynthesis
          Length = 418

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 43/98 (43%), Gaps = 2/98 (2%)

Query: 273 VLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAIN--PSVLV 330
           V IP P +  ++     N  + + YY   + G  +  K ++E+ +    R  +  PS+++
Sbjct: 138 VWIPNPSWANHSNVFQWNGFNQIKYYTYYEDGKLSIDKWLKELKESCSSRDPDWPPSIVL 197

Query: 331 VINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
                NPTG   T E  + I  +    GI  I D  YQ
Sbjct: 198 HACCHNPTGVDPTLEQWQQILPVIHDLGITPIIDMAYQ 235

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 330 VVIN-PGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           V+IN P NPTG V T E +  +  I  +  + +I+DEVY+
Sbjct: 186 VIINSPHNPTGKVFTREELLTLGNICVEKNVYIISDEVYE 225

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 326 PSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P +L  I  G NPTG  L+ E    I+EI  K+ I+++ D+ Y
Sbjct: 209 PKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPY 251

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
           (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 7/87 (8%)

Query: 170 RQVLSILQYPDILKENEQNLIDAKVYKRDAI--DRAKLLLSEIGGSVGAYSASQGVYGIR 227
           +Q +SI++  +     +   I A  Y RD I  D+ K LLSE+  S+   S  + VY + 
Sbjct: 309 KQYISIVERYESQCREQLEKIKAANYTRDRIARDQFKNLLSELSSSIRCNSKWENVYPLF 368

Query: 228 KTVANFITE--RDGGEPAYPEDIFLTV 252
           K+   F+    R+G  P    D+FL V
Sbjct: 369 KSDKRFVATLGRNGSSPL---DMFLDV 392

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 58/127 (45%), Gaps = 7/127 (5%)

Query: 242 PAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDE 301
           P   E++ L V        ++   C   K  ++   P Y +Y+   ++N+   +   L  
Sbjct: 81  PLTAENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPL-- 138

Query: 302 KSGWSTNPKEIE-EVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIV 360
               S N  +++ E V D +++     ++ + +PGNPTGA +    IE I +     GI+
Sbjct: 139 --VTSDNSFQVDTEAVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQ-NWDQGIL 195

Query: 361 VIADEVY 367
           V+ DE Y
Sbjct: 196 VV-DEAY 201

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 6/72 (8%)

Query: 301 EKSGWSTNPKEIEEVVQDAME----RAINPSVLVVINPG-NPTGAVLTEESIEHIFEIAA 355
           E  G    P+++E ++Q+  +    R++ P +L VI  G NP G  L +E    I+ I  
Sbjct: 179 EIDGHGVVPEKLEWLLQNWDDLHPGRSL-PKLLYVIPTGQNPMGVTLADERKPLIYNIIQ 237

Query: 356 KYGIVVIADEVY 367
           KY +V+I D+ Y
Sbjct: 238 KYDMVLIEDDPY 249

>TBLA0A10320 Chr1 (2542498..2544363) [1866 bp, 621 aa] {ON}
           Anc_5.287 YHR045W
          Length = 621

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 379 SMKKVLRKLQKSHPGKFDNVQL--ASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILK 436
           +MKK++  +QKSH   FDN +L  A+L   S G+  +CG+R        FT  +R + L+
Sbjct: 403 NMKKIIDHIQKSHTNIFDNFRLNWATLL-FSYGIFSKCGERQS-----RFTDNLRCIYLE 456

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%)

Query: 328 VLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           ++++ NP NP G V   + +  +  +    G  +IADEVY+
Sbjct: 184 LMIINNPNNPLGKVFNRDELLEMATLCVNNGAYIIADEVYE 224

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 29/44 (65%)

Query: 325 NPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           N  ++++ NP NP G+V+ ++ ++ I ++  +  I + +DEVY+
Sbjct: 151 NTKLIIINNPNNPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>SAKL0A06974g Chr1 (620230..622101) [1872 bp, 623 aa] {ON} similar
           to uniprot|P38319 Saccharomyces cerevisiae YBR223C TDP1
           Tyrosine-DNA Phosphodiesterase
          Length = 623

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 11/80 (13%)

Query: 311 EIEEVVQDAMERAINPSVLVV--INPGNPTGAV----LTEESIEHIFEIAAKYGIVVIAD 364
           ++ ++ +D+ E      + VV  +   NP G++    L EE  EH+     +Y   +I  
Sbjct: 93  DVIDLTKDSDEDDTEDRIEVVKHVRTSNPAGSIEQRCLEEEQAEHV-----QYPFRLIRS 147

Query: 365 EVYQENIADGVKFYSMKKVL 384
           E+Y  N      F SM+K+L
Sbjct: 148 EIYDRNTPSSPHFISMEKIL 167

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 6/93 (6%)

Query: 336 NPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ----ENIADGVKFYSMKKVLRKLQKSH 391
           NP+G   + E+   + EIA KY ++VI D+VY      + AD +    ++ V      + 
Sbjct: 203 NPSGNTYSLETRRRLIEIARKYDMLVITDDVYDILDYTSAADQLPSPPLRMVHLDRATAA 262

Query: 392 PGKFDNVQLASLHSTSKGVSGECGQRGGYMELI 424
           PG+       S  + SK ++   G R GY E I
Sbjct: 263 PGEDSFGNTVSNATFSKLIA--PGLRFGYHETI 293

>Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 aa]
           {ON} YMR019W (REAL)
          Length = 920

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 63/148 (42%), Gaps = 13/148 (8%)

Query: 86  RSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAK----YAVRGSIPMRAEELKVQLENN 141
           R+ ++ SLK+ K  D      LT  ++N N + +K    Y + GS            +N 
Sbjct: 199 RNTANESLKIDKNNDNDMNTNLTTVNMNNNQVGSKNSHGYDMHGSSGALDSNNITSEKNE 258

Query: 142 PSTLPFSQIVNANIGNP-QQLKQKPLSFYRQVLSILQY---PDILKENEQNLIDAKVYKR 197
             +   + +VN+++ +P Q        F+R+  +IL Y     ILK+     +D    KR
Sbjct: 259 MLSCQITSMVNSHLQSPWQTFSLDKYRFHRRYQNILPYYLGTSILKDLSPETVDQAKLKR 318

Query: 198 DAIDRAKLLLSEIGGSVGAYSA---SQG 222
             +      LS  GG    Y+A   SQG
Sbjct: 319 PRVQNYGWNLS--GGHYLKYNADFKSQG 344

>ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL106W (AAT1)
          Length = 443

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 62/152 (40%), Gaps = 7/152 (4%)

Query: 273 VLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVI 332
           + +P P +  +     LN    +  Y   + G       + ++ + A +R     +L+  
Sbjct: 163 IWVPQPSWANHMNIFKLNGFEEVRRYRYYEDGAVDVDSWLAQLERAAADRPYPQCILLHA 222

Query: 333 NPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHP 392
              NPTG   T E    I  +    G+V I D  YQ     G++   ++     L+    
Sbjct: 223 CCHNPTGVDPTREQWSRILSVINGLGMVPIVDMAYQ-----GLESGDLRADAYLLRMCLE 277

Query: 393 GKFDNVQLASLHSTSKGVSGECGQRGGYMELI 424
            ++DN  L   HS +K + G  G+R G + ++
Sbjct: 278 HRWDN-GLYVCHSFAKNM-GLYGERVGSLSVV 307

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 59/129 (45%), Gaps = 11/129 (8%)

Query: 242 PAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPY-YLD 300
           P   E+  L V        ++   C   K  +L+  P Y +Y+    +N+   +    + 
Sbjct: 83  PLTDENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLIT 142

Query: 301 EKSGWSTNPKEIEEVVQDAMERAINPSVLVVI--NPGNPTGAVLTEESIEHIFEIAAKYG 358
           E + +  +  EI  ++      A +P + +V   +PGNPTGA +  + IE++ +     G
Sbjct: 143 EDNSFQIDATEILNIL------ANDPLIKLVFITSPGNPTGAKIEIDRIEYLLK-NWDQG 195

Query: 359 IVVIADEVY 367
           +V++ DE Y
Sbjct: 196 LVIV-DEAY 203

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 326 PSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P VL  I  G NPTG  L+ E  + I+E+A  +  +++ D+ Y
Sbjct: 246 PRVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPY 288

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 9/104 (8%)

Query: 266 CQGPKTGVLIPIPQYPLYTATLALNNSHAL--PYYLDEKSGWSTNPKEIEEVVQDAMERA 323
           C   K  +L   P Y +Y+    +N+   L  P   ++ S    + K I  +  D + + 
Sbjct: 107 CVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDNSFQPDSQKVISILSSDPLIK- 165

Query: 324 INPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
               ++ + +PGNPTGA +    I  I E  +  G  V+ DE Y
Sbjct: 166 ----LVFLTSPGNPTGAKIDSNIIIKILE--SWDGGFVVVDEAY 203

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 326 PSVLVVI-NPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P +L  I N  NPTG  L EE    +  +A++Y  ++I D+ Y
Sbjct: 205 PKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPY 247

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 23/32 (71%)

Query: 336 NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           NP+GA  ++E    + ++A +Y I++I+D+VY
Sbjct: 200 NPSGATYSQECRLKLLDLARRYDILIISDDVY 231

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 13/66 (19%)

Query: 304 GWSTNPKEIEEVVQDAMERAIN-PSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVV 361
            WST P            R +N P VL  I  G NPTG  + +   E I+E+A ++  ++
Sbjct: 257 NWSTGPY-----------RHLNKPRVLYTIATGQNPTGMSVPQWKREKIYELAQRHDFLI 305

Query: 362 IADEVY 367
           + D+ Y
Sbjct: 306 VEDDPY 311

>TPHA0J02430 Chr10 complement(535317..537080) [1764 bp, 587 aa] {ON}
           Anc_6.221 YPL208W
          Length = 587

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 59/127 (46%), Gaps = 17/127 (13%)

Query: 113 NENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQV 172
           N+NV K     R  + +  +E+   L  NPS L F  +VN N+GN   +K K  S Y++ 
Sbjct: 93  NDNVRKLSMKFRPYLDLLPKEMHSPLIWNPSELQF--LVNTNLGN--SIKNKLQSIYKEW 148

Query: 173 LSILQYPD------------ILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSAS 220
             I ++ +            I+ E+   L + ++Y+R  + +A  L S +  S  A+  S
Sbjct: 149 YQITKFNESLFNHNEIKEEFIIYESFDELSELELYER-LLHKANELESPVWYSFIAFLWS 207

Query: 221 QGVYGIR 227
             ++  R
Sbjct: 208 HLIFISR 214

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 95/224 (42%), Gaps = 20/224 (8%)

Query: 273 VLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVV- 331
           V IP P +P +      N    + YY   K G       I+++ + A +   +P  +V+ 
Sbjct: 140 VWIPNPSWPNHANVFQNNGFKEINYYSYYKDGSLDIEGWIQDLEKHAQKEGEDPQCIVLH 199

Query: 332 INPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSH 391
               NPTG   ++E  + I +   +  ++ I D  YQ    D    Y    +L      +
Sbjct: 200 ACCHNPTGIDPSKEQWQRILDKIHELNLIPIIDMAYQG--LDSGDLYKDAYLLNMSLDEN 257

Query: 392 PGKFDNVQLASLHSTSKGVSGECGQRGGYMEL---------IGFTHEVRKVILKLASISL 442
             ++ N  L    S +K + G  G+R G + +         +    +++K++  + S   
Sbjct: 258 RYQWKN-GLFLCQSFAKNM-GLYGERVGSLSVVTPPDSKLKVNVDSQLKKIVRGMYS--- 312

Query: 443 CPVVTGQALVDLMVSPPKKGDASYE--QDQAER-RHIKSELSIR 483
            P   G  + +L++S P   +  +E  ++ A R +++K+E+  R
Sbjct: 313 SPPGYGSRVANLVLSTPHLKEEWFEDVKNVANRLQYVKAEMGKR 356

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 23/33 (69%)

Query: 336 NPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQ 368
           NP+G   + E+ + + ++A KY +++IAD+VY 
Sbjct: 206 NPSGMSFSLETKKKLLDLARKYDMLIIADDVYD 238

>SAKL0D14630g Chr4 (1206755..1207567) [813 bp, 270 aa] {ON} highly
           similar to uniprot|Q08873 Saccharomyces cerevisiae
           YOR367W SCP1
          Length = 270

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 7/56 (12%)

Query: 345 ESIEHIFEIAAKYGIVVIADEVYQ-----ENIADGVKFYSMKKVLRKLQKSHPGKF 395
           E I    E A KYG  V  DE++Q     E+    + + S+K + R   K HP KF
Sbjct: 161 EQISQFLEFARKYG--VPDDELFQTLDLYEDKDPAIVYQSLKSLSRYANKKHPDKF 214

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 56/128 (43%), Gaps = 14/128 (10%)

Query: 247 DIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLAL--NNSHALPYYLDEKSG 304
           D+  TV         L + C     G  I   +Y   ++ +A       A P  LDE   
Sbjct: 132 DVLATVGNTSAWESTLRVFC---NRGDTILAEEYTFSSSLVAAEAQGVRAYPVPLDENG- 187

Query: 305 WSTNPKEIEEVVQDAMERAIN----PSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGI 359
               P+ + E++ D  ER  +    P +L  +  G NPTG  L+ +  + ++ +A ++ +
Sbjct: 188 --MVPERLGELL-DNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDL 244

Query: 360 VVIADEVY 367
           +++ DE Y
Sbjct: 245 LIVEDEPY 252

>TDEL0E00380 Chr5 complement(89449..90966) [1518 bp, 505 aa] {ON}
           Anc_2.3 YNL241C
          Length = 505

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 215 GAYSASQGVYGIRKTVANFITERDGGEP------AYPEDIFLTV 252
           GAY  + G   +RK++  F +ER   EP      A P  +FLTV
Sbjct: 91  GAYDTADGYVKLRKSIEEFESERKVSEPHRLFYFALPPSVFLTV 134

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 49/103 (47%), Gaps = 7/103 (6%)

Query: 266 CQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIE-EVVQDAMERAI 324
           C   K  +L+  P Y +Y+    +N+   +   L      S N  +++ E V   +E   
Sbjct: 108 CVPGKEKILVLPPTYSMYSVCANINDIEVVQCPL----VVSDNSFQMDVEAVLTILENDP 163

Query: 325 NPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
              ++ V +PGNPTGA +    IE + +   + G+VV+ DE Y
Sbjct: 164 LIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV-DEAY 204

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 326 PSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P +L  I  G NPTG  +  E+   I+E+A K+  +++ D+ Y
Sbjct: 241 PRILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPY 283

>TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {ON}
           Anc_2.475 YKL106W
          Length = 443

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 58/134 (43%), Gaps = 10/134 (7%)

Query: 296 PYYLDEK---SGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFE 352
           PYY +EK     W  +   I++  ++    +    +L+     NPTG   T+E  + I +
Sbjct: 177 PYYSNEKIVLKDWLNHLINIQKTDREVTSNSKPSCILLHACCHNPTGLDPTKEQWDQILD 236

Query: 353 IAAKYGIVVIADEVYQENIADGV--KFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGV 410
                 ++ I D  YQ   +  V    Y ++KVL K  K +    + + L    + + G+
Sbjct: 237 TIYDLNLIPIIDMAYQGLESGDVLKDSYLLRKVLNK--KRYKNWKNGIYLCQSFAKNMGL 294

Query: 411 SGECGQRGGYMELI 424
            GE   R G + +I
Sbjct: 295 YGE---RVGSLSII 305

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 9/104 (8%)

Query: 266 CQGPKTGVLIPIPQYPLYTATLALNNSHAL--PYYLDEKSGWSTNPKEIEEVVQDAMERA 323
           C   K  +L+  P Y +Y+    +N+   +  P  + + S        +  +  D + + 
Sbjct: 108 CVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNSFQMDTEAALTILKNDPLIKL 167

Query: 324 INPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           I      V +PGNPTGA +    IE I +   + G+VV+ DE Y
Sbjct: 168 I-----FVTSPGNPTGAKIKTCLIEKILQ-NWENGLVVV-DEAY 204

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 326 PSVLVVINPG-NPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           P  L  +  G NPTG  L+      I+EIA K+  +++ D+ Y
Sbjct: 208 PKALYTVATGQNPTGMTLSPTKRRRIYEIAQKHDFLIVEDDPY 250

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 9/104 (8%)

Query: 266 CQGPKTGVLIPIPQYPLYTATLALNNSHAL--PYYLDEKSGWSTNPKEIEEVVQDAMERA 323
           C   K  +L+  P Y +Y+    +N+   +  P  + + S        +  +  D++ + 
Sbjct: 108 CVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGSFQMDTEAVLTILKNDSLIK- 166

Query: 324 INPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
               ++ V +PGNPTGA +    IE + +     G+VV+ DE Y
Sbjct: 167 ----LMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLVVV-DEAY 204

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 13/106 (12%)

Query: 266 CQGPKTGVLIPIPQYPLYTATLALNNSHAL--PYYLDEKSGWSTNPKEIEEVVQDAMERA 323
           C   K  +L+  P Y +Y+    +N+   +  P  + + S +  N + +  ++ +     
Sbjct: 108 CVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS-FQMNTEAVLTILNN----- 161

Query: 324 INP--SVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
            +P   ++   +PGNPTGA +    IE + +     GIVV+ DE Y
Sbjct: 162 -DPLIKIMFATSPGNPTGAKIKTCLIEEVLQ-KWDNGIVVV-DEAY 204

>KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.102
           YHR137W
          Length = 523

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 70/172 (40%), Gaps = 23/172 (13%)

Query: 217 YSASQGVYGIRKTVANFITERDGGEPAYPE-DIFLTVWCFRCCCYLLSILCQGPKTGVLI 275
           YSA++G+  +     +F+ +R G  P Y   D  L          +  IL     T VL+
Sbjct: 115 YSATEGLDPLLNFTKSFL-QRIGNTPLYNGWDTILANGSSDSLYKVFDILADR-NTTVLV 172

Query: 276 PIPQYPLYTATLALNNSHALPY--YLDE-KSGWSTNPKEIE--------EVVQDAMER-A 323
               +     T+    +H +P    LDE  S    N K+ +        E + D +E  A
Sbjct: 173 EEFTFVPVVGTILGTGAHIVPMKLNLDEVTSDNFNNDKQFDPNHEGIDVEYLADLLENWA 232

Query: 324 INPS--------VLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVY 367
           + P         +  V+   NPTG  L+ E    I+ +A ++  +++ D+ Y
Sbjct: 233 VGPHKHLPKPTLMYTVVTGQNPTGVSLSYEKRRQIYALAQRHNFIIVEDDPY 284

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,641,725
Number of extensions: 2461425
Number of successful extensions: 6607
Number of sequences better than 10.0: 132
Number of HSP's gapped: 6762
Number of HSP's successfully gapped: 132
Length of query: 588
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 473
Effective length of database: 40,294,809
Effective search space: 19059444657
Effective search space used: 19059444657
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)