Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B019808.260ON29592959152220.0
NCAS0B050108.260ON2952296998080.0
Smik_12.1468.260ON2958297387480.0
YLR087C (CSF1)8.260ON2958296787220.0
Suva_10.1718.260ON2958296986220.0
Skud_12.1558.260ON2959296886160.0
KAFR0B027208.260ON2982299883080.0
KNAG0G020308.260ON2998301081190.0
TDEL0F038708.260ON2942298176530.0
CAGL0L12210g8.260ON2981299675320.0
ZYRO0C01694g8.260ON3006304168540.0
Kpol_392.78.260ON2995302166260.0
TBLA0E044208.260ON3148257260400.0
TPHA0J007308.260ON3046305859220.0
SAKL0H17072g8.260ON2997302656980.0
KLTH0G13728g8.260ON2966303449530.0
Kwal_YGOB_56.238088.260ON2941302847150.0
Kwal_56.23810singletonOFF2763283043850.0
Ecym_43108.260ON2943157821900.0
KLLA0F19096g8.260ON2923158120380.0
AGR088W8.260ON2887151219700.0
Kwal_56.23808singletonOFF62601417e-10
CAGL0D00352g4.287ON86156784.9
TBLA0I015702.559ON1285103777.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B01980
         (2959 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  5868   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  3782   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  3374   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  3364   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  3325   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  3323   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  3204   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  3132   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  2952   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  2905   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  2644   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  2556   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  2331   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  2285   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  2199   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1912   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1820   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  1693   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...   848   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   789   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...   763   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    59   7e-10
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    35   4.9  
TBLA0I01570 Chr9 (342266..346123) [3858 bp, 1285 aa] {ON} Anc_2....    34   7.2  

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 5868 bits (15222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2854/2959 (96%), Positives = 2854/2959 (96%)

Query: 1    MDAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRS 60
            MDAISQFQRIPLTKQKDFSWVFLVDW              SRTLAYGISFILEWFLWKRS
Sbjct: 1    MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRS 60

Query: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120
            NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD
Sbjct: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120

Query: 121  KASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSKA 180
            KASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSKA
Sbjct: 121  KASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSKA 180

Query: 181  XXXXXXXXXXXXXXXXAGTFKSDSSTTNDRVFQEELSERPQFLDFLPIDFKVSHGSLIIG 240
                            AGTFKSDSSTTNDRVFQEELSERPQFLDFLPIDFKVSHGSLIIG
Sbjct: 181  EVSNSESNSEEDTFESAGTFKSDSSTTNDRVFQEELSERPQFLDFLPIDFKVSHGSLIIG 240

Query: 241  NKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMKF 300
            NKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMKF
Sbjct: 241  NKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMKF 300

Query: 301  KIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFGKSX 360
            KIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFGKS 
Sbjct: 301  KIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFGKSN 360

Query: 361  XXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNSGA 420
                      ANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNSGA
Sbjct: 361  DDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNSGA 420

Query: 421  PPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFKXX 480
            PPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFK  
Sbjct: 421  PPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFKTT 480

Query: 481  XXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPTKE 540
                    WRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPTKE
Sbjct: 481  ISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPTKE 540

Query: 541  GFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLEAF 600
            GFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLEAF
Sbjct: 541  GFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLEAF 600

Query: 601  ILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDFN 660
            ILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDFN
Sbjct: 601  ILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDFN 660

Query: 661  ENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKEV 720
            ENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKEV
Sbjct: 661  ENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKEV 720

Query: 721  GRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFFH 780
            GRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFFH
Sbjct: 721  GRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFFH 780

Query: 781  FVTSEEYTGEIRANEVQNQFTDRQLYEDKAXXXXXXXXXXXXVRKEQTGDSKIKRSDLKR 840
            FVTSEEYTGEIRANEVQNQFTDRQLYEDKA            VRKEQTGDSKIKRSDLKR
Sbjct: 781  FVTSEEYTGEIRANEVQNQFTDRQLYEDKASLSSYESIETSSVRKEQTGDSKIKRSDLKR 840

Query: 841  ATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDISL 900
            ATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDISL
Sbjct: 841  ATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDISL 900

Query: 901  RRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLGTL 960
            RRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLGTL
Sbjct: 901  RRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLGTL 960

Query: 961  DLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESEMD 1020
            DLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESEMD
Sbjct: 961  DLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESEMD 1020

Query: 1021 TFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLFEFETKVNLSNF 1080
            TFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLFEFETKVNLSNF
Sbjct: 1021 TFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLFEFETKVNLSNF 1080

Query: 1081 EKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGXXXXXXXXXXXXXX 1140
            EKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFG              
Sbjct: 1081 EKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGSIAPSSSLPPLPIP 1140

Query: 1141 XXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTESDEELDPLEFK 1200
                TIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTESDEELDPLEFK
Sbjct: 1141 LLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTESDEELDPLEFK 1200

Query: 1201 TETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQILDDIEIGIVNH 1260
            TETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQILDDIEIGIVNH
Sbjct: 1201 TETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQILDDIEIGIVNH 1260

Query: 1261 LSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLEENNETKITEV 1320
            LSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLEENNETKITEV
Sbjct: 1261 LSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLEENNETKITEV 1320

Query: 1321 TFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSADITID 1380
            TFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSADITID
Sbjct: 1321 TFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSADITID 1380

Query: 1381 EAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHDPYVIT 1440
            EAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHDPYVIT
Sbjct: 1381 EAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHDPYVIT 1440

Query: 1441 KPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDPGNAFI 1500
            KPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDPGNAFI
Sbjct: 1441 KPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDPGNAFI 1500

Query: 1501 SVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVYSTGYEVEH 1560
            SVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVYSTGYEVEH
Sbjct: 1501 SVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVYSTGYEVEH 1560

Query: 1561 NFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKKLLPELSMKKN 1620
            NFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKKLLPELSMKKN
Sbjct: 1561 NFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKKLLPELSMKKN 1620

Query: 1621 LKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPKDLASKAISMT 1680
            LKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPKDLASKAISMT
Sbjct: 1621 LKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPKDLASKAISMT 1680

Query: 1681 VYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCTDIHFRAMTATDVL 1740
            VYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCTDIHFRAMTATDVL
Sbjct: 1681 VYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCTDIHFRAMTATDVL 1740

Query: 1741 AKSVGXXXXXXXXXXXXFYXXXXXXXXXXXXYPVMEQKINMVLTCYFTNVNLEIMPLSPF 1800
            AKSVG            FY            YPVMEQKINMVLTCYFTNVNLEIMPLSPF
Sbjct: 1741 AKSVGEIIENIKELEKLFYSDSDSGIQQISQYPVMEQKINMVLTCYFTNVNLEIMPLSPF 1800

Query: 1801 SFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLKGNILENPN 1860
            SFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLKGNILENPN
Sbjct: 1801 SFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLKGNILENPN 1860

Query: 1861 YTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLKLFQRKKPAPSTEKSGR 1920
            YTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLKLFQRKKPAPSTEKSGR
Sbjct: 1861 YTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLKLFQRKKPAPSTEKSGR 1920

Query: 1921 TVTWSLESNINYFGLLVPISSTYFILELHMLLMSLNKIQGISSKYNGLSGQFSIDNVCFL 1980
            TVTWSLESNINYFGLLVPISSTYFILELHMLLMSLNKIQGISSKYNGLSGQFSIDNVCFL
Sbjct: 1921 TVTWSLESNINYFGLLVPISSTYFILELHMLLMSLNKIQGISSKYNGLSGQFSIDNVCFL 1980

Query: 1981 LKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQAL 2040
            LKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQAL
Sbjct: 1981 LKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQAL 2040

Query: 2041 TNIRYYKEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFCVGWLFSPEFDNEPGLI 2100
            TNIRYYKEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFCVGWLFSPEFDNEPGLI
Sbjct: 2041 TNIRYYKEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFCVGWLFSPEFDNEPGLI 2100

Query: 2101 IGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLK 2160
            IGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLK
Sbjct: 2101 IGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLK 2160

Query: 2161 NEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQST 2220
            NEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQST
Sbjct: 2161 NEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQST 2220

Query: 2221 TQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKY 2280
            TQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKY
Sbjct: 2221 TQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKY 2280

Query: 2281 NEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVKRHSSDREPSGTNISKQ 2340
            NEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVKRHSSDREPSGTNISKQ
Sbjct: 2281 NEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVKRHSSDREPSGTNISKQ 2340

Query: 2341 NIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIF 2400
            NIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIF
Sbjct: 2341 NIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIF 2400

Query: 2401 ALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQL 2460
            ALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQL
Sbjct: 2401 ALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQL 2460

Query: 2461 QNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGD 2520
            QNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGD
Sbjct: 2461 QNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGD 2520

Query: 2521 VDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISE 2580
            VDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISE
Sbjct: 2521 VDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISE 2580

Query: 2581 VNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDL 2640
            VNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDL
Sbjct: 2581 VNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDL 2640

Query: 2641 LKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKD 2700
            LKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKD
Sbjct: 2641 LKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKD 2700

Query: 2701 ILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQ 2760
            ILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQ
Sbjct: 2701 ILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQ 2760

Query: 2761 VYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDI 2820
            VYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDI
Sbjct: 2761 VYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDI 2820

Query: 2821 LEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKRIK 2880
            LEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKRIK
Sbjct: 2821 LEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKRIK 2880

Query: 2881 KEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVH 2940
            KEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVH
Sbjct: 2881 KEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVH 2940

Query: 2941 TAEKEYGSILGHSQAKNTN 2959
            TAEKEYGSILGHSQAKNTN
Sbjct: 2941 TAEKEYGSILGHSQAKNTN 2959

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 3782 bits (9808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1818/2969 (61%), Positives = 2254/2969 (75%), Gaps = 33/2969 (1%)

Query: 1    MDAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRS 60
            MDA+SQFQ +PLT+Q++FSW+FLV W               RT+AY I+FILEW LWK +
Sbjct: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60

Query: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120
             VK+NI+S+RIS LGGR+FFKNV IIH+D TIS LE N+TWRYWL N RK  +    + +
Sbjct: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120

Query: 121  -KASANSVK---LPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFT 176
             +    S+K   LPCRF +  EGLEIF+YN+ VAYDNII  FSKEER QFEKFLNEQ+ +
Sbjct: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILS 180

Query: 177  DSKAXXXXXXXXXXXXXXXXAGTFKSDSSTTNDRVFQEELSERPQFLDFLPIDFKVSHGS 236
            DS                    T KS+SS TNDRVFQEE ++   FL FLPI F V+ GS
Sbjct: 181  DSATVKSMDDSQFDTSES--TSTDKSESSATNDRVFQEEETDTSSFLRFLPIQFLVTRGS 238

Query: 237  LIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEF 296
            LI+GNKFTPSL+I S  S   ++D  QP EKLDLYK +   +       +KQNIGF+E+ 
Sbjct: 239  LILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFDEDV 298

Query: 297  SMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIF 356
            SMKFK+DR +VS++W  F ++L   Y  ++ +H+   K   ED F  KWRGL+LY+GT  
Sbjct: 299  SMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKGTGL 358

Query: 357  GKSXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVG 416
            G+            ANHEYAKFSSI+++P+  FT + D+PGIVPHGAHPT++  DGPDVG
Sbjct: 359  GERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGPDVG 418

Query: 417  NSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQ 476
            NSGAPP++SL+IQI GGS+CFGPWAQRQ + L +LLSP+ SR AKP KRLTPGC RIYT 
Sbjct: 419  NSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRIYTY 478

Query: 477  FKXXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQC 536
             +          WRIPTRESSKD EFLQHYRETN EYRPFGWIDLKFSK+T + +T A C
Sbjct: 479  GQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTFALC 538

Query: 537  PTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQ 596
            PT +GFKN + IHL +NE RSSVNHDILLKCK F+F +D  FPLGWN+EATWTI+L S+Q
Sbjct: 539  PTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLNSSQ 598

Query: 597  LEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNP 656
            +EAFILREHITLIADTLTDFSSGEPTPYELFRPF+Y INWKI+GYSLYLNVNDHNIVNNP
Sbjct: 599  MEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIVNNP 658

Query: 657  LDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMK 716
            LDFNENCYLSFHGD L +D ++PK  ++A  T++SYTI TPMFRL+LNTPPWNTLNEFMK
Sbjct: 659  LDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPPWNTLNEFMK 718

Query: 717  NKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFG 776
            +KEVGRS+DFK+ GSYLIYS+LDIDNVDTI+++C+S+ T LQCYGFV+RYL NVKMNYFG
Sbjct: 719  HKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMNYFG 778

Query: 777  DFFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKAXXXXXXXXXXXXVRKEQTGDSKIKRS 836
            DFFHFVTSEEYTG IRANE   Q+      +  +              + +   ++++RS
Sbjct: 779  DFFHFVTSEEYTGAIRANEDDMQYASESDDDRSSISSFDTMQGNDAPGRRRL-HTELQRS 837

Query: 837  DLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMN 896
            DLKR TNETDLWFTFTVWEGA+LLPETIYNCDPC+GLHFGEL+ID RSCNYYMDLLA+MN
Sbjct: 838  DLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLANMN 897

Query: 897  DISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFS 956
            D+S++RY+ K  +EI+E++ ++NG     +GSLS + IH HRMYGLPP+EPTYFCQWDF 
Sbjct: 898  DVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWDFD 957

Query: 957  LGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRE 1016
            LGTLD+  DI FL GF +SF +I FG VDLENILLYEKE  DDMTS+TV+++K+S+M++E
Sbjct: 958  LGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVMLQE 1017

Query: 1017 SEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPI--FNLFMYTMNGAKKEKLFEFETK 1074
             +++ +       LYF+ I+FENEKY TRLDL IP   F+LF+   +G  K KLF  ETK
Sbjct: 1018 PKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTK-KLFTLETK 1076

Query: 1075 VNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGXXXXXXXX 1134
            V ++NF +  D   H+  Q+EYI LHDAPYHRC+FILP   QD+E YQ+LFG        
Sbjct: 1077 VKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAPSSSL 1136

Query: 1135 XXXXXXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTESDEEL 1194
                      T D+I++DLLG F ++LE+ +PFR+PFS           + SD E++E++
Sbjct: 1137 PPLPVPLIPSTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYAT-----DVSDDETEEDI 1191

Query: 1195 DPLEFKTETSG-DSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQILDDI 1253
            DPLEF T +    ++    D+F+ID+S+ S+ I P +   +      F +++IVQI+DDI
Sbjct: 1192 DPLEFNTPSEAIQNDKCERDSFIIDVSFISIEICPDILDSIGTFLMLFSTENIVQIIDDI 1251

Query: 1254 EIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLEENN 1313
            EI  VN LS+L+EG     N+K+ ILYLDLFWG R + G+ +YLDRID  MC+K +EEN 
Sbjct: 1252 EIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVEENK 1311

Query: 1314 ETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNIL 1373
            E K+ E+T LNKIRSVR T+N+ ++  K +ERPPALSLVIEG EIWS     QVNSLNIL
Sbjct: 1312 EKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNIL 1371

Query: 1374 SADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQIS 1433
            S DIT+DEAQ++WLF Y D Q    Q++     +IQ+ +  +RK+L+S L  ASEYYQIS
Sbjct: 1372 STDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQIS 1431

Query: 1434 HDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQ-QDSHTL 1492
            HDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLP DW   I+    Q + + T 
Sbjct: 1432 HDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAATT 1491

Query: 1493 PDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVY 1552
             D    FISVFSNWRNWEFSDIARSYIYR +F   HS ++ ++ + SI +K+AS F TVY
Sbjct: 1492 QDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHTTKKSITIKIASFFVTVY 1551

Query: 1553 STGYEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKKLL 1612
            S GYEVEHNFI+TRTN+++ET    SDSS+ +E I N+TG+LGT KGK S K+I +K LL
Sbjct: 1552 SAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSDKIIMIKNLL 1611

Query: 1613 PELSMKKN--LKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPK 1670
            P L +      K +  F++ FKLN L+L ER ELQ  +G ++++SRVFG +LSMLWESPK
Sbjct: 1612 PSLKITDGGKSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLSMLWESPK 1671

Query: 1671 DLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCTDIH 1730
            DL S+A+S+ VY QR+E+ +KH N  LAE Q+R+FS+I+T ESWSYKPT+LVN QC+D+H
Sbjct: 1672 DLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSDLH 1731

Query: 1731 FRAMTATDVLAKSVGXXXXXXXXXXXXFYXXXXXXXXXXXXYPVMEQKINMVLTCYFTNV 1790
              AMTATD+L  S+                               + K+N +LTC+FTN+
Sbjct: 1732 LMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVNTILTCFFTNI 1791

Query: 1791 NLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQ 1850
            + E+MP+SPF  RH AKQLDIYFNR GSN+++LSVWD D++L SHLTK++YFRFSFG++Q
Sbjct: 1792 SFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGDLQ 1851

Query: 1851 LKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLKLF---- 1906
            LKGN++ +P Y IN+ +SASI+KLT+ D+++LIPSFLQDEKIL ES+E F +L LF    
Sbjct: 1852 LKGNMVNDP-YHINLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGLSK 1910

Query: 1907 -QRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSLNKIQGISSKY 1965
             Q+ KP    EK     +WS+++NINYFGLL PI S YF+ EL MLL SL K+       
Sbjct: 1911 NQKSKP----EKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSDIPNQ 1966

Query: 1966 NGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLS 2025
            + +SGQFS++NV F +KE++LP  LSK+LDFSIKVS LQK K T  ++QIES HFRVCLS
Sbjct: 1967 SDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLS 2026

Query: 2026 PGSLAHMLWRGNQALTNIRYYKE-HTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFC 2084
            P SL  +LW  NQ  T+I+YYK+ H    W+      N   + ++  + PSFH+LSYNFC
Sbjct: 2027 PESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNFC 2086

Query: 2085 VGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDR 2144
            VGWLFS +  +EPGLI+GY+RLFSAYEKN GKLTL+D +FS+ANG +SD FFS+G EKD+
Sbjct: 2087 VGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDK 2146

Query: 2145 YNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKR 2204
            YNRSYLPNMQISYW K+ G +RD+++RFHGEALDV FL+S++DVIES+L S+Q FQELK+
Sbjct: 2147 YNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKK 2206

Query: 2205 DLVGTASNIKEQTQSTTQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPS 2264
            DL+      ++     T E +  +SPF   IRSI+CQF+YDGGVFK+FS  +A    +PS
Sbjct: 2207 DLIPGLPKKQKVNDDKTLE-LNTLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPS 2265

Query: 2265 FEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVK 2324
            FE+ SPNV+ID+NYK+ E +T+   WIR+LI INSTHN L+AKCAPL+++F E IQ MVK
Sbjct: 2266 FEVNSPNVVIDLNYKHLENRTKQ-HWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVK 2324

Query: 2325 RHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFT 2384
            +HSS  E + +  S QN+DYKR+LDSFD+A+++ SAKQ LSL CEP+AKVQADIGFQSF 
Sbjct: 2325 KHSSSEESTLSKPSSQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFI 2384

Query: 2385 FTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILG 2444
            FTVTTND D  EPL F+LSVEKTEASIKHIFSRE STS GVDF+D+T+MFTHP+ IN+ G
Sbjct: 2385 FTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHG 2444

Query: 2445 TGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDTDS 2504
            T LIS++++FFNVKQLQNLYLFLDIW+LS+LL SKP N++VK++TD  SLS  Q  D +S
Sbjct: 2445 TALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTD-SSLSIAQLSDPES 2503

Query: 2505 TIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSKG 2564
             IPWCFTLIF+N+ GDVDLGP+LGV+S+  KRTWFATDHYK+ RKVLHA+T G +L+SKG
Sbjct: 2504 IIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKG 2563

Query: 2565 RLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNID 2624
            RLSGI EL GASWISEVNWP    IN +PLVSI++NID + TK AFDYHMFL+GAINN  
Sbjct: 2564 RLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTR 2623

Query: 2625 VHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIETL 2684
            VH+HSEKD+NG+ PDLLKV  +CE+I LCSTALVAANILDIYNT MR+RQDNKISYIETL
Sbjct: 2624 VHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETL 2683

Query: 2685 KESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISAR 2744
            +ESN +E +  ++Y DILRSLNL+QTDVSVDIYTLNIQISPI+LFD E+LV+ IE+ISAR
Sbjct: 2684 RESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISAR 2743

Query: 2745 SETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAP 2804
            SETH+G KL TELEMQVYDASV+LSTSKEE+DE  ++ ISV++Y+ YA +I GG IIE P
Sbjct: 2744 SETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIP 2803

Query: 2805 RLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQID 2864
            +LL++MTT+Q+EKSDILEYLYTC F DK+SVRWNLGP+NFIKEMW TH+RA+AVRRSQ+ 
Sbjct: 2804 KLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVV 2863

Query: 2865 VTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFP 2924
                  SEEDV KRIK+EE FSRF+YV LE PRIDMPQIRDLGDATPP+EWFG+NRKRFP
Sbjct: 2864 GVLDGQSEEDVEKRIKEEENFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFP 2923

Query: 2925 AFTHQTAVILVQKLVHTAEKEYGSILGHS 2953
            AFTHQTAV LVQKLV++AE+EY +ILG S
Sbjct: 2924 AFTHQTAVFLVQKLVYSAEREYANILGSS 2952

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 3374 bits (8748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1608/2973 (54%), Positives = 2162/2973 (72%), Gaps = 42/2973 (1%)

Query: 1    MDAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRS 60
            M+A+SQ + +PLT QKDFSWVFLVDW               R  AY +SFILEW LWKR+
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120
             VKIN+E++R+S LGGR+ FK++ +IH+DYTIS LE ++TW+YWLLN RK+     EL D
Sbjct: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKA-----ELID 115

Query: 121  K---ASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTD 177
                 S N+VKLPC+F LE EGLEIF+YNR VAYDN+I   SK+ER++FEK+LNE  F +
Sbjct: 116  NNKSPSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE 175

Query: 178  SKAXXXXXXXXXXXXXXXXAGTFKSDSSTTNDRVFQE-ELSERPQFLDFLPIDFKVSHGS 236
              +                A T  SD+S  NDR +QE ++ + PQFL FLPI+   S GS
Sbjct: 176  PFSDGSSADKLDEDLSES-AYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGS 234

Query: 237  LIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEF 296
            L++GNKFTPS+MI S  S  G++DV  P E++DLY+ +  ++FK F I IKQNIG+++  
Sbjct: 235  LLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAI 294

Query: 297  SMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIF 356
             +KFK+D  +VSK+W+ F +VL      +     + N  S  D FY+KW+GLSLY+ T  
Sbjct: 295  GLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSG 354

Query: 357  GKSXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVG 416
                           NHEYAKF+SI++ P+   +++ D+PG+VPHGAHPT++  DGPDVG
Sbjct: 355  EAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVG 414

Query: 417  NSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQ 476
            N+GAPP+F+L++QI GGSIC+GPWAQRQ++ L R+LSP+ SR AKP K+L PG  R+YT 
Sbjct: 415  NNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTL 474

Query: 477  FKXXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQC 536
            F+          WRIPTRE+SKD EFLQHY+ET+EEYRPFGW+DL+F KDTY    ++ C
Sbjct: 475  FRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVC 534

Query: 537  PTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQ 596
            PT EGF+N   +H  + EIRSSVNHDILLK K FN   DIG+PLGWN +A W I+++S Q
Sbjct: 535  PTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQ 594

Query: 597  LEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNP 656
            LEAF+LREHITL+ADTL+DFS+G+PTPYELFRPFVY++NW++ GYS+YLNVNDHNIVNNP
Sbjct: 595  LEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNP 654

Query: 657  LDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMK 716
            LDFNENCYLS HGD L ID+ VP+  +   +T++SY I TPMFR++LNTPPWNTLNEFMK
Sbjct: 655  LDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMK 714

Query: 717  NKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFG 776
            +KEVGR++DF I G+YL+YSELDIDNVDT++IEC+S STVL CYGFV+RYLTNVKMNYFG
Sbjct: 715  HKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFG 774

Query: 777  DFFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKAXXXXXXXXXXXXVRKEQTGDSKIKRS 836
            +FF+FVTSEEYTG + A +V +  T   + +               V+        +KRS
Sbjct: 775  EFFNFVTSEEYTGVLGARDVGDVTTKSSVVD--LASTVDSGYQNSSVKNNSEAKGPMKRS 832

Query: 837  DLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMN 896
            DLKR TNETD+WFTF+VW GA++LPETIY+ DPCI LHF EL++DFRSCNYYMD++A ++
Sbjct: 833  DLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLD 892

Query: 897  DISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFS 956
              S++R++ KQ NE+++ +R++NG   +++GSLSD+ IH HRMYGLPP EPTYFCQWD +
Sbjct: 893  GTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDIN 952

Query: 957  LGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRE 1016
            LG L ++ D+ F++GF +SF KI FG  DLENILLY+ E IDDMTSLTV  ++I I + +
Sbjct: 953  LGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLED 1012

Query: 1017 SEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLF-EFETKV 1075
              M +  + +AE + F+ I+FENE Y  R+D+++P   + +  + G   +  F +FETK+
Sbjct: 1013 PVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFETKL 1072

Query: 1076 NLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGXXXXXXXXX 1135
              +NFE+  DI   +S+Q++YIT HD+PYHRC+F+LP   QDS+ YQ L+G         
Sbjct: 1073 RFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGAIAPSSSIP 1132

Query: 1136 XXXXXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTE--SDEE 1193
                     TID+I++D++G +  +LE+ NPF+  F  A +P    P + S TE  +DEE
Sbjct: 1133 TLPLPTLPDTIDFIIEDIVGEYATLLEAANPFKDSF--AETPSTVEPSKASFTEDDNDEE 1190

Query: 1194 LDPLEFKTET---SGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQIL 1250
                 FK       GD E    DN+V+D+SY  L I+P L+ +  +  E   S+++VQ+L
Sbjct: 1191 ASSSGFKPGAFTEDGDDE---KDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVL 1247

Query: 1251 DDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLE 1310
            DDIEIGIV  LS+LQEGI +  NI + I YL+L W +    G  LYLDRID +M +K LE
Sbjct: 1248 DDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLE 1307

Query: 1311 ENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSL 1370
            +N  TK+ EV  L ++++VR T+N+  +   +++RPPALSL +EG EIWS     QVNSL
Sbjct: 1308 KNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSL 1367

Query: 1371 NILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYY 1430
            N+ S+DITIDE+Q++WLFQY   Q  L QE+A++  SIQ++R++++ +L+S+L  ASEYY
Sbjct: 1368 NLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYY 1427

Query: 1431 QISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSH 1490
            QISHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP DW   ID++  ++   
Sbjct: 1428 QISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYT 1487

Query: 1491 TLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFT 1550
            +  D  N F+SVFS WRNWEFSD+ARSYIY  +FS  + K ++N ++  +K  + S + T
Sbjct: 1488 SANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLT 1547

Query: 1551 VYSTGYEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKK 1610
            VY  GYEVEHNF++   N+VV+  P ++  S+ +E+ I +TG +G++KGK S +L+ L+ 
Sbjct: 1548 VYGEGYEVEHNFVVADANLVVDLTPPVTSLSLNREETIEITGRIGSVKGKFSDRLLKLQD 1607

Query: 1611 LLPELSM---KKNLKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWE 1667
            L+P ++         P T   + F++N +LL ++SELQ V+  +K+MSR  GG++S+LWE
Sbjct: 1608 LIPLVAAVGEDDKSDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWE 1667

Query: 1668 SPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCT 1727
            + KD  S+A S+ +++Q+SE+W+KH +IIL E+Q+R+FSI+ T E+WS+KPT+L+N QC 
Sbjct: 1668 NLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCA 1727

Query: 1728 DIHFRAMTATDVLAKSVGXXXXXXXXXXXXFYXXXXXXXXXXXXYPVMEQKINMVLTCYF 1787
            D+HFRAM++T+    ++                              + QKIN VLTCYF
Sbjct: 1728 DLHFRAMSSTEQTVTAITEIRESALKIKERIKFKPKSKKKSQ----FVGQKINTVLTCYF 1783

Query: 1788 TNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFG 1847
            +NV+ EIMPLSPF  RH AKQLDIYFN+ GSN++++S+WDTD F+ SH TKE+Y RFSFG
Sbjct: 1784 SNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFG 1843

Query: 1848 NIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLK--L 1905
            +I++KG + +     IN+D+S S++KLT  + RR++ SFLQDEK+  + +    SLK   
Sbjct: 1844 DIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLCSLKSLF 1903

Query: 1906 FQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSL-NKIQGISSK 1964
            F    P    +     + W+L+++I+YFG+L+P++STYF+ ELHMLL+SL N   G+  +
Sbjct: 1904 FSSNIPKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPE 1963

Query: 1965 YNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCL 2024
               ++GQFSI+N+ FL+KE+SLP  LSK+LDFSIKVSTLQ+   T +SFQ+ES HFRVCL
Sbjct: 1964 ETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCL 2023

Query: 2025 SPGSLAHMLWRGNQALTNIRYY-KEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNF 2083
            SP SL  ++W  ++ L    YY K H    W   +    ++   E+  +F S H+LSY F
Sbjct: 2024 SPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFRSIHILSYKF 2083

Query: 2084 CVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKD 2143
            C+GWLF     ++PGL++GY+RLFSAYE++FGK T++D++FSVANG TS TFFS+G+EKD
Sbjct: 2084 CIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKD 2143

Query: 2144 RYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELK 2203
            +YNRS+LPNMQISYW K  G L+D + RFHGEALDVNF+ SF+DVI+S+L+S++ FQELK
Sbjct: 2144 KYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELK 2203

Query: 2204 RDLVGTASNIKEQ-----TQSTTQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEAS 2258
            R+++  + N   +       S+ +     ++PF   IRS+N  F+YDGGVF+V++  +  
Sbjct: 2204 RNILDVSENSHSEDSNIYAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIE 2263

Query: 2259 NHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEG 2318
               +PSFEIKSP V I+  YK++E K + P  IRTLIT++ THNTL+A CAPL+ EFSE 
Sbjct: 2264 AKSEPSFEIKSPVVTINCTYKHDEDKVR-PHKIRTLITVDPTHNTLYAGCAPLLMEFSES 2322

Query: 2319 IQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADI 2378
            +QKM+K+HS+D +P+ T  S QN+DYKR+LD FDVAV++ SAKQ LSL CEP+AKVQAD+
Sbjct: 2323 LQKMIKKHSTDEKPNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADV 2382

Query: 2379 GFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPN 2438
            GF+SF F+VTTN++D E PL F+L++E T+ASIKHIFSRE STSF V F+DLT++FTHP+
Sbjct: 2383 GFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPD 2442

Query: 2439 SINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQ 2498
             I++ G GL+SD++VFFNVKQLQNLYLFLDIW+ S++L+++P    V    D+ SL+S  
Sbjct: 2443 VISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTS 2502

Query: 2499 SKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGI 2558
              D  + IPWCFTLIF+N++GDVDLGP+LGV+SL  +RTW ATDHY   R++LHA+T GI
Sbjct: 2503 HVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGI 2562

Query: 2559 TLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVG 2618
            +LTS+GRLSG+ E+  ASW+SEV W   +  N +PLVS SLNID +  K AFDYHMFL+G
Sbjct: 2563 SLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIG 2622

Query: 2619 AINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKI 2678
             INNI   +H+EKD  G+ PDLL+V+   + I L STALVAANILDIYNT++R+RQDNKI
Sbjct: 2623 TINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKI 2682

Query: 2679 SYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNI 2738
            SY+ETL++SN  E RQ + YKDILRSL L++TD+SV I +L +QISPISLFD E+LVV I
Sbjct: 2683 SYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRI 2742

Query: 2739 ENISARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGG 2798
            + +S RSETH+G KLKT+L++QV D S ALSTSKEELDE++ A+I+++DYMHYA +I GG
Sbjct: 2743 DKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGG 2802

Query: 2799 VIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAV 2858
             II+ P+L + MTT Q+EK++ LEYL+ CSF DKISVRWNLGPVNFIKEMW THV+A+AV
Sbjct: 2803 TIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAV 2862

Query: 2859 RRSQI-DVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFG 2917
            RRSQI +++FG  +EE++ + I KEE  S+F Y+ LEEP+I++PQIRDLGDATPP+EWFG
Sbjct: 2863 RRSQIANISFGQ-TEEELEESINKEETASKFNYIALEEPQIEVPQIRDLGDATPPMEWFG 2921

Query: 2918 LNRKRFPAFTHQTAVILVQKLVHTAEKEYGSIL 2950
            +NRKRFP FTHQTAVI VQKLV+ AEK+Y  IL
Sbjct: 2922 VNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 3364 bits (8722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1598/2967 (53%), Positives = 2160/2967 (72%), Gaps = 30/2967 (1%)

Query: 1    MDAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRS 60
            M+AISQ + +PLT QKDFSWVFLVDW               R  AY +SFILEW LWKR+
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120
             +KIN+E++R+S LGGR+ FKN+ +IH+DYTIS LE ++TW+YWLLN RK+  +  E   
Sbjct: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKA--ELIENNK 118

Query: 121  KASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSKA 180
             +S    KLPC+  +E EGLEIF+YNR VAYDN+I   SK+ER++FEK+LNE  F +  +
Sbjct: 119  SSSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFS 178

Query: 181  XXXXXXXXXXXXXXXXAGTFKSDSSTTNDRVFQE-ELSERPQFLDFLPIDFKVSHGSLII 239
                            A T  SD+S  NDR +QE ++ + P+ L FLPI+ K S GSL++
Sbjct: 179  DGSSADKLDEDLSES-AYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLL 237

Query: 240  GNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMK 299
            GNKFTPS+MI S  S  G+IDV  P E+LDLY+ +  ++FK F I IKQNIG+++   +K
Sbjct: 238  GNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLK 297

Query: 300  FKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFGKS 359
            FKIDR +VSK+W+ F +V       +     + +  + +D FY KW+GLSLY+ +     
Sbjct: 298  FKIDRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDNFYHKWKGLSLYKASAGDAK 357

Query: 360  XXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNSG 419
                        NHEYAKF+SI++ P+    ++ D+PG+VPHGAHPT+   DGPDVGN+G
Sbjct: 358  ASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNG 417

Query: 420  APPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFKX 479
            APP+F+L++QI GGSIC+GPWAQRQ++ L R+LSP+ SR AKP K+L PG  RIYT F+ 
Sbjct: 418  APPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRM 477

Query: 480  XXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPTK 539
                     WRIPTRESSKDPEFL+HY+ETNEEYRPFGW+DL+F KDTY    ++ CPT 
Sbjct: 478  NISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTV 537

Query: 540  EGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLEA 599
            +GF+N   +H  + EIRSSVNHDILLK K F+   DIG+PLGWN +A W I+++S QLEA
Sbjct: 538  QGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEA 597

Query: 600  FILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDF 659
            F+LREHITL+ADTL+DFS+G+PTPYELFRPFVY++NW++ GYS+YLNVNDHNIVNNPLDF
Sbjct: 598  FLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDF 657

Query: 660  NENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKE 719
            NENCYLS HGD L ID+ VP+  +   +T++SY I TPMFR++LNTPPWNTLNEFMK+KE
Sbjct: 658  NENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKE 717

Query: 720  VGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFF 779
            VGR++DF I GSYL+YSELDIDNVDT++IEC+S+STVL CYGFV+RYLTNVKMNYFG+FF
Sbjct: 718  VGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFF 777

Query: 780  HFVTSEEYTGEIRANEVQNQFTDRQLYEDKAXXXXXXXXXXXXVRKEQTGDSKIKRSDLK 839
            +FVTSEEYTG + A EV +  T   + +               ++ E      +KRSDLK
Sbjct: 778  NFVTSEEYTGVLGAREVGDVTTKSSVAD--LASTVDSGYQNSSLKNESEDKGPMKRSDLK 835

Query: 840  RATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDIS 899
            R TNETD+WFTF+VW+GA++LPETIY+ DPCI LHF EL++DFRSCNYYMD++A +N  S
Sbjct: 836  RTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTS 895

Query: 900  LRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLGT 959
            ++R++ KQ NE+++ +R++NG   +++G LSD+ IH HRMYGLPP EPTYFCQWD +LG 
Sbjct: 896  IKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGD 955

Query: 960  LDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESEM 1019
            L ++ DI F++GF  SF KI FG  DLENILLY+ E I+DMTSLTV V+KI I +++  M
Sbjct: 956  LCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVM 1015

Query: 1020 DTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLF-EFETKVNLS 1078
             +  + +AE + F+ I+FENEKY  R+D++IP   + +  + G   +  F +FETK+  +
Sbjct: 1016 KSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFETKLRFT 1075

Query: 1079 NFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGXXXXXXXXXXXX 1138
            NFE+  DI   +S+Q+ YIT+HD+PYHRC F+LP   QDS+ YQ+L+G            
Sbjct: 1076 NFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGAIAPSSSIPTLP 1135

Query: 1139 XXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTE--SDEELDP 1196
                  TIDYI++D++G +  +LE+ NPF+  F  A +P    P   S +E  +DEE DP
Sbjct: 1136 LPTLPDTIDYIIEDIVGEYATLLETTNPFKNIF--AETPSTMEPSRASFSEDDNDEEADP 1193

Query: 1197 LEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQILDDIEIG 1256
              FK     +      DN+V+D+SY  L ++P L+ +  +  E   S+++VQ+LDDIEIG
Sbjct: 1194 SSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIG 1253

Query: 1257 IVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLEENNETK 1316
            IV  LS+LQEGI +  NI + I YL+L W +    G  LYLDRID +M +K LE+N   K
Sbjct: 1254 IVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNK 1313

Query: 1317 ITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSAD 1376
            + EV  L K+++VR T+N+  +   +++RPPALSL IEG E+WS   + QVNSLN+ S+D
Sbjct: 1314 LLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSD 1373

Query: 1377 ITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHDP 1436
            ITIDE+Q++WLF+Y   Q  L QE+ ++  SIQ +RS ++ +L+SKL  ASEYYQISHDP
Sbjct: 1374 ITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDP 1433

Query: 1437 YVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDPG 1496
            YVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP DW   IDE+  ++   +  D  
Sbjct: 1434 YVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAK 1493

Query: 1497 NAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVYSTGY 1556
            N F+SVFS WRNWEFSD+ARSYIY  +F+  + K ++N ++  +K  + S + TVY  GY
Sbjct: 1494 NIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGY 1553

Query: 1557 EVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKKLLPELS 1616
            EVEHNF++   N+VV+  P ++     +E+ I +TG +G++KGK S +L+ L+ L+P ++
Sbjct: 1554 EVEHNFVVADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIA 1613

Query: 1617 MKKNLKPSTP---FLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPKDLA 1673
                   S P     + FK+N +LL ++SELQ V+  +K+MSR  GG++S+LWE+ KD  
Sbjct: 1614 AVGEDDKSDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDST 1673

Query: 1674 SKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCTDIHFRA 1733
            S+A S+ +++Q+SE+W+KH ++IL E+Q+R+FS++ T E+WS+KPT+L+N QC D+HFRA
Sbjct: 1674 SQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTILINNQCADLHFRA 1733

Query: 1734 MTATDVLAKSVGXXXXXXXXXXXXFYXXXXXXXXXXXXYPVMEQKINMVLTCYFTNVNLE 1793
            M++T+ L  ++                              ++QKIN VL+CYF+NV+ E
Sbjct: 1734 MSSTEQLVTAITEIRESLMMIKERIKFKPKSKKKSQ----FVDQKINTVLSCYFSNVSSE 1789

Query: 1794 IMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLKG 1853
            +MPLSPF  RH AKQLDIYFN+ GSN+++LS+WDTD F+ SH TKE+Y RFSFG+I++KG
Sbjct: 1790 VMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKG 1849

Query: 1854 NILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLK--LFQRKKP 1911
             I       IN+D+S S++KLT  + RR++ SFLQDEK+  + +    SLK   F    P
Sbjct: 1850 GISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLP 1909

Query: 1912 APSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSL-NKIQGISSKYNGLSG 1970
                +     + W+L+++I YFG+LVP++STYF+ ELHMLL+SL N   G+  +   ++G
Sbjct: 1910 KKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTG 1969

Query: 1971 QFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSLA 2030
            QFSI+N+ FL+KE+SLP  LSK+LDFSIKVSTLQ+   T +SFQ+ES HFRVCLSP SL 
Sbjct: 1970 QFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLL 2029

Query: 2031 HMLWRGNQALTNIRYY-KEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFCVGWLF 2089
             ++W  ++ L    YY + H    W   +    ++ S E+  +F S H+LSY FC+GW+F
Sbjct: 2030 RLMWGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIF 2089

Query: 2090 SPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSY 2149
                 + PGL++GY+RLFSAYEK+FGK T++DA+FSVANG TS TFFS+G+EKD+YNRS+
Sbjct: 2090 QYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSF 2149

Query: 2150 LPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLVGT 2209
            LPNMQISYW K  G L+D + RFHGEALDVNF+ SF+DVIES+L+S++ FQELK++++  
Sbjct: 2150 LPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDV 2209

Query: 2210 ASNIKEQTQST-----TQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPS 2264
            + +++ +  ++      +     ++PF   IRS+N  F+YDGGVF+V++  +     +PS
Sbjct: 2210 SESLRAENDNSYASTSVESASSSLAPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPS 2269

Query: 2265 FEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVK 2324
            FEIKSP V I+  YK++E K + P   RTLIT++ THNTL+A CAPL+ EFSE +QKM+K
Sbjct: 2270 FEIKSPVVTINCTYKHDEDKVK-PHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIK 2328

Query: 2325 RHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFT 2384
            +HS+D +P+ T  S QN+DYKR+LD FDVAV++ SAKQ LSL CEP+AKVQAD+GF+SF 
Sbjct: 2329 KHSTDEKPNFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFL 2388

Query: 2385 FTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILG 2444
            F++ TN++D E+PL F+L++E T+ASIKHIFSRE STSF V F+DLT++FTHP+ I++ G
Sbjct: 2389 FSMATNEFDSEQPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYG 2448

Query: 2445 TGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDTDS 2504
            TGL+SD+ VFFNVKQLQNLYLFLDIW+ S++L+++P+   V    ++ SL+S    D  +
Sbjct: 2449 TGLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGT 2508

Query: 2505 TIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSKG 2564
             IPWCFTLIF+N++GDVDLGP+LG++SL  +RTW ATDHY   R++LHA+T GI+LTS+G
Sbjct: 2509 EIPWCFTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEG 2568

Query: 2565 RLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNID 2624
            RLSG+ E+  ASW+SEV WP  ++ N +PLVS SLNID +  K AFDYHMFL+G I+NI 
Sbjct: 2569 RLSGLFEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIH 2628

Query: 2625 VHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIETL 2684
             H+H+EKD  G+ PDLL+V+   + I L STALV ANILDIYNT++R+RQDNKISY+ETL
Sbjct: 2629 FHLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETL 2688

Query: 2685 KESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISAR 2744
            ++SN  E RQ + YKDILRSL L++TD+SV+I +  +QISPISLFD E+LV+ I+ +S R
Sbjct: 2689 RDSNPGESRQPILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIR 2748

Query: 2745 SETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAP 2804
            SETH+G KLKT+L++QV D S ALSTSKEELDE++ A+I+++DYMHYA +I GG II+ P
Sbjct: 2749 SETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIP 2808

Query: 2805 RLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQI- 2863
            +L + MTT Q+EK++ LEYL+ CSF DKISVRWNLGPV+FIKEMW THV+A+AVRRSQ+ 
Sbjct: 2809 KLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVA 2868

Query: 2864 DVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRF 2923
            +++FG  +EE++ + IKKEE  S+F Y+ LEEP+I++PQIRDLGDATPP+EWFG+NRK+F
Sbjct: 2869 NISFGQ-TEEELEESIKKEEAASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKF 2927

Query: 2924 PAFTHQTAVILVQKLVHTAEKEYGSIL 2950
            P FTHQTAVI VQKLV+ AEK+Y  IL
Sbjct: 2928 PKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 3325 bits (8622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1594/2969 (53%), Positives = 2143/2969 (72%), Gaps = 34/2969 (1%)

Query: 1    MDAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRS 60
            M+A+SQ + +PLT QKDFSWVFLVDW               R  AY +SFILEW LWKR+
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120
             +KIN+E++RIS LGGR++FK++ +IH+DYTIS LE ++TW+YWLLN RK+  +  E   
Sbjct: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKA--ELIENEK 118

Query: 121  KASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSKA 180
             +S  +++LPC+F LE EGLE F+YNR +AYDN+I   SK+ER++FEK+LNE  F +  +
Sbjct: 119  NSSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFS 178

Query: 181  XXXXXXXXXXXXXXXXAGTFKSDSSTTNDRVFQE-ELSERPQFLDFLPIDFKVSHGSLII 239
                            A T  SDSS  NDR +QE  + + P+ L F PI+ K++ GSL++
Sbjct: 179  DGSSADKLDEDLSES-AYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLL 237

Query: 240  GNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMK 299
            GNKFTPS+MI S  +  G+IDV  P E+LDLY+ +  L+ K F I IKQNIG+++   +K
Sbjct: 238  GNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLK 297

Query: 300  FKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVS-EEDPFYEKWRGLSLYRGTIFGK 358
            FK+D  +VSK+W+ F +VL        +   R  K    +D F++KW+GLSLY+ +    
Sbjct: 298  FKLDTGKVSKLWKTFVRVLRVVTK--PVIPRRGKKAGPSDDAFFQKWKGLSLYKASAGDA 355

Query: 359  SXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNS 418
                         +HEYAKF+SI++ P+   +++ D+PG+VPHGAHPT+   DGPDVGN+
Sbjct: 356  KTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNN 415

Query: 419  GAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFK 478
            GAPP+F+L++QI GGSIC+GPWAQRQ++ L R+LSP+ SR AKP K+L PG  R+YT F+
Sbjct: 416  GAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFR 475

Query: 479  XXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPT 538
                      WRIPTRESSKD EFLQHY++T+EEYRPFGW+DL+F KDTY    ++ CPT
Sbjct: 476  MNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPT 535

Query: 539  KEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLE 598
             EGFKN   +H  + EIRSSVNHDILLK K F+   DIG+PLGWN    W I+++S QLE
Sbjct: 536  VEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLE 595

Query: 599  AFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLD 658
            AF+LREHITL+ADTL+DFS+G+PTPYELFRPFVY++NW+++GYS+YLNVNDHNIVNNPLD
Sbjct: 596  AFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLD 655

Query: 659  FNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNK 718
            FNENCYLS HGD L ID+ VP+  +   +T++SY I TPMFR++LNTPPWNTLNEFMK+K
Sbjct: 656  FNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHK 715

Query: 719  EVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDF 778
            EVGRS+DF I G YL+YSELDIDNVD++ I C+S STVL CYGFV+RYL NVKMNYFG+F
Sbjct: 716  EVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEF 775

Query: 779  FHFVTSEEYTGEIRANEVQNQFTDRQLYEDKAXXXXXXXXXXXXVRKEQTGDSKIKRSDL 838
            F+FVTSEEYTG + A EV    T   + +  +               E  G   +KRSDL
Sbjct: 776  FNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAEDNG--PMKRSDL 833

Query: 839  KRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDI 898
            KR TNETD+WFTF+VW GA++LPETIY+ DPCI LHF EL++DFRSCNYYMD++A +N  
Sbjct: 834  KRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGT 893

Query: 899  SLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLG 958
            S++R++ KQ NE+++ +R++NG   +++G LSD+ IH HRMYGLPP EPTYFCQWD +LG
Sbjct: 894  SIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLG 953

Query: 959  TLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESE 1018
             L++N DI FL+GF TSF K+ FG  DLENILLY+ E I+DMTSLTV  ++I+I + +  
Sbjct: 954  ELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPV 1013

Query: 1019 MDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMY-TMNGAKKEKLFEFETKVNL 1077
            M +  + + E L F+ I+FENE+Y  R+D+++P   + +   M          FETK+  
Sbjct: 1014 MKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRF 1073

Query: 1078 SNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGXXXXXXXXXXX 1137
            +NF +  D    +S+Q+ YI ++D+PYHRC F+LP   QDS+ YQ L+G           
Sbjct: 1074 TNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTL 1133

Query: 1138 XXXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTESDEE--LD 1195
                   TIDYI++D++G +  +LE+ NPF+  F  A +P    P   S TE D+E   D
Sbjct: 1134 PLPTLPDTIDYIIEDIVGEYATLLEATNPFKDLF--AETPSTVEPLRASFTEDDDEEAAD 1191

Query: 1196 PLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQILDDIEI 1255
            PLEFK     +      DN+VID+SY  L I+P L+ +  +  E F S+D+VQ+LDDIEI
Sbjct: 1192 PLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEI 1251

Query: 1256 GIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLEENNET 1315
            GIV  LS+LQEGI +  NI + + YL+L W +    G  LYLDRI+ +M +K LE+N  +
Sbjct: 1252 GIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTS 1311

Query: 1316 KITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSA 1375
            K  EV  L K+++VRAT+N+  +   +++RPPALSL +EG E+WS   + QVNSLN+ S+
Sbjct: 1312 KSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSS 1371

Query: 1376 DITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHD 1435
            DITIDE+Q++WLF+Y   Q  L QE+ +++ SIQ +RS+T+ +L+SKL  ASEYYQISHD
Sbjct: 1372 DITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHD 1431

Query: 1436 PYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDP 1495
            PYVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP DW   ID++  ++      D 
Sbjct: 1432 PYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDA 1491

Query: 1496 GNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVYSTG 1555
             N F+SVFS WRNWEFSD+ARSYIY  +F   H+K + NS++  +K  + S + TVY  G
Sbjct: 1492 KNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEG 1551

Query: 1556 YEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKKLLP-- 1613
            YEVEHNF++   N+VV+  P ++  S  +E+ I +TG +G++KGK S KL+ L+ L+P  
Sbjct: 1552 YEVEHNFVVADANLVVDLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLLKLQDLIPLV 1611

Query: 1614 -ELSMKKNLKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPKDL 1672
              ++      P     + FK+N +LL ++SE+Q V+  +KVMSR  GG++S+LWE+ KD 
Sbjct: 1612 VAVTEDDKSDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDS 1671

Query: 1673 ASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCTDIHFR 1732
             S+A S+ +++Q+SE+W+KH + IL E+Q+ +FSI+ T E+WS+KPT+LVN QC D+HFR
Sbjct: 1672 TSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADLHFR 1731

Query: 1733 AMTATDVLAKSVGXXXXXXXXXXXXFYXXXXXXXXXXXXYPVMEQKINMVLTCYFTNVNL 1792
            AM+ T+ +  ++                              +  +IN VL+CYF+NV+ 
Sbjct: 1732 AMSTTEQMVNAITEIKESVLKVKEQIKFKPKSKNKSQ----FVGSRINTVLSCYFSNVSS 1787

Query: 1793 EIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLK 1852
            EIMPLSPF  RH AKQLDIYFN+ GSN+++LS+WDTD F+ SH TKE+Y RFSFG+I++K
Sbjct: 1788 EIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIK 1847

Query: 1853 GNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLKLFQRKKPA 1912
            G   +     IN+D+S S++KLT  + RR++ SFLQDEK+  + +   SSL         
Sbjct: 1848 GGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLNSLFLTTDP 1907

Query: 1913 PSTEKS--GRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSL-NKIQGISSKYNGLS 1969
             + +K    + + W+L++NI+YFG+LVP++STYF+ ELHMLL+SL N   G+  +   L+
Sbjct: 1908 MNAKKETPAKMINWTLDTNISYFGILVPVASTYFVFELHMLLLSLTNTNNGLLPEQTRLT 1967

Query: 1970 GQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSL 2029
            GQ SI+N+ FL+KE+SLP  LSK+LDFSIKVSTLQ+   T +SFQ+ES HFRVCLSP SL
Sbjct: 1968 GQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSL 2027

Query: 2030 AHMLWRGNQALTNIRYY-KEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFCVGWL 2088
              ++W   + L  ++YY K H    W   +    ++   E+  +F S H+LSY FC+GWL
Sbjct: 2028 LRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSIHILSYKFCIGWL 2087

Query: 2089 FSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRS 2148
            F     ++PGL+ GY+RLFSAYEK+FGK T++DA+FSV+NG TS TFFS+G+EK++YNRS
Sbjct: 2088 FQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRS 2147

Query: 2149 YLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLV- 2207
            +LPNMQISYW K  G L+D + RFHGEALDVNFL SF+DVI+S+L+SI+ FQELK++++ 
Sbjct: 2148 FLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILD 2207

Query: 2208 ----GTASNIKEQTQSTTQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKP 2263
                    N        T+     ++PF   IRS+NC F+YDGGVF+V++  +     +P
Sbjct: 2208 MPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEP 2267

Query: 2264 SFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMV 2323
            SFE+KSP V I+  YK++E K + P  IRTLIT++ THNTL+A CAPL+ EFSE +Q M+
Sbjct: 2268 SFELKSPVVTINCTYKHDESKAK-PHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMI 2326

Query: 2324 KRHSS-DREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQS 2382
            K+HS+ +++P+ T  S QN+DYKR+LD FDVAV++ SAKQ LSL CEP+AKVQAD+GF+S
Sbjct: 2327 KKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFES 2386

Query: 2383 FTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINI 2442
            F F++TTN++D E+PL F+L++E+T+ASIKHIFSRE STSF V F+DLT++FTHP+ I++
Sbjct: 2387 FLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISM 2446

Query: 2443 LGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDT 2502
             GT L+SDV VFFNVKQLQNLYLFLDIW+ S++L+++P         ++ +LSS  + D 
Sbjct: 2447 YGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDV 2506

Query: 2503 DSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTS 2562
             + IPWCFTLIF+N++GDVDLGP+LGV+SL  +RTW ATDHY   R++LHA+T GI+LTS
Sbjct: 2507 GTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTS 2566

Query: 2563 KGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINN 2622
            +GRLSG+ E+  ASW+SEV WP+  + N +PLVS SLNID V  K AFDYHMFL+G INN
Sbjct: 2567 EGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINN 2626

Query: 2623 IDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIE 2682
            I  H+H+EKD  GI PDLL+V+   + I L STALVAANILDIYNT++R+RQDNKISY+E
Sbjct: 2627 IRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYME 2686

Query: 2683 TLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENIS 2742
            TL++SN SE +Q + YKDILRSL L++TD+SV+I +L +QISPISLFD E+LVV I+ +S
Sbjct: 2687 TLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVS 2746

Query: 2743 ARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIE 2802
             RSETH+G KLKT+L++QV D S ALSTSKEELDE+I A+I+++DYMHYA +I GG II+
Sbjct: 2747 IRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIID 2806

Query: 2803 APRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQ 2862
             P+L + MTT Q+EK++ LEYL+ CSF DKISVRWNLGP+NFIKEMW THV+A+AVRRSQ
Sbjct: 2807 IPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQ 2866

Query: 2863 I-DVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRK 2921
              +++FG  +EE++ + IK+EE  S+F Y+ LEEP+I++PQIRDLG+ATPP+EWFG+NRK
Sbjct: 2867 TANISFGQ-TEEELEESIKREENASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRK 2925

Query: 2922 RFPAFTHQTAVILVQKLVHTAEKEYGSIL 2950
            R P FTHQTAVI VQKLV+ AEK+Y  IL
Sbjct: 2926 RLPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 3323 bits (8616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1593/2968 (53%), Positives = 2151/2968 (72%), Gaps = 31/2968 (1%)

Query: 1    MDAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRS 60
            M+AISQ + +PLT QKDFSWVFLVDW               R  AY ++FILEW LWKR+
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60

Query: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120
            N+KIN+E++R+S LGGR+ FK++ +IH+DYTIS LE ++TW+YWLLN RK+  +  E   
Sbjct: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKA--ELIENNK 118

Query: 121  KASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSKA 180
             + + +VKLPC+F LE EGLEIF+YNR VAYDN+I   SK+ER++FEK+LNE  F +S +
Sbjct: 119  DSLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFS 178

Query: 181  XXXXXXXXXXXXXXXXAGTFKSDSSTTNDRVFQE-ELSERPQFLDFLPIDFKVSHGSLII 239
                            A T  SD+S  NDR +QE ++ + P+FL FLPI+ K + GSL++
Sbjct: 179  DGSSADKLDEDLSES-AYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLL 237

Query: 240  GNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMK 299
            GNKFTPS+MI S  +  G+IDV  P E+LDLY+ +  ++FK F I IKQNIG+++   +K
Sbjct: 238  GNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLK 297

Query: 300  FKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFGKS 359
            FK+D  +VSK+W+ F +VL      +     +      +D F++KW+GLSLY+       
Sbjct: 298  FKLDTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSDDSFFQKWKGLSLYKAAPGDAK 357

Query: 360  XXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNSG 419
                        NHEYAKF+SI++ P+    ++ D+ G VPHGAHPT+   DGPDVGN+G
Sbjct: 358  PSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNG 417

Query: 420  APPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFKX 479
            APP+F+L++QI GGSIC+GPWAQRQ++ L R+LSP+ SR +KP K+L PG  RIYT F+ 
Sbjct: 418  APPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRM 477

Query: 480  XXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPTK 539
                     WRIPTRE+SKD EFLQHY+ET+EEYRPFGW+DL+F KDTY    V  CPT 
Sbjct: 478  NVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTV 537

Query: 540  EGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLEA 599
            EGF+N   +H  + EIRSSVNHDILLK K FN   DIG+PLGWN +A W I+++S QLEA
Sbjct: 538  EGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEA 597

Query: 600  FILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDF 659
            F+LREHITL+ADTL+DFS+GEPTPYELFRPFVY++NW++ GYS+YLNVNDHNIVNNPLDF
Sbjct: 598  FLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDF 657

Query: 660  NENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKE 719
            NENCYLS HGD L ID+ VP+  +   +T++SY I TPMFR++LNTPPWNTLNEFMK+KE
Sbjct: 658  NENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKE 717

Query: 720  VGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFF 779
            VGR++DF + GSYL+YSELDIDNVDT++IEC+S STVL CYGFV+RYLTNVKMNYFG+FF
Sbjct: 718  VGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFF 777

Query: 780  HFVTSEEYTGEIRANEVQNQFTDRQLYEDKAXXXXXXXXXXXXVRKEQTGDSKIKRSDLK 839
            +FVTSEEYTG + A EV    T   + +               ++ E      +KRSDLK
Sbjct: 778  NFVTSEEYTGVLGAREVGEIITKSSVLD--LASTLDSGYQNSSLKNESEDKDPVKRSDLK 835

Query: 840  RATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDIS 899
            R TNETD+WFTF+VW GA++LPETIY+ DPCI LHF EL++DFRSCNYYMD++A +N  S
Sbjct: 836  RTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTS 895

Query: 900  LRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLGT 959
            ++R++ K  NE+++ +R++NG   +++G+LSD+ IH HRM+GLPP EPTYFCQWD +LG 
Sbjct: 896  IKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGD 955

Query: 960  LDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESEM 1019
            L ++ DI F++GF  SF KI FG  DLENILLY+ E +DDMTSLTV  ++I I   +  M
Sbjct: 956  LTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVM 1015

Query: 1020 DTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLF-EFETKVNLS 1078
             +  + TAE L F+ I+FENE+Y  R+D++IP   + +  + G   +  F +FETK+  +
Sbjct: 1016 KSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFT 1075

Query: 1079 NFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGXXXXXXXXXXXX 1138
            NFE+  DI   +S+Q+ YIT HD+PYHRC F+LP   QDS+ YQ L+G            
Sbjct: 1076 NFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLP 1135

Query: 1139 XXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTE--SDEELDP 1196
                  TID+I++D++G +  +LE+ NPF+  F  A +P    P   S TE  +DE  DP
Sbjct: 1136 LPTLPDTIDFIIEDIVGEYATLLETTNPFKDIF--AETPSTVEPSRASSTEDDNDERADP 1193

Query: 1197 LEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQILDDIEIG 1256
            LEFK     +       N+VID+SY  L ++P L+ +  +  + F S+D+VQ+LDDIEIG
Sbjct: 1194 LEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIG 1253

Query: 1257 IVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLEENNETK 1316
            IV  LS+LQEGI +  NI + I Y++L W +    G  LYLDRID +M +K LE+N  +K
Sbjct: 1254 IVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSK 1313

Query: 1317 ITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSAD 1376
            + EV  L +I++VR T+N+  +   +++RPPALSL +EG E+WS   + QVNSLN+ S+D
Sbjct: 1314 LLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSD 1373

Query: 1377 ITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHDP 1436
            ITIDE+Q++WLF+Y   Q  L QE  ++  SIQ +R +++ +L+SKL  ASEYYQISHDP
Sbjct: 1374 ITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDP 1433

Query: 1437 YVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDPG 1496
            YVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP DW   I+++  ++   +  D  
Sbjct: 1434 YVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAK 1493

Query: 1497 NAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVYSTGY 1556
            N F+SVFS WRNWEFSD+ARSYIY  +FS  +++ ++N M+  +K  + S + TVY  GY
Sbjct: 1494 NIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGY 1553

Query: 1557 EVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKKLLPELS 1616
            EVEHNF++   N+VV+  P ++  S+ +E+ I +TG +G++KGK S +L+ L+ L+P ++
Sbjct: 1554 EVEHNFVIADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFSDRLLKLQDLIPLVA 1613

Query: 1617 MKKNLKPS---TPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPKDLA 1673
                   S       + FK+N +LL ++SE+Q V+  +K+MSR  GG++S+LWE+ KD  
Sbjct: 1614 AVGGGDKSDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDST 1673

Query: 1674 SKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCTDIHFRA 1733
            S+A S+ +++Q+SE+W+KH +IIL E+Q+R+FSI+ T E+WS+KPT+L+N QC D+HFRA
Sbjct: 1674 SQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRA 1733

Query: 1734 MTATDVLAKSVGXXXXXXXXXXXXFYXXXXXXXXXXXXYPVMEQKINMVLTCYFTNVNLE 1793
            M+ T+     +                            P    KIN+VL+CYF+NV+ E
Sbjct: 1734 MSTTEQTVTVITEIRESVLKIKDRIKFKPKSKKRSQFVGP----KINIVLSCYFSNVSSE 1789

Query: 1794 IMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLKG 1853
            IMPLSPF  RH AKQLDIYFN+ GSN+++LS+WDTD F+ SH TKE+Y RFSFG+I++KG
Sbjct: 1790 IMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKG 1849

Query: 1854 NILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLKLFQRKKPAP 1913
             I +     IN+D+S S++KLT  + RR++ SFLQDEK+  + +   SSLK        P
Sbjct: 1850 GISKEDYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLKSLLFTSGLP 1909

Query: 1914 STEKS---GRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSL-NKIQGISSKYNGLS 1969
              +K     R + W+L+++I YFG+LVP++STYF+ ELHMLL+SL N   G+  +   ++
Sbjct: 1910 KKKKKKAPARMINWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVT 1969

Query: 1970 GQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSL 2029
            GQFSI+N+ FL+KE+SLP  LSK+LDFSIKVSTLQ+   T +SFQ+ES HFRVCLSP SL
Sbjct: 1970 GQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSL 2029

Query: 2030 AHMLWRGNQALTNIRYY-KEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFCVGWL 2088
              ++W  ++ L    YY + H    W+  +    ++   E+  +F S H+LSY FC+GWL
Sbjct: 2030 LRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWL 2089

Query: 2089 FSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRS 2148
            F     ++PGL++GY+RLFSAYEK+FGK T++DA+FSVANG  S TFFS+G+EKD+YNRS
Sbjct: 2090 FQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRS 2149

Query: 2149 YLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLVG 2208
            +LPNMQISYW K  G L+D + RFHGEALDVNF+ SF+DVI+S+L+S++ FQELK++++ 
Sbjct: 2150 FLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILD 2209

Query: 2209 TASNIKEQ-----TQSTTQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKP 2263
             + +   +       S+ +     ++PF   IRS+N  F+YDGGVF+V++  +     +P
Sbjct: 2210 VSEDSHMEDDNPYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEP 2269

Query: 2264 SFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMV 2323
            SFEIKSP V I+  YK+NE + + P  IR LI ++ T NTL+A CAPL+ EFSE +QKM+
Sbjct: 2270 SFEIKSPVVTINCTYKHNENEAK-PHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMI 2328

Query: 2324 KRHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSF 2383
            K+HS+D +PS T  S QN+DYKR+LD FDVAV++ SAKQ LSL CEP+AKVQAD+GF+SF
Sbjct: 2329 KKHSTDDKPSFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESF 2388

Query: 2384 TFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINIL 2443
             F++TTN++D E+PL F+L++++T+ASI+HIFSRE STSF V F+DLT++FTHP+ I++ 
Sbjct: 2389 LFSMTTNEFDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMY 2448

Query: 2444 GTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDTD 2503
            GT L+SD+ VFFNVKQLQNLYLFLDIW+ S++L+++P+   +    D+ SL+S    D  
Sbjct: 2449 GTSLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVG 2508

Query: 2504 STIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSK 2563
            + IPWCFTLIF+N++GDVDLGP+LGV+SL  +RTW ATDHY   R++LHA+T G++LTS+
Sbjct: 2509 AEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSE 2568

Query: 2564 GRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNI 2623
            GRLSG+ E+  ASWISEV W + ++ N +PLVS SLNID V  K AFDYHMFL+G INNI
Sbjct: 2569 GRLSGLFEVANASWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNI 2628

Query: 2624 DVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIET 2683
               +H+EKD  GI PDLL+V+   + I L STALVAANILDIYNT++R+RQDNKISY+ET
Sbjct: 2629 QFQLHNEKDAKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMET 2688

Query: 2684 LKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISA 2743
            L++SN  E +Q + YKDILRSL L++TD+S++I +L +QISPISLFD E+LVV I+N+S 
Sbjct: 2689 LRDSNPGESKQPILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSI 2748

Query: 2744 RSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEA 2803
            RSETH+G KLKT+L++QV D S ALSTSKEELDE+I A+I+++DY+HYA +I GG II+ 
Sbjct: 2749 RSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDI 2808

Query: 2804 PRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQI 2863
            P+L + MTT Q+EK++ +EYL+ CSF DKISV+WNLGPVNFIKEMW THV+A+AVR+SQI
Sbjct: 2809 PKLAVHMTTLQEEKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQI 2868

Query: 2864 -DVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKR 2922
             +V+FG  +EE++ + IK +E  S+F Y+ LEEP+I +PQIRDLGDATPP+EWFG+NRKR
Sbjct: 2869 ANVSFGQ-TEEELEESIKTKETTSKFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKR 2927

Query: 2923 FPAFTHQTAVILVQKLVHTAEKEYGSIL 2950
            FP FTHQTAVI VQKLV+ AEK+Y  IL
Sbjct: 2928 FPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 3204 bits (8308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1568/2998 (52%), Positives = 2074/2998 (69%), Gaps = 62/2998 (2%)

Query: 1    MDAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRS 60
            M + S+FQ +P++  K+FSWVFL+DW               R +AY  S ILEW LWKR+
Sbjct: 1    MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGY--DTPEL 118
            ++K+NIES+RIS LGGR+FFKNV IIH+DYTIS L+  +TWRYWLL  RK  Y  ++ + 
Sbjct: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120

Query: 119  PDKASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDS 178
                   + +LPCRF L  EG EIFVYNR  +YDNII  FSKEER +F+KFL+EQ+F D 
Sbjct: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180

Query: 179  KAXXXXXXXXXXXXXXXXAGTFK-----------SDSST---TNDRVFQEELSERPQ-FL 223
             +                    K           S  ST    NDR+F +  S++   FL
Sbjct: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240

Query: 224  DFLPIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFA 283
               P++ +V   SL  GNKFTPSL+I S    TG+ID CQP EKLDLYK++  ++   FA
Sbjct: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300

Query: 284  IDIKQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYE 343
            + +K NIG+ EE  +KFKIDR ++S++W++F  +       + L+  +  +    D F +
Sbjct: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360

Query: 344  KWRGLSLYRGTIFGKSXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGA 403
            KW+GLSLY+GTIF  +            NHEYAKFSS+V+ P+AIFT+E DIPG VPHGA
Sbjct: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420

Query: 404  HPTLTATDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPT 463
            HPT +  DGPDVGN+GAPP  SL+IQI GGSIC+GPW QRQ+N +  +L+P  SR   P 
Sbjct: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480

Query: 464  KRLTPGCTRIYTQFKXXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKF 523
            KR  PG TRIYT  K          WRI TRE SKD  FL+HY+ETN++YRPFGWIDL+F
Sbjct: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540

Query: 524  SKDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWN 583
            SK++Y   T A  PT EGFKN ++IHL  NEIRSSVNHDIL+KCK F+F +D+ +PL WN
Sbjct: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600

Query: 584  EEATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSL 643
            + ATWTID+ S QLE F+LREHITLIADTLTDF+SGEPTPYELFRP    INWK++ Y +
Sbjct: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660

Query: 644  YLNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVL 703
            YLNVNDHNIVNNPLDFNENCYLS HGD L I++ +P  +++A F E++Y I TPMFRL+L
Sbjct: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRLLL 720

Query: 704  NTPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFV 763
            NTPPWNTLNEFMK KEVGRS+DF   GSYL+YSELD+DNVDTI I C S+ T LQCYGFV
Sbjct: 721  NTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780

Query: 764  IRYLTNVKMNYFGDFFHFVTSEEYTGEIR-----ANEVQNQFTDRQLYEDKAXXXXXXXX 818
            IRYL NVKMNYFGDFF+F+TSEEYTG  R        + +  +D +  ++          
Sbjct: 781  IRYLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSNLSDNE--DNGDVYSDGESG 838

Query: 819  XXXXVRKEQTGDSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGEL 878
                + +E    + +KRSDL+R  NETDL+ TF+VW+GAI+LPETIYNCD C  L FGEL
Sbjct: 839  MDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGEL 898

Query: 879  LIDFRSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHR 938
            +ID RS NYYMDLLAS+ D  + RY  K   +I++SV  DN   ++  G LSD+ IH HR
Sbjct: 899  IIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHR 958

Query: 939  MYGLPPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVID 998
            M+GLPP EPTYFC+WDF +G L++N +  FL+GF+TSF++I FG  DLENILLY KEVI+
Sbjct: 959  MFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVIN 1018

Query: 999  DMTSLTVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMY 1058
            DMTSLTV+ ++IS+ ++       +    + + F++I+FE+  Y +RLDL IP   + MY
Sbjct: 1019 DMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMY 1078

Query: 1059 TMN-GAKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQD 1117
             ++   KK +LF F TKV+L++F +  +   H+S Q+ YITL+DA +HR +F+LP S Q 
Sbjct: 1079 GLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQK 1138

Query: 1118 SEIYQDLFGXXXXXXXXXXXXXXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSP 1177
             E+Y +L+G                  T+D+I++D LG +  +L+    FR+PF    +P
Sbjct: 1139 KELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFGSTNTP 1198

Query: 1178 KLGNPFEGSDTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNC 1237
                    + T  +E++DPLEF   T    + +  DN VIDI Y S+ INP + +Y+++ 
Sbjct: 1199 N------QASTHHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESL 1252

Query: 1238 REHFCSQDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYL 1297
                  ++IVQ++DDIEI  +  LS  QEG  +  NIKL++LY D++WG+R   GI LYL
Sbjct: 1253 SSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYL 1312

Query: 1298 DRIDLEMCQKMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSE 1357
            D++D EM Q+ +E++ E  + E+T L K RS+RA+I+E  S     ERPPALSLV+EG E
Sbjct: 1313 DKLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCE 1372

Query: 1358 IWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRK 1417
            +WS     QVNS++ +S DITIDE+Q++WLF ++++Q    Q I + L S+Q   + +R+
Sbjct: 1373 LWSATAEKQVNSIDTISTDITIDESQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRR 1432

Query: 1418 QLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWL 1477
            +L+SKL  A+++YQISHDPYVITKPAFITRLS+GHVRENRSWKIITRLRHILTY+P DW 
Sbjct: 1433 KLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWE 1492

Query: 1478 RVIDEMRNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSME 1537
              ++    ++  +   +    F+SVFSNWRNWEFSD+ARSYIY  +F    ++K + SM 
Sbjct: 1493 SGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMR 1552

Query: 1538 NSIKLKLASLFFTVYSTGYEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTI 1597
              IK+ L+S F T Y+ GY+++ NF+LT  N+V E  P  +++ + +EK+IN+TGS+G++
Sbjct: 1553 RIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSV 1612

Query: 1598 KGKTSHKLINLKKLLPELSMKKNLKPSTPFL------RCFKLNMLLLFERSELQFVLGAS 1651
            KG  S +L+ LK+L+P L+ ++     +P        + FKLN LLLFE++E+Q V+G S
Sbjct: 1613 KGNFSDELLRLKELIPLLNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGES 1672

Query: 1652 KVMSRVFGGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITA 1711
            K+ +R+  GK+S+L + PK+  S A S+ +YA+RSE  + H N  L E+Q+R+FS+  T 
Sbjct: 1673 KLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATV 1732

Query: 1712 ESWSYKPTVLVNLQCTDIHFRAMTATDVLAKSVGXXXXXXXXXXXXFYXXXXXXXXXXXX 1771
            ESWS KPTVLV+ QC   H ++M  T  L  SV                           
Sbjct: 1733 ESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKS 1792

Query: 1772 YPVMEQKINMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLF 1831
                 + + + + C  +NV+ EIMP+SPF  RH  K+ D+ F + GS ++++ VWDTD F
Sbjct: 1793 PKKKLKDVEIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFF 1852

Query: 1832 LISHLTKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEK 1891
            L S LTK++YFR SFG+ Q+  N++E     ++ +VSAS++KLT  +  R++ SFLQDE+
Sbjct: 1853 LRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDER 1912

Query: 1892 ILIESLEQFSSLKLF----QRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILE 1947
               ES +   +LK F       +  P+T K  R   W L+++I YFG+LVPIS+TYF+ E
Sbjct: 1913 TASESFKLLKALKPFLLPQTEGRLQPATTKEMR---WLLDTDIKYFGILVPISTTYFVFE 1969

Query: 1948 LHMLLMSLNKIQGISSKY---NGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQ 2004
             H L++S++ I   + KY   +    Q SI+NV FL+K++ +P+ LS++LDFSI  ST+Q
Sbjct: 1970 THALVLSMSDID--TEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQ 2027

Query: 2005 KLKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSV-AWE--KVINFK 2061
            K+     SFQ+ES HFR+ LSP SL  ++W G Q L    YYKE      W+       K
Sbjct: 2028 KMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIKASKLKK 2087

Query: 2062 NTNNSAEVQADFPSFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLID 2121
                S+ +  +  SFHVLSYNFC+GW+F     + PG+++G+SRLFSAYE  +GKLTL+D
Sbjct: 2088 EKKGSSSIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVD 2147

Query: 2122 AYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNF 2181
            A+FSVA G TS TF+ +  E +  NRSYLPNMQI+YW+K  GL++DV++RFHGEALDV+F
Sbjct: 2148 AFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSF 2207

Query: 2182 LASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDISPFFTGIRSINCQ 2241
            L +FI VIES L+S Q FQELK  L+   ++    T++ T+  I  ++PF + I+S+NCQ
Sbjct: 2208 LTTFITVIESMLQSFQVFQELKTSLIQPNTS---TTENNTEPKIKSLAPFLSNIKSVNCQ 2264

Query: 2242 FQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTH 2301
            F+YDGGVFKVFS  +  +HL+PSFE+K+P VIID NYK+N    + P WIR L+ I STH
Sbjct: 2265 FKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLK-PHWIRALVAIGSTH 2323

Query: 2302 NTLFAKCAPLIAEFSEGIQKMVKRHSSD--REPSGTNISK---QNIDYKRMLDSFDVAVE 2356
            NTLFA CAPLIAEF E I +MVK+HSS+   E   TN+SK   QNIDYKR+LD FD+A +
Sbjct: 2324 NTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFK 2383

Query: 2357 VISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFS 2416
            + S++Q LSL CEP+AKVQAD+GF SF   + TN+ D  EPL F+LS++KT+ASIKHIFS
Sbjct: 2384 LTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFS 2443

Query: 2417 REASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLL 2476
            +E STSFG+D IDL  MFTHP+ IN+ GTGLIS+V ++FNVKQLQNLYLF+DIWKLS+ +
Sbjct: 2444 KETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFI 2503

Query: 2477 NSKPMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKR 2536
               P  +    + + K L+  Q  +    IPW FTLIF+NING  DLGP+LGVLSL  KR
Sbjct: 2504 RPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLSLKLKR 2563

Query: 2537 TWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVS 2596
            TW A+DHY+  R+V+ A+T  ++  SKGRLSGI ELDGASW+SEV+WP  +  ++YPLV+
Sbjct: 2564 TWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVN 2623

Query: 2597 ISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTA 2656
            +S+NID +  K AFDYHMFL+G I+     +HSEKDI G  PDLLKVN  CE I +CSTA
Sbjct: 2624 VSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTA 2683

Query: 2657 LVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALD-YKDILRSLNLIQTDVSVD 2715
            LVAANILD+YNTVMR+RQDNKI Y+ETL+ES+T E R   D Y+DILRSLNL+QTDVS +
Sbjct: 2684 LVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTN 2743

Query: 2716 IYTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEEL 2775
            I+ L +Q+SPI+LFD E+LV+NIENISAR+ T AG KLKT LE++VYD  VALSTSK E+
Sbjct: 2744 IHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKREI 2803

Query: 2776 DEDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISV 2835
            DED ++ ISV DYM YA +ISGG IIE P+L IAMT++Q+E SDILEYLY C+F DKI+V
Sbjct: 2804 DEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAV 2863

Query: 2836 RWNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEE 2895
            +WNLGPVNFIKEMW THV+A+AVRRSQ  +     ++E+V KRIK+EE  S+ +YVP+EE
Sbjct: 2864 KWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPIEE 2923

Query: 2896 PRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSILGHS 2953
            PRIDMPQIRDLGDATPPLEWFG+NRKR PAFTHQT V+ VQKLVH AEK+Y S+L +S
Sbjct: 2924 PRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLDNS 2981

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 3132 bits (8119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1555/3010 (51%), Positives = 2056/3010 (68%), Gaps = 71/3010 (2%)

Query: 2    DAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRSN 61
            D +SQF  I L K KDFSWVFLVDW               R +A+ ISFI EW LWKR  
Sbjct: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62

Query: 62   VKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDT---PEL 118
            +K+NIES+R+S LGGR+FFKN+ II +DYTISFL   ++WRYWL   R   + T    E 
Sbjct: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122

Query: 119  PDKAS-ANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTD 177
             D AS   + KL CR  LE EG+E+F+YNR VAYDN I  FSKEER +FE+FLNE VFTD
Sbjct: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182

Query: 178  SKAXXXXXXXXXXXXXXXXAGTFKS----------DSSTTNDRVFQEELSERPQFLDFLP 227
              +                    KS          +S   NDR+F +E + +  FL++LP
Sbjct: 183  RASTESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKNLFLNYLP 242

Query: 228  IDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIK 287
            +  KVSH S ++GNKFTPSL+I S  S  G++D CQP EKLD+YK +  +D K  ++ +K
Sbjct: 243  LQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSLK 302

Query: 288  QNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRG 347
            QNIG+NEE  +KFK+   ++SK+W  F K        + LS  + N+ S    F++KWRG
Sbjct: 303  QNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKWRG 362

Query: 348  LSLYRGTIFGKSXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTL 407
            LSLY+  +F              A HEYAKF+SI++ P+AI T+E DIPG VPHGAHPTL
Sbjct: 363  LSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPTL 422

Query: 408  TATDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLT 467
            ++ DGPD+GN+GAPP F LEIQ+ GGS+C+GPWAQRQ+  +  LL+P  SR+ KP K L 
Sbjct: 423  SSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPLQ 482

Query: 468  PGCTRIYTQFKXXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDT 527
            PG  R+YT FK          WRIPTRESSKD EFL+HY+ TNE+YRPFGW+DLKFSKD+
Sbjct: 483  PGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKDS 542

Query: 528  YICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEAT 587
            Y     A C T +G +NT+ IHLGD+EIRSSVNHDI +K KS +F +++GFPLGWNE+A 
Sbjct: 543  YASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKAK 602

Query: 588  WTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNV 647
            WTI++ S+QLE F+LREHITLIADT++DFS+GEPTPYELFRPF+Y INWK++GYS+YLNV
Sbjct: 603  WTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLNV 662

Query: 648  NDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPP 707
            NDHNIVNNPLDFNENCYLSFHGDIL +D+ VPK  + A  T++SY IYTPMFRL+LN PP
Sbjct: 663  NDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAPP 722

Query: 708  WNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYL 767
            WNTLNEFMK+KEVGR++DF+ TG+YLIY+ELD+DNVD I I CSS+STVL CYGFVIRYL
Sbjct: 723  WNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRYL 782

Query: 768  TNVKMNYFGDFFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKAXXXXXXXXXXXXVRKEQ 827
             N+KMNYFGDFFHFVTSEEYT +I +      + +  L+E K                E+
Sbjct: 783  MNIKMNYFGDFFHFVTSEEYTEKISS----KGYGEGSLFE-KYSDDASTFVSDFDKNNEE 837

Query: 828  TGDSKIKR--SDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSC 885
                K+ R  +D++R TNETDLW TF +WEGA+LLPETIYNCDPCI LHFGEL ID RS 
Sbjct: 838  DDKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRST 897

Query: 886  NYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPL 945
            NYYMDLLAS++DI LR+Y   Q NEI+E+VRQ NG   K +  +S++ IH HRMYGLPP 
Sbjct: 898  NYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPT 957

Query: 946  EPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTV 1005
            EPTYFC+WDF LGT+ L  ++ F++G +TSF KI FG  DLEN+LLYEKEV+DDMT++TV
Sbjct: 958  EPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTV 1017

Query: 1006 DVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMN--GA 1063
            +VK   I+I   E+ +        + F NI+FENEKY TR+D+RIP+  L +Y  N   +
Sbjct: 1018 NVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEAS 1077

Query: 1064 KKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQD 1123
            K+   F FETK+N +NF    +   H++ Q++YIT++DAP+HRC FILP S Q+S IYQ 
Sbjct: 1078 KELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQK 1137

Query: 1124 LFGXXXXXXXXXXXXXXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPF 1183
            L+G                  T ++I+ D L  +    +      +P+  +T+    +  
Sbjct: 1138 LYGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEYNTTSDCI-ILNLPYPDSTNLNSDSFN 1196

Query: 1184 EGSDTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCS 1243
               DT      D +  K+    D      DN+VID  Y S+SI+P L+ Y++    HF  
Sbjct: 1197 SYPDTAPHTLSDTIIRKSPLPEDER----DNYVIDFRYISISIDPELFFYIEKLLNHFYG 1252

Query: 1244 QDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLE 1303
             D  Q++D IEIG+V  LS+ QEGI +  N K++IL+ D+FWG R   GI LYLD +D E
Sbjct: 1253 DDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTLDFE 1312

Query: 1304 MCQKMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCIT 1363
            M +K +E+N E  +TEVT L K+ S+RA++N   S GK + +PPALSL++EG + WS   
Sbjct: 1313 MNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTTA 1372

Query: 1364 NAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKL 1423
               +NS+ + S D TIDE Q+ WLF +   Q  L   +    + +Q+ R+ +RK+L+S+L
Sbjct: 1373 KKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRL 1432

Query: 1424 AVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEM 1483
             VASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHI+TYLP DW   + + 
Sbjct: 1433 TVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQ 1492

Query: 1484 RNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLK 1543
              ++  +   D  + F+SVFS+WRNWEFSD+ARSYIY  +F    ++KQ+ ++    K  
Sbjct: 1493 LKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWKAA 1552

Query: 1544 LASLFFTVYSTGYEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSH 1603
              S++ TVY+ G  V+H+FI+T++N+V E  P  ++S   QEK+INVTG+LG+IKGK S 
Sbjct: 1553 FVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNLGSIKGKISD 1612

Query: 1604 KLINLKKLLPELSMKKN--LKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGK 1661
            K+  L  L+  +  +++  LK  + F R FKLN+ LLF+ S+L FV G + + + +  GK
Sbjct: 1613 KMFKLHNLMNLVQQQEDPALKSISSFSRSFKLNIALLFDSSDLLFVFGETSLTNTIHSGK 1672

Query: 1662 LSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVL 1721
             S LWE+PK    +  S+ +YA+R E  MKH N +L E+Q+   ++   A+S    P+++
Sbjct: 1673 ASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGIALSAAADSIISHPSIV 1732

Query: 1722 VNLQCTDIHFRAMTATDVLAKSVGXXXXXXXXXXXXFYXXXXXXXXXXXXYPV-MEQKIN 1780
             N QC DI+ R M  T+V+   +             F              P     KIN
Sbjct: 1733 ANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKPTPTKIN 1792

Query: 1781 MVL------TCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLIS 1834
              L      TC+F+NV+L+IMP+ PF FR   K+++  F+   + +   ++WD+DL+L S
Sbjct: 1793 PFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYLGS 1852

Query: 1835 HLTKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILI 1894
            HLTK++YFR S GNI +        N   N+DVSASIVKLT  +  R++ SFLQDE+ + 
Sbjct: 1853 HLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQDEREVS 1912

Query: 1895 ESLEQFSSLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMS 1954
             S+++   L      +P  +T  +G  + W L ++I Y G+L+P+S+T+F+ E+H LL S
Sbjct: 1913 RSVKKLQVLGNLFSSEPEINTIPAGAKIDWRLNADIKYLGILIPVSTTFFVFEMHTLLAS 1972

Query: 1955 LNKIQ--GISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRS 2012
            L  +    I  + +  SGQ S+DN+ FL+K++++P+ LS+I+D S K+S +QK+  +  S
Sbjct: 1973 LADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIMESHHS 2032

Query: 2013 FQIESPHFRVCLSPGSLAHMLWRGNQALT-NIRYYKEHTSVAWEKVINFKNTNNSAEVQA 2071
            +QIESPH R C SP SL  +LW G+Q L  +  Y + H+   W+ +   +      +  +
Sbjct: 2033 YQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPKKEKKVEEDKTTS 2092

Query: 2072 -----DFPSFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSV 2126
                  F S H+LSYNFCVGWLF    D + GLI+GY+RLFSAYEK  GKLTL+DA+FSV
Sbjct: 2093 FFSTLTFGSCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVDAFFSV 2152

Query: 2127 ANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFI 2186
            +NG+TSDTF+S G+E+D+YNRS+LPN+QI YWLK    ++DV++R HGE LDVNFL+SF+
Sbjct: 2153 SNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNFLSSFV 2212

Query: 2187 DVIESSLESIQKFQELKRDLVGTASNIKEQT-------------------QSTTQEPIGD 2227
             +IE++L+SIQ FQELK+ LV   +  + ++                   +     P  D
Sbjct: 2213 KIIEATLQSIQVFQELKKVLVNPLTQSEARSEEEEEESEEHNRRETVPGKEKKEDAPRKD 2272

Query: 2228 ISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQT 2287
            I+PF + IR +NCQF+YDGG+FKV+S  +  ++L PSFEI+SP V ID++YK N    + 
Sbjct: 2273 IAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNNIGDVK- 2331

Query: 2288 PTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVKRHSSDREPS-GTNISK--QNIDY 2344
            P  IRTLIT+NSTHN LFA+CAPL+   S+ IQ MVK+HSS ++P     +S+  QNIDY
Sbjct: 2332 PHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVKKHSSKKKPEPKQRVSRPSQNIDY 2391

Query: 2345 KRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSV 2404
            KR+L+SFD+  ++IS++Q LSL CEP+AKVQA++GF SF F + TND D  EPL FAL V
Sbjct: 2392 KRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSFALVV 2451

Query: 2405 EKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLY 2464
            + T ++I+HIFSRE S SFG+D ID+T MFTHPN IN+ G  LISDV V+FNVKQLQNLY
Sbjct: 2452 KNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQLQNLY 2511

Query: 2465 LFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLG 2524
            LFLDIWKLSNLL  KPM +       + +  S    D  + IPWCFTLIF+NING VDLG
Sbjct: 2512 LFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPS-SPMDVGNIIPWCFTLIFANINGKVDLG 2570

Query: 2525 PTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWP 2584
            P+LG+LSL  ++ WFA+DHY+S R++LHAY   I LT+KGRLSGI+ELDGA W +EVNWP
Sbjct: 2571 PSLGLLSLSMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGALWAAEVNWP 2630

Query: 2585 IYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVN 2644
             Y+  + YPLV++S  I  +  KVAFDYHMFL+G + N   H+HSE+D +G  PDLLKV 
Sbjct: 2631 KYD--DPYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDLLKVM 2688

Query: 2645 VICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKDILRS 2704
            + CE I +CSTALVAAN+LD+YNT+MR+RQD  +SY+ETL+ESNT++ ++ +DYKDIL+ 
Sbjct: 2689 LTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKETVDYKDILKV 2748

Query: 2705 LNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDA 2764
            LNLIQTDV VDI TLN+QISPISLFD E+LVVNI N+ A  +THAG KL+T L +Q+Y+A
Sbjct: 2749 LNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLETYLHLQLYNA 2808

Query: 2765 SVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYL 2824
              +LS+SK E+DED+++ ISVEDYM YA +I GG I + P+L I+M T+QK  SDILEY 
Sbjct: 2809 HGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKSNSDILEYG 2868

Query: 2825 YTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKRIKKEEE 2884
            Y  +FGDKI+VRWNLGPVNFIKEMW TH++A+AVRRSQ  V      E DV KR++ EE 
Sbjct: 2869 YRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDEEGDVEKRMRDEET 2928

Query: 2885 FSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEK 2944
             S+  Y+ +EEP+ID PQI+DLGDATP LEWFGLNRK+FP FTHQT ++ VQKL+H+AEK
Sbjct: 2929 LSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEK 2988

Query: 2945 EYGSILGHSQ 2954
            EY +I+GHSQ
Sbjct: 2989 EYANIVGHSQ 2998

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 2952 bits (7653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1454/2981 (48%), Positives = 2023/2981 (67%), Gaps = 66/2981 (2%)

Query: 1    MDAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRS 60
            M+  SQF+R+ L+ +++FSWVFLVDW               R  AY I+ +LEWFLWK  
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPEL-- 118
             VKI++ES+RI+PL G + F+N+ II +D TIS L+ ++ WRY LL  R+S Y+      
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 119  -------PDKASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLN 171
                    D  S  ++ LPCRF L  EG EIF+YNR VAY+NII  FS+EER QFEKF++
Sbjct: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180

Query: 172  EQVFTDSKAXXXXXXXXXXXXXXXXAGTFKSDSSTTNDRVFQEELSERPQ-FLDFLPIDF 230
            +Q  ++                     +  SD    NDRVF E  +++   F+ FLP++ 
Sbjct: 181  KQEMSE-LFHCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKKSIFMRFLPMEL 239

Query: 231  KVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNI 290
            ++S GS+++GNKFTPSL+I SC+S  G++D+CQP EKLDLYK+ F +DF    I I+QNI
Sbjct: 240  QLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNI 299

Query: 291  GFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSL 350
             +N +   K      ++S+MW  F KVL   + +   SH  +NK +E +PF  KW+GL L
Sbjct: 300  EYNRK---KATFKNGKLSRMWATFVKVLHIPFYNK--SH--NNKGTESEPFMTKWKGLGL 352

Query: 351  YRGTIFGKSXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTAT 410
            Y+G  F +            ANHEYAK S+I+++P+ + T+  DIPG+VPHGAHPTL   
Sbjct: 353  YKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTL--- 409

Query: 411  DGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGC 470
            +GP+VGN+GAPPEF +++Q  G +IC+GPWAQR++  L+R++SP  +R++ P K L+PG 
Sbjct: 410  EGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGS 469

Query: 471  TRIYTQFKXXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYIC 530
             RIYT FK          WRIPTRE SKD EFL+ ++ T+EEYRPFGW+DLKF+ D+Y  
Sbjct: 470  RRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGS 529

Query: 531  STVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTI 590
             T   CP +EGF N + IH  + E  SSVNHD++LKC  F+   D+G+PLGWN  ATWTI
Sbjct: 530  VTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTI 589

Query: 591  DLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDH 650
            +L STQLE F+LREH+TL+AD  TDFSSGEPTPYELFRPF+Y+INW I+GYS+YLNVNDH
Sbjct: 590  NLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDH 649

Query: 651  NIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNT 710
            NIVNNPLDFNENCYLS HG+ L ID+  P   ++  + +V Y I TPMFRL+LNTPPWNT
Sbjct: 650  NIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLLLNTPPWNT 709

Query: 711  LNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNV 770
            LNEFMKNKEVGRS+ F + G Y +YSELDIDNVDT+ +EC+S  T L CYGFV+RYL NV
Sbjct: 710  LNEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNV 769

Query: 771  KMNYFGDFFHFVTSEEYTGEIRANEVQN-QFTDRQLYEDKAXXXXXXXXXXXXVRKEQTG 829
            KMNYFGDFFHF+TSEEYTG IRA E ++   T+ +   D +                   
Sbjct: 770  KMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPYVRLRA 829

Query: 830  DSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYM 889
            D  + RSD+KR TNETD+WFTF+VWEGA++LPETIYNCDPC+ LHFGEL++D RSCNYYM
Sbjct: 830  DPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYM 889

Query: 890  DLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTY 949
            DLLA+M+  S++RY+ +Q +E++ES+R+DNG   K++GSL+ + IH HRMYGLPP+EPTY
Sbjct: 890  DLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPTY 949

Query: 950  FCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKK 1009
            FCQW   L  L +N D  F +GF T F  I FG  +LEN LLY+ E  DDMTS+TV V+ 
Sbjct: 950  FCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSVTVRVRD 1009

Query: 1010 ISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTM-NGAKKEKL 1068
            +++++      +  +     L F++I+FENE+Y  R+DL++P  ++ + T  + ++  +L
Sbjct: 1010 MNVVVENDS--SRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRL 1067

Query: 1069 FEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGXX 1128
             +  TKV L++F +  D A H+SKQ++YITL+D+P++RC+F+LP  LQ+S +Y+ L G  
Sbjct: 1068 MDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKSLLGSI 1127

Query: 1129 XXXXXXXXXXXXXXXXTIDYIVDDLLGCFPEIL----ESENPFRIPFSPATSPKLGNPFE 1184
                            TID+I++DLLG F   L    +++     P SP+ S       E
Sbjct: 1128 SPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSESFDTSQEHE 1187

Query: 1185 GSDTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQ 1244
            G D    +    L  K  +    E +  DN +ID+ + ++ ++P + SY+D     F   
Sbjct: 1188 GPDDVRYDRFAQLP-KILSPNPLEQY--DNVIIDVKFLAVDLDPLICSYVDGLLGEFWKV 1244

Query: 1245 DIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEM 1304
            + V I+D+IE+ IV  L  L        N+KL ++ ++ FWGD+    + LY D++D ++
Sbjct: 1245 NTVDIIDEIEMSIVKRLGQLWNNT-CVLNLKLYVVDINFFWGDKNAKVVDLYFDKLDFDL 1303

Query: 1305 CQKMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITN 1364
             Q+  + + ET ++E   L+K+RSVRAT+ + S     +ERPPALSL +EG E +S +  
Sbjct: 1304 GQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMRE 1363

Query: 1365 AQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLA 1424
              V S+++LS DIT+DE+Q++WL  YI +Q  L + + ++   + E    TR+ L+  + 
Sbjct: 1364 KIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDIT 1423

Query: 1425 VASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMR 1484
             ASE+YQISH+PYVITKPAFI RLS GHVREN SW+IITRLRHILTYLP +W       R
Sbjct: 1424 TASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEW-------R 1476

Query: 1485 NQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKL 1544
            N       P   +   SV S+WR WE SDI RSYIYR +F    SK Q  S++  +K+  
Sbjct: 1477 NNSAIQVSPTVDSTDASVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDF 1536

Query: 1545 ASLFFTVYSTGYEVEHNFILTRTNVVVETLPAISDSSIIQ----EKIINVTGSLGTIKGK 1600
             S FFT+YS GY V HNF++TR N+V E +PA   S + Q    + ++N+T SLG IKG+
Sbjct: 1537 HSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGE 1596

Query: 1601 TSHKLINLKKLLPELSMK--KNLKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMSRVF 1658
             + +L+ L+ +  +      K  K S    + +K+N+LL F+RSELQFVLG +++ +R+ 
Sbjct: 1597 LNDQLLKLRNIFSKAQTPALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRIL 1656

Query: 1659 GGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKP 1718
             GK ++L E  K+ A+ A+S   +A+RSE W+KH +++LAE+  RE S+ +TAE WSY P
Sbjct: 1657 NGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMP 1716

Query: 1719 TVLVNLQCTDIHFRAMTATDVLAKSVGXXXXXXXXXXXXFYXXXXXXXXXXXXYPVMEQK 1778
            ++ +N+QC++ H RAMT+T++L  S+             F               +    
Sbjct: 1717 SLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPNVQGTSTNLSIPL 1776

Query: 1779 INMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTK 1838
             N  LT  F++V  E+MPL+PF  RH  KQL +Y NR+ SN++++S+WD ++ L SH T 
Sbjct: 1777 QNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTT 1836

Query: 1839 EEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLE 1898
            E+YF F+ G++Q+K N+    +  +N+ +S S++KLTL + RR++ SFLQDEK++ ESL 
Sbjct: 1837 EQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLG 1896

Query: 1899 QFSSLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSLNKI 1958
                  L Q   P    +     + WSL++N+NYFG+LVP++ST+F+ E+HMLL ++N  
Sbjct: 1897 YIKG--LLQLFSPLARNKTQSSALRWSLDANLNYFGILVPMASTFFVFEIHMLLAAMNNA 1954

Query: 1959 Q-GISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIES 2017
              G     + ++GQ SI+N   L+KE SLPADLSK+LDFSI+V + QK+  +P+S+QIES
Sbjct: 1955 SDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIES 2014

Query: 2018 PHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVI---NFKNTNNSAEVQADFP 2074
             HFRVCLSPGSL  +LW  +Q  + + Y+++H     +K I   +  + + SA+ Q DF 
Sbjct: 2015 SHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRK--QDKAISPFSLFDGSASADRQIDFR 2072

Query: 2075 SFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDT 2134
            S H+LSYN C+GW+F    D + GLIIG+ RLFSAYEK++GKLTLID YFSVANG+++DT
Sbjct: 2073 SIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDT 2132

Query: 2135 FFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLE 2194
            F+S+G EK RYNRS+L N+QI+YWLK    ++D+++R +GEAL+V+ L++  D+IES+L 
Sbjct: 2133 FYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLA 2192

Query: 2195 SIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSS 2254
            SIQKFQ LK++ +    +   + +   +    +ISPF + IR+I+CQF+Y GGV K++S 
Sbjct: 2193 SIQKFQTLKKERMHKRDS-GPRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYSL 2251

Query: 2255 AEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAE 2314
             + +    PS EIKSP V+I + Y +NE + + P  IR L++I+ THN L+++C P++ +
Sbjct: 2252 DDLNRAEGPSLEIKSPGVVIALKYNHNEAE-RRPHRIRCLVSIDPTHNILYSQCVPILND 2310

Query: 2315 FSEGIQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKV 2374
              E  Q+MV++HS D  P     S Q+IDYK +LDSFD+A +V S +Q LSL CEPRAKV
Sbjct: 2311 IVEASQRMVQKHSPDETPLE---SSQSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKV 2367

Query: 2375 QADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMF 2434
            QAD+GF SFTF VTTND     P   +LSVEK ++S++HIFSRE S SF VDF+D T +F
Sbjct: 2368 QADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIF 2427

Query: 2435 THPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSL 2494
            THP   ++ G  L+SD++VFFN+KQLQNL LFLDIW+L+  LN+K   +    +   KS+
Sbjct: 2428 THP---DVFGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDRKKQTKSM 2484

Query: 2495 SSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAY 2554
            +  +   T ++I W FTLIF+N+ GDVDLGP+LGVLSL   RTWFATDHY + R+VLHA+
Sbjct: 2485 TLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAF 2544

Query: 2555 TKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHM 2614
               +++ S+GRLSG+ +L  A+WISEVN+P   +I     +S+SL++ RV  K AFDYHM
Sbjct: 2545 ADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHM 2604

Query: 2615 FLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQ 2674
            FL+G I+ +  H+ SE D+ GI PDLL V + C+ +  C+TAL AANILDIYNT+ R+RQ
Sbjct: 2605 FLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMRQ 2664

Query: 2675 DNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEIL 2734
            DN+ISYIETL+ESN++E R  L Y DIL+SLNL++TD+S DI T   QISPISLFD E+L
Sbjct: 2665 DNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEVL 2724

Query: 2735 VVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGR 2794
            V+NI+N+SARSET +G KLKTEL +QV +A V+LSTSKEELDE+ +A IS+EDYM YA +
Sbjct: 2725 VLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYASK 2784

Query: 2795 ISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVR 2854
            ISGG I++ PRLL++MTT+QK KSD++EYL+TC F D+++V+WNLGP+NFIKEMW+TH++
Sbjct: 2785 ISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIK 2844

Query: 2855 AMAVRRSQIDVTFGPVSEEDVGKRIKKEEEF-SRFQYVPLEEPRIDMPQIRDLGDATPPL 2913
            ++AVR++Q + T   +SE+D    +  EEE  ++ QYVPL+EP I+MPQI+DLGDATPP+
Sbjct: 2845 SLAVRQTQSNKT---MSEKDKQADLDPEEEIKAKLQYVPLDEPYIEMPQIKDLGDATPPM 2901

Query: 2914 EWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSILGHSQ 2954
            EWFG++RKR PA THQ A++L+QKLVH AEKEY  + G  Q
Sbjct: 2902 EWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGRFQ 2942

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 2905 bits (7532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1436/2996 (47%), Positives = 2028/2996 (67%), Gaps = 72/2996 (2%)

Query: 7    FQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRSNVKINI 66
            F+   L  +++FSWVFLVDW              SR  AYG++FILEW LWK++ VK++I
Sbjct: 10   FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69

Query: 67   ESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPDKASANS 126
             ++RIS L GRVFFKN+ II +D TI+ LE ++TWRYWL+  RKS Y   ++   ++ +S
Sbjct: 70   GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129

Query: 127  ------------------VKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEK 168
                              +KLPCRF  E EG E+F+YNR  AYDNI+   SK ER +FEK
Sbjct: 130  GNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEK 189

Query: 169  FLNEQVFTDSKAXXXXXXXXXXXXXXXXAGTFKSDSST-TNDRVFQEELSER-PQFLDFL 226
            F+ E  F D  +                + T  +D  T  NDR FQ +  +  P++L+ L
Sbjct: 190  FMAENDFLDPSSDGSSDDKIEETS----SATNSTDEETIANDRTFQNDTRKTLPRYLEAL 245

Query: 227  PIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDI 286
            PI+  ++ GS++IGNKFTP ++I S  S   + DV +   KLDLY++++ +  K   I +
Sbjct: 246  PIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLEIMM 305

Query: 287  KQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEE--DPFYEK 344
            KQNI ++ E S  F+ D+ ++S++W +F ++       +     +SN+  E+  D F +K
Sbjct: 306  KQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIF-----KLVPFPFKSNRRKEQPHDNFMQK 360

Query: 345  WRGLSLYRGTIFGKSXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAH 404
            W+GLS+YR  +FG+            ++HEYAKF+S++++P+     + D+PG VPHGAH
Sbjct: 361  WKGLSMYRNDMFGE-FDEFDDIEFDISSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAH 419

Query: 405  PTLTATDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTK 464
            P  +  DGPDVGN+ APP++  EI I GG++C+GPWAQRQ N L  LLSP  SR AKP K
Sbjct: 420  PPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIK 479

Query: 465  RLTPGCTRIYTQFKXXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFS 524
            +L PG  RIYT  K          WRIPTRESSKD EFL HY+ETN++YRPFGWID+K S
Sbjct: 480  KLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVS 539

Query: 525  KDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNE 584
            +D+     +A CPT +GFKNT+D+ L D EIRSSVNHDI LK KSF+F  DIG+PLGWN 
Sbjct: 540  RDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNA 599

Query: 585  EATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLY 644
            EA WTI ++S QLE F+LREH+TLIADTLTDFSSGEP PYELFRPFVY I W + GYS Y
Sbjct: 600  EANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFY 659

Query: 645  LNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLN 704
            LNVNDHNIVNNPLDFNENCYLS HGD L ++++VPK+ +++ FT ++Y IYTPMFRL+LN
Sbjct: 660  LNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRLLLN 719

Query: 705  TPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVI 764
            TPPWNTLNEFM+NKEVGRSHDF++ GSYLIYSELDIDNVDT+ +ECSS+ T L  YGFVI
Sbjct: 720  TPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFVI 779

Query: 765  RYLTNVKMNYFGDFFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKAXXXXXXXXXXXXVR 824
            RYL NVKMNYFG+FFHFVTSEEYTG  R  +++N  ++ +  +D +              
Sbjct: 780  RYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNSSD 839

Query: 825  KE--QTGDSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDF 882
            K         +K+SDLKR +NETD+WFTF+VW+GA++LPETIYN DPCI LHF EL++D 
Sbjct: 840  KNPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVDL 899

Query: 883  RSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGL 942
            RSCNYYMD+LA+  DI+L+RY+GK+ +EIYE V  +NG  ++ +G+LSD+ IH HRMYGL
Sbjct: 900  RSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYGL 959

Query: 943  PPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTS 1002
            PP EPTYFCQWD   G L+++ ++ FL+G   +F KI FG  DLENILLYE E+IDDMTS
Sbjct: 960  PPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMTS 1019

Query: 1003 LTVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPI--FNLFMYTM 1060
            LT+ +  I I + + +         E   F+ I+FENE+Y  R+D++IP   FN+F    
Sbjct: 1020 LTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNIF---S 1076

Query: 1061 NGAKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEI 1120
            N      L  F+  +N +NF +  D   H+  Q++YI L+DAPYHRCAF+LP S Q S I
Sbjct: 1077 NEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRI 1136

Query: 1121 YQDLFGXXXXXXXXXXXXXXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLG 1180
            Y +LFG                  TI+Y+++DLL  +  + E    + I  S   + +L 
Sbjct: 1137 YNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDYMGLFEGN--YDIKESSVENLEL- 1193

Query: 1181 NPFEGSDTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREH 1240
            +  E +   +    +       T  D     SDN+V+ +    + INP L++ ++   +H
Sbjct: 1194 SAIEATRAITGIGAERTHSNPITLSDY-AVESDNYVVKVESIVIDINPALYTTIEKLLKH 1252

Query: 1241 FCSQDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRI 1300
               QD VQI+D IEIGIV  LS + +G+ T  N+K+QI + +LFWG++++  +S++ D++
Sbjct: 1253 IYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFFDKM 1312

Query: 1301 DLEMCQKMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWS 1360
            D  + +K LE+N+E  + E+T L KI++VR T+ +   +    ERPPA+++ +EG E WS
Sbjct: 1313 DFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEFWS 1372

Query: 1361 CITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLV 1420
                 QVNS+++ SADIT+D+AQ++W F+YI +Q     ++  +   IQ +R  ++K+L+
Sbjct: 1373 TAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQKELI 1432

Query: 1421 SKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDW-LRV 1479
            S+L  ASEYYQISHDPYVITKPAFI RLSRGHVREN+SWKIITRLRHILTYLP DW L V
Sbjct: 1433 SRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYLNV 1492

Query: 1480 IDEMRNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENS 1539
               +R+++   +  D  + F+S+FSNWR+WEFSD+ARSYIY  +F   H++K++ S++  
Sbjct: 1493 GQPLRDRKFDPS-QDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEKKKQSLQKL 1551

Query: 1540 IKLKLASLFFTVYSTGYEVEHNFILTRTNVVVETLPAIS---DSSIIQEKIINVTGSLGT 1596
             KL + + F TVYST Y+V+H+ +++   +++E  P+ +   ++S+ +E++I+++G++  
Sbjct: 1552 FKLNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGTVDV 1611

Query: 1597 IKGKTSHKLINLKKLLPELSMKKNLKPSTP----FLRCFKLNMLLLFERSELQFVLGASK 1652
            IKGK S KL+ L+KL+P L+     +P  P      + FK+N   +    ++Q V+ A+K
Sbjct: 1612 IKGKLSTKLLKLQKLIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATK 1671

Query: 1653 VMSRVFGGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAE 1712
            +   V  G++S+LWE+ +D  ++A S+ ++++ +E+ +KH N +LAE ++  F    T +
Sbjct: 1672 LNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTD 1731

Query: 1713 SWSYKPTVLVNLQCTDIHFRAMTATDVLAKSVGXXXXXXXXXXXXFYXXXXXXXXXXXXY 1772
            +W+ +PT L++ + + IHFR M  T+ L +++                            
Sbjct: 1732 TWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHPTVYD 1791

Query: 1773 PVMEQKINMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFL 1832
            P    K N++ +C F+NV+++IMP+SPF+ +++AKQ+D ++N+  S+  ++ + DTD FL
Sbjct: 1792 P---NKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFL 1848

Query: 1833 ISHLTKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKI 1892
             S  TKE+Y R S   +Q++ N+  +    ++I++S ++VKLT  + + ++ SFL+DE++
Sbjct: 1849 TSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERV 1908

Query: 1893 LIESLEQFSSLK-LFQ---RKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILEL 1948
              ES+    +LK LF     K+  P + +      WSL+S+I+YFG+L+P++STY+++E 
Sbjct: 1909 ASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEF 1968

Query: 1949 HMLLMSLNKIQGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKV 2008
            H  + S++   G  S    ++G  S++N+ FL+KE SLP  LSK++D ++ VSTLQ++  
Sbjct: 1969 HSYVSSISNANGAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDD 2028

Query: 2009 TPRSFQIESPHFRVCLSPGSLAHMLWRGNQALT-NIRYYKEHTSVAWEKVINF----KNT 2063
              RS Q+ES H R+CLSP SL  +LW  NQ    +  Y K H+   W+         ++T
Sbjct: 2029 NSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDT 2088

Query: 2064 NNSAEVQADF----PSFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTL 2119
            N+    +  F     S H LSYN CVGWLF  E     GLI GYSRLFSAYE   GKLT+
Sbjct: 2089 NSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTV 2148

Query: 2120 IDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDV 2179
            ID+YF+ A G TS TF+ + + K+ +NR YLPNMQI +W K    ++DVY+RF GE LDV
Sbjct: 2149 IDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDV 2208

Query: 2180 NFLASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDISPFFTGIRSIN 2239
             +L+ F+  IES+L SI+ FQ+LK++L+   +  +E       +P+   +     I+S+N
Sbjct: 2209 KYLSDFMLTIESTLHSIKMFQKLKKELI-VETPKREVVHIKEDKPVNSSNNILKNIKSVN 2267

Query: 2240 CQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINS 2299
            C F+YDGG + VF+ ++ S +  P+ EIKSP + +D+ YK+ ++ T+  + IR L+ I+ 
Sbjct: 2268 CHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHS-IRCLVNIDP 2326

Query: 2300 THNTLFAKCAPLIAEFSEGIQKMVKRHSSDREPSGTN-ISKQNIDYKRMLDSFDVAVEVI 2358
            THN L+A CAPL+  F E ++ +  R+ S+ + S T   S QNIDY+++L+ +D+A+ V 
Sbjct: 2327 THNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDLAITVT 2386

Query: 2359 SAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSRE 2418
            SAKQ LSL CEP+AKVQAD+GF++ T ++TTN +D +EPL F+ S++ T+ASIKH+FSRE
Sbjct: 2387 SAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRE 2446

Query: 2419 ASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNS 2478
             STSFGV ++DLT++FTH N IN  GT LISD+ ++FNVKQLQNLYLFLDIW+LS LLN 
Sbjct: 2447 TSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSELLNP 2506

Query: 2479 KPMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTW 2538
               ++    R D K  S  +    +S +PWCFTLIF+N+ GD+DLGP+LG++SL   RTW
Sbjct: 2507 VTSSQEQVIRKD-KKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTW 2565

Query: 2539 FATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSIS 2598
             ATDH+   R++LHA+   + L S+GRLSG++ +DGASW+SEV W      ++ PLV++S
Sbjct: 2566 LATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALS 2625

Query: 2599 LNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALV 2658
            LN D++E K AFDYHMFL+G +NNI   +HSE+D+ G+ PDLLKV+  CE IKLCSTALV
Sbjct: 2626 LNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALV 2685

Query: 2659 AANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYT 2718
            AANILDIYNT++R+RQD KISYIETLK+SN    +Q L Y+DIL+SL L++TD++V I +
Sbjct: 2686 AANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICS 2745

Query: 2719 LNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELDED 2778
            L +QISPISLFD E++V+N+ ++SARSETH+  KL T L M+VYDA+++LST+K+ELDED
Sbjct: 2746 LQLQISPISLFDVEVVVINVVSVSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDED 2805

Query: 2779 IIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWN 2838
             ++ I+V DYM YA +I GG IIE PR+ + MTT+Q+EKSDILEYLY+C F DK++VRWN
Sbjct: 2806 ALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWN 2865

Query: 2839 LGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRI 2898
            LGPVNF+KEMW THV+A+AVRRSQ+      VSE+DV KRIK+EE  ++  YVP+EEP+I
Sbjct: 2866 LGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQI 2925

Query: 2899 DMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSILGHSQ 2954
            DMPQI+DLGDATPP+EWFG+NRKRFPAFTHQTAV+ VQ LV+ A+K+Y   LG S+
Sbjct: 2926 DMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRSK 2981

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 2644 bits (6854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1376/3041 (45%), Positives = 1931/3041 (63%), Gaps = 131/3041 (4%)

Query: 1    MDAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRS 60
            MD  S FQ++ L + ++FSWVFLVDW               R   + ++FILEW +WKR 
Sbjct: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60

Query: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGY----DTP 116
             VKINIES+RI+PLGG + F+N+ IIH+DYTIS LE  + WRYWL N RKS Y    D  
Sbjct: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNE 120

Query: 117  EL-----PDKASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLN 171
            E       +  S +  K PCRF L  EGLEIFVYN+  +Y+NII  FSKEER QFEKF++
Sbjct: 121  EERLENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180

Query: 172  EQVFTD----------------------SKAXXXXXXXXXXXXXXXXAGTFKSDSST--- 206
            +Q  T+                                         AG  ++D      
Sbjct: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDGQAPNN 240

Query: 207  -TNDRVFQEELSERPQ-FLDFLPIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQP 264
              ND +F+++ S R   ++ FLPI       SL++GN+FTPS+++ S  +  G+ID+C P
Sbjct: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300

Query: 265  SEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSH 324
             EKLDL+K++   +       +KQNIGF+++ S  FK  R R+SK+WQ+F ++ L     
Sbjct: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFL--LPT 358

Query: 325  MKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFGKSXXXXXXXXXXXANHEYAKFSSIVRT 384
            +   HL++    E+  F E W+GLSLYR  +               ANHEYA+  SI+++
Sbjct: 359  LGPKHLQTQ---EDITFRENWKGLSLYRQNM---EEDELENVDFDFANHEYARVISILKS 412

Query: 385  PQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQ 444
             + +FT+E DIPG+VP     TL    GP+VGNSGAPPEF ++IQ+ G +IC+GPWA+RQ
Sbjct: 413  AKIVFTYEYDIPGLVPKEPEETL---QGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQ 469

Query: 445  LNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFKXXXXXXXXXXWRIPTRESSKDPEFLQ 504
            L+ L  LLSP+ SR  KP K LTPG  RIYT FK          WRIPTRE SKD EFL+
Sbjct: 470  LSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLR 529

Query: 505  HYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDIL 564
            HY ET EE+RPFGWIDLKF KD+Y       CPT+EG  N ++ H  + EIR+SVNH++L
Sbjct: 530  HYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELL 589

Query: 565  LKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPY 624
            L+ KSF+F  D+G+PLGWN++A W I+L STQLE FILREHITLI+D   DFSSG+PTPY
Sbjct: 590  LRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPY 649

Query: 625  ELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVS 684
            ELFRPF+YRINW ++GYS+YLNVNDHNIVNNPLDFNENCYLS HGD L  D+ +P++ V+
Sbjct: 650  ELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVA 709

Query: 685  AGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVD 744
               TE++Y I TPMFRL+LNTPPWNTLNEFMKNKEVGRS++F++ G Y ++SELDIDNVD
Sbjct: 710  NRCTEITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVD 769

Query: 745  TIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFFHFVTSEEYTGEIRANEVQNQ--FTD 802
            TI +ECSS  T L CYGFV+RYL NVKMNYFGDF HFVT+EEYT      E +N+    +
Sbjct: 770  TISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDE 829

Query: 803  RQLYEDKAXXXXXXXXXXXXVRKEQTGDSKIKRSDLKRATNETDLWFTFTVWEGAILLPE 862
               +   +             R    G    KRS+LKR  NE D+WF F+VWEGA++LPE
Sbjct: 830  HSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPE 889

Query: 863  TIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCG 922
            TIYN DPCI LHF EL +D RS NYYMDLLA+MN+  L+RY+ +  ++++E VR+DNG  
Sbjct: 890  TIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQ 949

Query: 923  NKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFG 982
             K +G LS + IH HRMYGLPP EPTYFCQW   +  L++N D+ F +GF+T F+KI FG
Sbjct: 950  EKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFG 1009

Query: 983  LVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKY 1042
              +LENILLYE   + DMTS+TV VK++  M+ +++  +  +  A+++ F+ I+FENE Y
Sbjct: 1010 FKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAY 1069

Query: 1043 CTRLDLRIPIFNLFMYTMNGAKKEK--LFEFETKVNLSNFEKPNDIATHKSKQQEYITLH 1100
              R+D + P  N  ++ ++  +KE   L   +T++N ++F +    A H+ +Q+EYITLH
Sbjct: 1070 SQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITLH 1129

Query: 1101 DAPYHRCAFILPPSLQDSEIYQDLFGXXXXXXXXXXXXXXXXXXTIDYIVDDLLGCFPEI 1160
            D+ Y+RC+F+LP   Q+S +Y++L G                  TIDYI++D LG +   
Sbjct: 1130 DSAYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCLGEYAPT 1189

Query: 1161 LESENPFRIPFSPATSPKLGNPFEGSDTESDEELDPLEFKTETSGDSETFASDNFVIDIS 1220
            ++ ++      S      L N  E +  +++              + + +  +N+V+D+ 
Sbjct: 1190 VKPDDSSSSDTSEGQRTPLTN--EDTRFQANSGFFSPHMPHNPPNNRDRY--NNYVLDVE 1245

Query: 1221 YCSLSINPRLWSYLDNCREHFCSQDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILY 1280
            Y +L + P +   L N  + F ++D   I+D  EI IV  L +LQ G       +L +  
Sbjct: 1246 YVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSRLHVKD 1305

Query: 1281 LDLFWGDRQNAGISLYLDRIDLEMCQKMLEENNETKITEVTFLNKIRSVRATINEA--SS 1338
            L   +   + +G+ L L+  D ++ +K +E  +E  I E T  + I ++R ++ EA  SS
Sbjct: 1306 LHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLEAHPSS 1365

Query: 1339 VGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLS 1398
            +     +P AL L IE  E+WS   +  VNS+N+ S   T+DE+Q++ +  Y+  Q+ + 
Sbjct: 1366 ISM---KPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIKVL 1422

Query: 1399 QEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRS 1458
            ++  ++ + ++  R  T+K L+  L  ASEYYQISHDPYVITKPAFI RLS GHVRENRS
Sbjct: 1423 RDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVRENRS 1482

Query: 1459 WKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDPG---NAFISVFSNWRNWEFSDIA 1515
            W+IITRLRHILTYLP DW R  D +   QDS     P    + F+SVFSNWRNW+ SDI 
Sbjct: 1483 WRIITRLRHILTYLPNDW-RTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDIT 1541

Query: 1516 RSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVYSTGYEVEHNFILTRTNVVVETLP 1575
            RSYIY+ +F   +    +  +   +K+   S FFTV  +GYEV  + I TRTN++V+ LP
Sbjct: 1542 RSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDVLP 1601

Query: 1576 AISDSS----IIQEKIINVTGSLGTIKGKTSHKLINLKKLLPELSMKK-----NL----- 1621
               ++S      QEK+I +T ++G IKG+   ++  LK+L  + S  +     NL     
Sbjct: 1602 PSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSISR 1661

Query: 1622 -----------------KPSTP--FLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKL 1662
                             + S P    R  K+   ++FER +L FV+G +++ +R+  GK 
Sbjct: 1662 SASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKN 1721

Query: 1663 SMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLV 1722
            SML E+ K+    A+S   +AQR E+W+KH   +LAE  +++  +  TA+     P V +
Sbjct: 1722 SMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQ-LGVIPFVSL 1780

Query: 1723 NLQCTDIHFRAMTATDVLAKSVGXXXXXXXXXXXXFYXXXXX-XXXXXXXYPVMEQKINM 1781
            N Q T+   RAM +T VL  SV             F               P +  K ++
Sbjct: 1781 NCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIPIKFDI 1840

Query: 1782 VLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEY 1841
                 FT+++ EIM LSPF    + KQL IY +   + +LVL   + D++L S L+ E++
Sbjct: 1841 RFN--FTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQF 1898

Query: 1842 FRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFS 1901
            F+FS  ++Q K  + +     + + +S S++KLTL + RR + + LQDE+ L+ES++   
Sbjct: 1899 FKFSSTDLQFKCEVADEVVPVVEVQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQ 1958

Query: 1902 SLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSLNKIQGI 1961
             L  F R     +     R   W+L++N+ YFGLLVP+SS  +I ELH L  SL      
Sbjct: 1959 KLWNFLRSASGGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQ 2018

Query: 1962 SSKYN-GLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHF 2020
              +Y+   SGQ  +++   L+KE SLPA+LSK+LDFSI+  T QK+  + +S+QIES +F
Sbjct: 2019 YEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYF 2078

Query: 2021 RVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLS 2080
            R+CL P  L  +LW  +   + + ++K+H +  W    + K T  S E   DF S H+LS
Sbjct: 2079 RLCLFPELLVDILWSVHYLQSLLNHFKKHHT-PWLPYSSNK-TAKSGESTLDFRSIHILS 2136

Query: 2081 YNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGH 2140
            YNFCVGWLF    ++EPGLI+GY RLFSAYEK+FGKLTLID Y SVANG TSDTF+S+  
Sbjct: 2137 YNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKS 2196

Query: 2141 EKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQ 2200
            EKD Y R+YL NMQI YWLK E LL+D+++RFHGE +DV FL++   ++E +L SI++F 
Sbjct: 2197 EKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFN 2256

Query: 2201 ELKRDLVGTASNIKEQTQSTTQEPI------GDISPFFTGIRSINCQFQYDGGVFKVFSS 2254
            E+K+  +       +QT S+T+  +        ++PF   IR+IN Q  + GGVFKV+S 
Sbjct: 2257 EMKKAKI-------KQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSP 2309

Query: 2255 AEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAE 2314
             E  +  +P  EIKSP V + +NY++NE + ++   IR   TI  THN LFAKCAPL+++
Sbjct: 2310 TELDSKAEPLLEIKSPGVQMAINYEFNETREKSHC-IRFFTTIEPTHNMLFAKCAPLLSD 2368

Query: 2315 FSEGIQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKV 2374
            F+  I+ M++  SS+ +   +     +IDYK +L+ +D+A E+ S KQ LS  CEP+AKV
Sbjct: 2369 FNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKV 2428

Query: 2375 QADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMF 2434
            Q D GF SF F VTT+  D  EP   + S++K E+S++HIFSR++S +F +D+ID+ +MF
Sbjct: 2429 QLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMF 2488

Query: 2435 THPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSL 2494
            T+P   N+ G  L+SD++++ N+KQ QNL +FLDIW+LSN   +KP     + ++D K  
Sbjct: 2489 TYP---NVYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKS 2545

Query: 2495 SSVQSKDTD----STIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKV 2550
             S     +        PW FT+IF+N+ G VDLGP+LGVL+L  ++ W  T H    ++ 
Sbjct: 2546 LSPPFSPSSNDSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRT 2605

Query: 2551 LHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAF 2610
             H +  GIT+ S+GRLSG+ ELD AS +SE++WP  + +   PL+S+S+ I+R+  K AF
Sbjct: 2606 WHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAF 2665

Query: 2611 DYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVM 2670
            DYHMFL+G++ ++ VH+H+E D   I PDLL+V++  E+I LC+TAL AAN LDIYNT+M
Sbjct: 2666 DYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANALDIYNTIM 2725

Query: 2671 RLRQDNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFD 2730
            R++QDN+ISYIETLKESN S    ++ Y+++L SLNL++TD+SV +  L + ISP+SLFD
Sbjct: 2726 RMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFD 2785

Query: 2731 AEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMH 2790
            AE+LVV++ +++ARSET +G KLKTEL++Q+ D + +LS+SKEELDE+ ++ I+V+DYM 
Sbjct: 2786 AEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIAVDDYML 2845

Query: 2791 YAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWA 2850
            YA + SGG II+ P+LL++MTT+Q++ S +LEYL+TC F DKIS++WNLGPVNFIKEMWA
Sbjct: 2846 YASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWA 2905

Query: 2851 THVRAMAVRRSQIDVTFGPVSEE-DVGKRIKKEEEF-SRFQYVPLEEPRIDMPQIRDLGD 2908
            THVR++AVRR+Q+    G  S E +V     KE+   S+F YVPL+EP I+MPQI+DLGD
Sbjct: 2906 THVRSLAVRRTQL----GNSSPELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKDLGD 2961

Query: 2909 ATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSI 2949
            ATPPLEWFG++RK  PA THQTAV+L+QKLVHTAEKEY  +
Sbjct: 2962 ATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 2556 bits (6626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1308/3021 (43%), Positives = 1900/3021 (62%), Gaps = 94/3021 (3%)

Query: 1    MDAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRS 60
            M+  SQF  I L ++K FSWVFL  W               R      +FIL W +WK+ 
Sbjct: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60

Query: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGY------- 113
             VKINIESIR+S LGG VF KN+ II+QD+T+SFLE  + WRYWLLN R+  Y       
Sbjct: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120

Query: 114  -DTPELPDKASANSV----KLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEK 168
             +  +  D +++ ++    KLPC   +E +G E+FVYNR  AY+N++  F+KEER +F  
Sbjct: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180

Query: 169  FLNEQVFTDSKAXXXXXXXXXXXXXXXXAGTFKSDSSTTNDRVFQEELSERPQFL-DFLP 227
            FLNE    D  +                     S+S+  NDR +++   ER   L +FLP
Sbjct: 181  FLNEHDLGDIVSEDTNVNSMDKDYFESVTTENSSESTVINDRTYKKNKDERKSILFNFLP 240

Query: 228  IDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIK 287
            I  ++ HG++ +GN+FTPSL++ S  +C G++DV   +EK+DLYK +  + F+   I +K
Sbjct: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300

Query: 288  QNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTC---YSHMKLSHLRSNKVSEEDPFYEK 344
             N+ ++ EF+ +  ID+ ++S++W  F  ++      ++ +   H++  +   E  F  K
Sbjct: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360

Query: 345  WRGLSLYRGTIFGKSXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAH 404
            WRGLSLY+  +                N EYAKFSSI++ P    ++  D PGIVPHGAH
Sbjct: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420

Query: 405  PTLTATDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTK 464
             T    DGPD+GNSG+PPEF +++Q+S  SI +GPW  RQ++ LIR+LSP+ S+N  P K
Sbjct: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480

Query: 465  RLTPGCTRIYTQFKXXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFS 524
            +L PG  RI+T FK          WRIPTRE SKD EF++ + +TN+++RPFGW+D   +
Sbjct: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540

Query: 525  KDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNE 584
            K T      +  PT +G  N  DIH  D E+ +SVNHDILLK K F+ V DIG+PLGWN 
Sbjct: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600

Query: 585  EATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLY 644
            +A W  D+ + QLE F+L+EHI+L +D  +DF+S +PTPYELFRPF Y +NW I GYS+Y
Sbjct: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660

Query: 645  LNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLN 704
            LNVND NIVNNPLDFNENCYLS HGD L ID ++P   +S  +TE+++ IYTPMFRL+LN
Sbjct: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720

Query: 705  TPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVI 764
            TPPWNTL+EFMK+KEVGR+ DF I GSYLIYS+LDIDNVDTI +EC+S+ST L CYG VI
Sbjct: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780

Query: 765  RYLTNVKMNYFGDFFHFVTSEEYT-----GEIRANEVQNQFTDRQLYEDKAXXXXXXXXX 819
            RYL NV+ NYFGDF HF+TSEEY+        R+N+ Q  FT    Y   +         
Sbjct: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFT----YSTTSSVQNSSSDD 836

Query: 820  XXXVRKEQT-GDSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGEL 878
                 KEQ      ++R+D+ R  NE D+WFTF VW+GA++LPE +YN + C  L F EL
Sbjct: 837  TVLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSEL 896

Query: 879  LIDFRSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHR 938
            +I FR  NYYMD L ++ D+ + R++    +EI+  VR  +   N  +G+LSD+ IHAHR
Sbjct: 897  MISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHR 956

Query: 939  MYGLPPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVID 998
            M+GLPP + TYFCQW    G+L ++ +I FL  F   F K+ FG  +LEN L+Y+ E  D
Sbjct: 957  MFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSD 1016

Query: 999  DMTSLTVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMY 1058
            DMT LT+  +K+ I++ +            +L  ++I+F+NE+Y  R++L+IP F++ ++
Sbjct: 1017 DMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIF 1076

Query: 1059 TM-NGAKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQD 1117
             + N   K  L  F+TK++ +NF    D     + Q+ YITLHD+PYHRC FILP   Q+
Sbjct: 1077 DVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQE 1136

Query: 1118 SEIYQDLFGXXXXXXXXXXXXXXXXXXTIDYIVDDLLGCFPEILESENPFR--IPFSPAT 1175
            S +Y +L+G                  TID++V+D L  + ++L  ENPF      +   
Sbjct: 1137 SFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLL--ENPFLNIRSINNLD 1194

Query: 1176 SPKLGNPFEGSDTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLD 1235
            +  L N +      S++ +   E K   + D + +  DN+++++ Y  + INP    ++D
Sbjct: 1195 TSSLFNEYRVDTYISEKAIFKAEEKNTVNYDPK-YEYDNYILNVEYIRVDINPLFSDFID 1253

Query: 1236 NCREHFCSQDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISL 1295
            +      S+++V I+D+IE+ IV  L   ++ +    N+KL+I Y+D+FWG R + GI +
Sbjct: 1254 SMSTKLYSENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGIEI 1313

Query: 1296 YLDRIDLEMCQKMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEG 1355
            YLD++D EM Q++ ++ N+  + E T L+K++S+R + +E        ERPPALSL +EG
Sbjct: 1314 YLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTVEG 1373

Query: 1356 SEIWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTT 1415
             E+WSC   AQ NS+NILS DIT+D +Q  WL +Y++KQ+     +  ++  +Q+   T 
Sbjct: 1374 LEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDVTL 1433

Query: 1416 RKQLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPID 1475
            +K L+SKL  ASEYYQI HDPYVITKPA I RLS  HVRENRSW+I+TRLRHIL YLP  
Sbjct: 1434 QKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPEG 1493

Query: 1476 WLRVIDEMRNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENS 1535
            W +        +  ++  DP N F+SVFSNWRNWE SD+ARSYIYR +F     K   N 
Sbjct: 1494 WEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEK---NL 1550

Query: 1536 MENSIKLKLASLFFTVYSTGYEVEHNFILTRTNVVVETLPAISD------SSIIQEKIIN 1589
            + N+ K+ + S +FT+YS  Y V+HN ++TR NV+++ +  +SD      ++   +KI +
Sbjct: 1551 INNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQM--LSDEEPKAATANKNDKIYD 1608

Query: 1590 VTGSLGTIKGKTSHKLINLKKLLPELSMKKNLKPSTPFL--RCFKLNMLLLFERSELQFV 1647
            +TG++GT KG+   +LI LKKL  E   K   + ST F   + FK+N++L+ E+ EL   
Sbjct: 1609 ITGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKSTDFSIPKFFKINIVLIVEKGELTLA 1668

Query: 1648 LGASKVMSRVFGGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSI 1707
               +K++SR+  GK+S  +E+ +D+A+ + S+  YA R+E+W+KH+ +IL ++ + +  I
Sbjct: 1669 AANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLFI 1728

Query: 1708 IITAESWSYKPTVLVNLQCTDIHFRAMTATDVLAKSVGXXXXXXXXXXXXFYXXXXXXXX 1767
             + AE    KPT+LVN++ + + F+A+  T  L   +                       
Sbjct: 1729 SVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKRH 1788

Query: 1768 XXXXYPVMEQKINMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWD 1827
                     +KI++       +++ EI+ LSPF+ +H+ K+L I FNR G ND + S+ D
Sbjct: 1789 TSTSPIFSTKKIDISFDINIFDISSEIVILSPFTVKHSMKELKIVFNREGDNDTIFSILD 1848

Query: 1828 TDLFLISHLTKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFL 1887
             DL+L S+    +YFR S+ +I L+  + ++ +  I I++  S++KLTL D +++  S L
Sbjct: 1849 ADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSLL 1908

Query: 1888 QDEKILIESLEQFSSLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILE 1947
            QDEK   +SLE   +L           T        + +  ++ YFGLL P+ ++YFILE
Sbjct: 1909 QDEKTFEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDLTYFGLLFPVDTSYFILE 1968

Query: 1948 LHMLLMSLNKI----QGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTL 2003
            LH LL + + +    Q +  K   ++   ++ N  F++K   +   +SK+LDFS+ +ST 
Sbjct: 1969 LHSLLATFSNVYMNPQQLKEK---ITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTE 2025

Query: 2004 QKLKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVINFKNT 2063
             K+  + RSF++ES HFRVCL+P SL  +L    Q  ++ +YYKEHT +       FK  
Sbjct: 2026 TKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQI-----FKTK 2080

Query: 2064 NNSAEVQADFP-------SFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGK 2116
              ++ V  +         S H LSYNFC+GW+F     + PGLI+GY RLFSAYE ++GK
Sbjct: 2081 KKASVVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGK 2140

Query: 2117 LTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEA 2176
            LT++D +FS+ANG +SDTF+S+G+EK++YNRSYLPN+QI YWLK    ++ +++RF+GE 
Sbjct: 2141 LTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGET 2200

Query: 2177 LDVNFLASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDISPFFTGIR 2236
            +DV FL++F  +I  ++ES+Q FQ +K++ V    N++ + +    +     S FF+ ++
Sbjct: 2201 IDVRFLSNFATIINLTIESVQHFQMIKKETVREM-NVEAEKKVGEDDISTKFSLFFSKVQ 2259

Query: 2237 SINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLIT 2296
             INCQ  YDGGVF V+         + + EI +P VIID++YKY     + P WIR+ I 
Sbjct: 2260 RINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKY-RIDMKKPHWIRSFIN 2318

Query: 2297 INSTHNTLFAKCAPLIAEFSEGIQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVE 2356
            I  T+NTL ++ A  + EF E + +MV + S   +P         IDYKR+L+ FDV+  
Sbjct: 2319 IEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRILEDFDVSFS 2378

Query: 2357 VISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFS 2416
            + + KQ +SL CEP AKV A++GF+SF F++ TND DP EPL  +L+V   + SI H FS
Sbjct: 2379 ISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFS 2438

Query: 2417 REASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLL 2476
             E + SF VDF+D+T +FTHP   +I GT LISDV ++FN+KQLQNL +FLDIW L  L+
Sbjct: 2439 TEPTASFSVDFVDITTLFTHP---DIYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLI 2495

Query: 2477 NSKPMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKR 2536
              +P   V   + + +  SS +S    + IPW FT+I ++INGD+ LGP+LG LSL  K+
Sbjct: 2496 KLRPQKSVPVKKPESRVSSSTKSSSNTTIIPWSFTVIITDINGDIHLGPSLGNLSLKLKK 2555

Query: 2537 TWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVS 2596
             W +T+H++  RK L  +T  ++LTS GRL G++++   SWI  V +   E ++  PLV 
Sbjct: 2556 NWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVD 2615

Query: 2597 ISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTA 2656
            I+LN++ V  K AFDYHMFL+G ++NI  ++ SEKD+ G  PDLLK++++C+ I +CSTA
Sbjct: 2616 ITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTA 2675

Query: 2657 LVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDI 2716
            LVA+NILDI NT+ R RQD++ SYIETL ESN    + ++ Y DIL+SLNL++TDV ++I
Sbjct: 2676 LVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEI 2735

Query: 2717 YTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELD 2776
            + + +QISPISLFD E++V  +EN+SARS T +G KL T+L+M++Y A+++LS S EELD
Sbjct: 2736 HKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELD 2795

Query: 2777 EDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVR 2836
            E+ ++ ISV+DYM YA ++SGG I+  P+L + MTT+Q E S I+EYL+ C F DKISVR
Sbjct: 2796 EEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVR 2855

Query: 2837 WNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGP-------------VSEEDVGKRIKKE- 2882
            WNLGPVNFIKE+WATHV+++AVRR+Q+     P             VS E++ + ++ E 
Sbjct: 2856 WNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGEPSPLVSSEEL-EMLRSES 2914

Query: 2883 ----------EEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAV 2932
                       E  +F YVPL+EP+I+MP+I+DL DATPPLEWFG+NRK+FP  THQTA+
Sbjct: 2915 SNADNDNNEYSEEDKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAI 2974

Query: 2933 ILVQKLVHTAEKEYGSILGHS 2953
            IL+QK+VH A+KEY  +LG S
Sbjct: 2975 ILIQKIVHVAQKEYAKVLGDS 2995

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 2331 bits (6040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1166/2572 (45%), Positives = 1667/2572 (64%), Gaps = 48/2572 (1%)

Query: 417  NSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQ 476
            N  APPE ++E Q+   SI +GPWA R + ++ R+ SPI SR  +      PG  R YT 
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 477  FKXXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQC 536
             K          WR+PTRE SKD +FL+ Y +TN+  R FGW DL FS+++     ++  
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 537  PTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQ 596
            P   G+ N L++   D E+RSSVNHDI  + KS+    DIG+PLGWN+E TW+   +S Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 597  LEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNP 656
            LE F LREH+ LIADT +DFSSGEPTPYE FRP +Y+++W  +GYS YLNVNDHNI+NNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 657  LDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMK 716
            LDFNENCY+S HGD   I + +P+  ++A +T++ + I TPMFRL+LNTPPWNTLNEFM+
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 717  NKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFG 776
            NKE+GR +DF   GSY+IYS+LDIDNVD++ IECS++   L  YGFVI YL NV+MNYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 777  DFFHFVTSEEYTGEIRANE--VQNQFTDRQLYEDKAXXXXXXXXXXXXVRKEQTG----- 829
            +F HF+T+EEYT  +R N+  + +   D  +  +                  ++      
Sbjct: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSKSNIIDPL 1009

Query: 830  -DSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYY 888
             +  +++ D+KR  NETD+WFTF+VWEGA+LLPE +YN DPCI L F EL+IDFR+C+YY
Sbjct: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069

Query: 889  MDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPT 948
            +DLLA++N  S +R I K QN+I+E V  +     +++GS+S++ IH HRMYG PP  P+
Sbjct: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129

Query: 949  YFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVK 1008
            YF  W   +  L +N DI F+ GFI+   K+ F   +L+NILLY++ V+D+MTS+TV   
Sbjct: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189

Query: 1009 KISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEK- 1067
             I I++ +      +L   + + F+ INF N++Y +R+DL++P  + F +  NG+  +K 
Sbjct: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLH-FAFFDNGSSMDKT 1248

Query: 1068 -LFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFG 1126
             LFEF+TK+N +NF +  D   H  KQQE+I L+D+ +HRC+F+L P +Q+S +Y +L+G
Sbjct: 1249 CLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYG 1308

Query: 1127 XXXXXXXXXXXXXXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGS 1186
                              TI +I+DD LG F       N   +  S +TS  + +  +  
Sbjct: 1309 GITPSSSVPPLPIPVQAETIAFIIDDFLGPF-----GINSTELLGSISTSTPIHSSNKPL 1363

Query: 1187 DTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDI 1246
               S   + P+E        S++    N++IDISY +L INP  ++Y  N  + F S++I
Sbjct: 1364 KPPSSSVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSENI 1423

Query: 1247 VQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQ 1306
            ++ +D IE+ IVN L    E +++  NIKLQI YLD F+G R   G+ LY+D+IDLE+ Q
Sbjct: 1424 IETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEVSQ 1483

Query: 1307 KMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQ 1366
            K  ++ +   + E+  L++  S+RA+INE   +   DERPPALSL +EG E WS   ++Q
Sbjct: 1484 KTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTASSQ 1543

Query: 1367 VNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVA 1426
            VNSLNI S DIT+DE+QI+WL  Y+++ +    E+ ++L SIQ+  +  +K+LVS L +A
Sbjct: 1544 VNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLTLA 1603

Query: 1427 SEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDW-LRVIDEMRN 1485
            SEYYQISHDPYVITKPA++ R+S+GHVR+NRSW+I+TRLRHI TYLP DW + V +EMR 
Sbjct: 1604 SEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEMRG 1663

Query: 1486 QQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLA 1545
            + D + + D  + F++VFSNWRNWE SD+ARSYIY+ +F        E  ++ ++KL L 
Sbjct: 1664 K-DMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLNLN 1722

Query: 1546 SLFFTVYSTGYEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKL 1605
            S+FFT+YSTGY ++HN ILT+  +++E     + S  I++ I+N+TGSLG+IKG+ S K 
Sbjct: 1723 SIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILNMTGSLGSIKGEFSDKF 1782

Query: 1606 INLKKLLPELSMKKNLKPST----------PFLRCFKLNMLLLFERSELQFVLGASKVMS 1655
            + L +L+P+ S ++++K  T          P+   F +++ LLFE   LQ  +G + + +
Sbjct: 1783 LRLLELIPDFSKEEDIKSLTENSSIVSEKSPY---FTIHLFLLFENGGLQLTMGDTTLSN 1839

Query: 1656 RVFGGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWS 1715
             V  GK+S L E        + S   Y ++SEM +KH+  I+AE Q+    +I T     
Sbjct: 1840 NVTDGKISALLEKSSYSKEFSYSGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIYTP 1899

Query: 1716 YKPTVLVNLQCTDIHFRAMTATDVLAKSVGXXXXXXXXXXXXFYXXXXXXXXXXXXYPVM 1775
              P +L+NL+  D+HF+++ +T+ + K++             +                 
Sbjct: 1900 ICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTKPTKVDQKPE 1959

Query: 1776 EQKINMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISH 1835
            +   ++ + C  + V+ E+  +SPF  R+  KQLD+YFN+ G  +++LS+WDTD+F+ SH
Sbjct: 1960 KINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFVTSH 2019

Query: 1836 LTKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIE 1895
             TKE+YFRFS+ +IQ+  N +   N  + + +SAS+VKLT  + RR+  SFLQDE+I IE
Sbjct: 2020 HTKEQYFRFSYDDIQINCNPMSEKNKVLVVSLSASLVKLTFSEPRRIFASFLQDERITIE 2079

Query: 1896 SLEQFSSLK--LFQR----KKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELH 1949
            S ++   LK   F      KK      K      W+LE NINYFG+L+PI+ST+F+LELH
Sbjct: 2080 SFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFFVLELH 2139

Query: 1950 MLLMSL-NKIQGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKV 2008
            MLL SL N  + I    N +SGQ S++N+ FL+ ++SLP  LSK++DFSI++STLQK   
Sbjct: 2140 MLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQKTTS 2199

Query: 2009 TPRSFQIESPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVINFKNTNNSAE 2068
            +  S QIES HFR+C SP SL  +LW   Q    + YYK+H +     + + K    S+ 
Sbjct: 2200 SYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLSSHKTGTKSST 2259

Query: 2069 VQAD---FPSFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFS 2125
             ++    F S H+LSYNFC+GW+      + PG + GY RLFSAYEKN+GKLTLI+ Y S
Sbjct: 2260 SESPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMS 2319

Query: 2126 VANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASF 2185
            V N  +S+ FFS+G EK+R+NRS+LP+MQI YWLK     +D+++R HG+ALDV+ L++F
Sbjct: 2320 VTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDILSNF 2379

Query: 2186 IDVIESSLESIQKFQELKRD-LVGTASNIKEQTQSTTQEPIGDISPFFTGIRSINCQFQY 2244
            +++IE   +S Q F++ ++  +V      K      ++     +  F + I SINC+F+Y
Sbjct: 2380 VNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSENATEFVPTFLSDINSINCEFKY 2439

Query: 2245 DGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTL 2304
            +GG  +VFS  +      PS E+ +P V I +NYK+ +   + P W+R +I I+S+HN L
Sbjct: 2440 EGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPK-PHWLRCVIDIHSSHNIL 2498

Query: 2305 FAKCAPLIAEFSEGIQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLL 2364
            ++KCAP + EF E IQ++++    + + S + I+  N  YKR+L  FD+A  + +AKQ+L
Sbjct: 2499 YSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNRTYKRILAPFDIAFRIKAAKQML 2558

Query: 2365 SLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFG 2424
            S  CEP AKVQA++G  SF F ++T     E+PL   L + K   S++HIFS+EAS SF 
Sbjct: 2559 SFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASASFS 2618

Query: 2425 VDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEV 2484
            ++FIDLT +FT P    +   GLISD+ +FFN+KQ QNL LFLDIW LS  +  +P  + 
Sbjct: 2619 LNFIDLTFIFTQPT---LYCVGLISDIDIFFNMKQQQNLLLFLDIWHLSESIGIRPNRKK 2675

Query: 2485 VKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHY 2544
             K +         ++      IPW F +IF+N+N D+ LGP LG++S   ++TWF +D Y
Sbjct: 2676 RKHKKHKGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFISDRY 2735

Query: 2545 KSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRV 2604
               R++L  +T G+ L S+GRLSG+L++  A W  EVN+   E   + P+V+I ++I  V
Sbjct: 2736 LDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDIGCV 2795

Query: 2605 ETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILD 2664
              K AFDYHMF++  +NNI   +HSE+D  G  PDLL   ++CE I +CST LVA+NILD
Sbjct: 2796 ALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDLLLTTLLCEEISICSTTLVASNILD 2855

Query: 2665 IYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQIS 2724
            IYNT++R RQD K SY ETL ESN  + R  + Y DIL+SLNL++TDV +D+  L +QIS
Sbjct: 2856 IYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQLQIS 2915

Query: 2725 PISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATIS 2784
            PISLFD E+LV+NI+N+SARSET + +KLKT LE+QV +ASVALST+KEELDE+ +  IS
Sbjct: 2916 PISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKEELDEESVNKIS 2975

Query: 2785 VEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNF 2844
            V DYM YA +I GG I+  P+LL+ MTT+QK  S+ +EY +TC F  K+SVRWNLGPVNF
Sbjct: 2976 VADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNF 3035

Query: 2845 IKEMWATHVRAMAVRRSQID--VTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQ 2902
            IKEMWATHV+++AVR+++I+  V +     E   + I  E    +F YV L EP I+MPQ
Sbjct: 3036 IKEMWATHVKSLAVRQARIEEPVEYSSEELESSPESIYLEPAQPKFTYVALVEPSIEMPQ 3095

Query: 2903 IRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSILGHSQ 2954
            I+DL DATPP+EWFGLNRK+FP+FTHQTAVI+VQKLVH  EKEY  I+GHS+
Sbjct: 3096 IKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIGHSE 3147

 Score =  148 bits (374), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/175 (40%), Positives = 107/175 (61%), Gaps = 7/175 (4%)

Query: 6   QFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRSNVKIN 65
           +F  + L+++K FSWVFLV W               R  AY ++FIL+W LW+   VKI+
Sbjct: 6   KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIH 65

Query: 66  IESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPE-------L 118
            ESIR+S L  R+ FKN+ II ++ TIS LE  + W+YWLLN R S Y+  +       +
Sbjct: 66  CESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYI 125

Query: 119 PDKASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQ 173
              +   +++LPC+F  + EG EIFVYN+  AY+NII  FS +E+ ++++FL++ 
Sbjct: 126 TPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 110/190 (57%), Gaps = 12/190 (6%)

Query: 223 LDFLPIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSE-KLDLYKLRFLLDFKT 281
           L+F P   K++ GS+I GNKFTPSL+I S  S  G++DV   +  ++DLYK++  LDF+ 
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357

Query: 282 FAIDIKQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVL------LTCYSHMKLSHLRS--- 332
           F I++K NI + ++   K     + +S++W +F+ +       L+ Y H    H  S   
Sbjct: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417

Query: 333 -NKVSEEDPFYEKWRGLSLYRGTIFGKSXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTF 391
            + + E++ F +KW+GLSLY+     +             NHEYA++ SIV+ P+ IFT 
Sbjct: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFL-NHEYARYCSIVKAPRLIFTN 476

Query: 392 ECDIPGIVPH 401
           E DIPGIVP+
Sbjct: 477 EYDIPGIVPY 486

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 2285 bits (5922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1209/3058 (39%), Positives = 1813/3058 (59%), Gaps = 126/3058 (4%)

Query: 5    SQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRSNVKI 64
            ++F  + L++++ FSWVFLV W              ++   +G++F  EW LWK  N+K+
Sbjct: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65

Query: 65   NIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYD--------TP 116
             IESIR+S L G +FFKNV +I QD TIS LE +VTWRYWLLN RKS Y+         P
Sbjct: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKP 125

Query: 117  ELPDKASANSV----------------------------------------------KLP 130
               D    N++                                              KL 
Sbjct: 126  NGDDMLDNNTIHDRSNNDNNDNNDNNDNNDNNNNNDNNDNNETNNYNDIDYDYNKNKKLD 185

Query: 131  CRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLN--------EQVFTDSKAXX 182
              F +   G EIF+YNR  AY+ II  FSKEE+ QF  FL         E+V ++ K   
Sbjct: 186  SLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCN 245

Query: 183  XXXXXXXXXXXXXXAGTFKSDSSTTNDRVF----QEELSERPQF---------------L 223
                            + KSD  + ++       QE  S+R                  L
Sbjct: 246  EYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAHIMRKLHL 305

Query: 224  DFLPIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFA 283
            D LP+D  ++ G++ IGNKFT SL++ + +   G++D   P  KLD++K +   +     
Sbjct: 306  DILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDID 365

Query: 284  IDIKQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYE 343
            + IK+NIG+N E + +F      ++++W     VL    +    +   S +  E+  F +
Sbjct: 366  MSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFVK 425

Query: 344  KWRGLSLYRGTIFGKSXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGA 403
            KW GL LY+ ++   +           ANHEYAK S+  + PQ IF+ E DIPGIVPHG+
Sbjct: 426  KWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHGS 485

Query: 404  HPTLTATDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPT 463
            HP L+   GPD+GN  +PP F +++Q+S  SI FG W  R +  L  L+ P+ S++ KP 
Sbjct: 486  HPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKPL 545

Query: 464  KRLTPGCTRIYTQFKXXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKF 523
             +L PG TR+++ F            R+PTRE SKD +FL+ Y ET +++R FGWIDL F
Sbjct: 546  NKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLSF 605

Query: 524  SKDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWN 583
             K +     +   PT  GF+NTL     + E+ +SVNH++L K  S N   +IG+PLGWN
Sbjct: 606  KKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGWN 665

Query: 584  EEATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSL 643
            +   W  ++ S QL+ F+LREHITL++D + DFS+ EPTPYELFR F Y +N KI GYS 
Sbjct: 666  DPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYSF 725

Query: 644  YLNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVL 703
            Y NVND NI+NNPLDFNENCYLSFHGD+   ++ +P   ++  +  +SY I+TPMFRL L
Sbjct: 726  YFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLFL 785

Query: 704  NTPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFV 763
            NTP WNTL+EFM+NKE+GRSHDF+++G+YLIYSELDIDNVD++ I+  S STVL C+GFV
Sbjct: 786  NTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGFV 845

Query: 764  IRYLTNVKMNYFGDFFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKAXXXXXXXXXXXXV 823
            I+Y+ N + NYFG F  F+T+EEY+  IR N   N  +      D               
Sbjct: 846  IKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSINT--NDLTSIEGLQKMDSITN 903

Query: 824  RKEQTGDSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFR 883
              E      IKRSDL R  NETD+W  F V +GA++LPE +YN D C+ L FGEL I+ R
Sbjct: 904  DVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFINMR 963

Query: 884  SCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLP 943
            +CNYYMD+  ++ D +L R+     +E++E ++  N   + + G++SD+ IH HRMYGLP
Sbjct: 964  TCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVE-GNISDITIHGHRMYGLP 1022

Query: 944  PLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSL 1003
            P E TYFCQW  ++GT  ++ D+ FL  FI S NKI F L + EN LLYE + ++DMT L
Sbjct: 1023 PKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMTLL 1082

Query: 1004 TVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMN-G 1062
            +VDV+ + +++ +  ++      A  +   NI+FENEKY  RLD+    F   + ++   
Sbjct: 1083 SVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLKID 1142

Query: 1063 AKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQ 1122
            + K+ + +  TK+N++NF K ++   H   Q+++I LHD+PYHRC F+LP   Q+S  Y+
Sbjct: 1143 SGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESSSYK 1202

Query: 1123 DLFGXXXXXXXXXXXXXXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNP 1182
            +L+G                  T ++IV+ +L  + E L S++  ++  +   +     P
Sbjct: 1203 ELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELNSVDTTP 1262

Query: 1183 FEGSDTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFC 1242
             + S    D ++   +    T    ET   DNFV+++ Y ++++NP +   ++     F 
Sbjct: 1263 LKDS---FDMQITNFQNILTTEDPYET---DNFVVNVKYLTVTVNPDIVFTIEKFSTEFN 1316

Query: 1243 SQ-DIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRID 1301
             +  +   +D IE+ IVN LSDL+E I +  N+ L +  +D  WG R    I  Y++ + 
Sbjct: 1317 KKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYINMLK 1376

Query: 1302 LEMCQKMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSC 1361
             E+ Q+    NN     ++T L K RSVR  I   S    +D+RPP LSL++EG E WS 
Sbjct: 1377 FELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAWSS 1436

Query: 1362 ITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVS 1421
             T  Q+ +LN+ S DIT+DE QI WL  Y+  Q+ L  +I  +++ I + +++ +K  ++
Sbjct: 1437 TTTKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFIT 1496

Query: 1422 KLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVID 1481
             L  A E YQI HDPYVITKPA + RLS  H+RENRSW+I+T+LRHILTYLP DW   +D
Sbjct: 1497 SLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYLPEDWEDRLD 1556

Query: 1482 EMRNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIK 1541
            E    + S    +  + F++VFSNWRNWE SDI +SYIYR +F E  SK+    ++NSIK
Sbjct: 1557 EEDLIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSKR---ILQNSIK 1613

Query: 1542 LKLASLFFTVYSTGYEVEHNFILTRTNVVVET-LPAISDSSII--QEKIINVTGSLGTIK 1598
            + L + +FT+YS  Y  + NF++T+ N+++      +++  +I  QE+I++V   +G+IK
Sbjct: 1614 VFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIGSIK 1673

Query: 1599 GKTSHKLINLKKLLPELSM----KKNLKPSTPFLRCFKLNMLLLFERSELQFVLGASKVM 1654
             + +  ++ LK+ + ++       K+        + FK+N+  +F+  +       S + 
Sbjct: 1674 FEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNSSLK 1733

Query: 1655 SRVFGGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESW 1714
            SR+    +   +E+  + ++ + S   YA R+ + +KH N IL + Q+R      TAE  
Sbjct: 1734 SRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAELH 1793

Query: 1715 SYKPTVLVNLQCTDIHFRAMTATDVLAKSVGXXXXXXXXXXXXFYXXXXXXXXXXXXY-P 1773
            S   ++++N +C+++HF+++  T++   ++                           + P
Sbjct: 1794 SAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTP 1853

Query: 1774 VMEQ-----------KINMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLV 1822
             + +           K N+ L+  FTNV+ EI  L P   +H    ++I +N +  ++L+
Sbjct: 1854 SVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDELL 1913

Query: 1823 LSVWDTDLFLISHLTKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRL 1882
            + V DTDL+L S  TKE+Y R S+  ++L   + +     I++++S+SI+KLT  D RR+
Sbjct: 1914 VQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPRRM 1973

Query: 1883 IPSFLQDEKILIESLEQFSSLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISST 1942
            + SFLQDEK L  SL    SL+   RK  +  +E    +  W +     Y G+L+PI +T
Sbjct: 1974 LFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSYEWIVNFKSKYMGVLLPIQAT 2033

Query: 1943 YFILELHMLLMSL-NKIQGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVS 2001
            Y++ ELH  L ++ NK +  S+ +    G  S D++ FL+K++S+P   SKILDFSIK+S
Sbjct: 2034 YYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFSIKLS 2093

Query: 2002 TLQKLKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVINFK 2061
            T + +    RSF+IES  FRVCL+P SL   +W   Q L  +  Y + ++V +  V N  
Sbjct: 2094 THRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLNSYYDQSTVNF-FVFNDN 2152

Query: 2062 N----TNNSAEVQADFPSFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKL 2117
            N    TN+  E      SFH+LSYNF +GWL+    +  PGLI+GY+RLFS YE N GKL
Sbjct: 2153 NIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKL 2212

Query: 2118 TLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEAL 2177
            TL+D +FS+ANG + DTF+S G E  ++NRSYLPN+QI YW+K    ++ ++++FHGE L
Sbjct: 2213 TLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETL 2272

Query: 2178 DVNFLASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDI-SPFFTGIR 2236
            DVNF  +F+++IES++ SI  FQ LKR+ +      K +    +   + +I  P F  ++
Sbjct: 2273 DVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIKGPIFGKLK 2332

Query: 2237 SINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLIT 2296
             +NC+F YDGG+F++FS+A  +N L+P+  IKSP V I ++Y Y EK+ +   WI  LI 
Sbjct: 2333 QVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELK-KHWINCLID 2391

Query: 2297 INSTHNTLFAKCAPLIAEFSEGIQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVE 2356
            I  T N L + C P +++F   I+ +V+    + E +  N  K  I+   +L++FD+  +
Sbjct: 2392 IEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINITSLLENFDICFK 2451

Query: 2357 VISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFS 2416
            +IS  Q ++L CEP+AK+  D+GF SF F++ T   +P +PL  +L +   + S+KH FS
Sbjct: 2452 LISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFS 2511

Query: 2417 REASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLL 2476
             EAS SF V  +D+ ++FTHP    + GTGL+ DV + FN+KQ QN+ +FLDIW +S   
Sbjct: 2512 NEASASFEVSKLDVILIFTHP---EVFGTGLVDDVKLHFNLKQFQNISIFLDIWDVSKST 2568

Query: 2477 NSKPMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKR 2536
              K   +   +  D KS    Q+    ST+PW F  I +NINGD+++G TLG L+L+ +R
Sbjct: 2569 EKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQR 2628

Query: 2537 TWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVS 2596
            TW +TDH+ + R++LH +T  + ++S+GRL G +E+D  +W  +VN+         PLV 
Sbjct: 2629 TWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVSPLVD 2688

Query: 2597 ISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTA 2656
            +  ++ +V  KVAFDYHMFL+  + ++  H+ SEKDI+ I PDLL VN+ C+ IK+C+TA
Sbjct: 2689 LLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTA 2748

Query: 2657 LVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDI 2716
            LVA+NILDIYNT+MR RQDNK SYIETL ESN +  ++   Y+DIL+SLNL+QT +S +I
Sbjct: 2749 LVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANI 2808

Query: 2717 YTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELD 2776
            + LN+QISP SL+DAE++++ ++++ + +ET  G K+KT+LEM+VY+A+++L++  +EL 
Sbjct: 2809 HELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELT 2868

Query: 2777 EDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVR 2836
            E+ IA +S E Y+ YA  ++ G I E P+L I MTT+Q   + IL+Y Y+CSF  K+ V 
Sbjct: 2869 EEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVT 2928

Query: 2837 WNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEP 2896
            WNLGP+NFIKE+WATHVR++ VR  Q  +    +S E+ G   +  +  S  +Y+ LEEP
Sbjct: 2929 WNLGPINFIKEVWATHVRSLEVRTVQF-MGNHDISLENEGDTDESVKVLSNIEYIALEEP 2987

Query: 2897 RIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSILGHSQ 2954
             I+MPQI+DL DATPPLEWFGLNRK FP+ THQ+ ++ +QKLV+ A+KEY  +LG S+
Sbjct: 2988 YIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLGSSK 3045

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 2199 bits (5698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1199/3026 (39%), Positives = 1786/3026 (59%), Gaps = 104/3026 (3%)

Query: 1    MDAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRS 60
            MDA SQF+ IP++K+ +FSWVFLVDW               R LAY I+ +++W LW+R 
Sbjct: 1    MDAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRY 60

Query: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELP- 119
             VKINI+S++IS LGGRVFFKN+ +I +D TISFL+ + TWRYWLLN RK+  +  E   
Sbjct: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKSG 120

Query: 120  DKASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSK 179
            ++    S  L CRFFLE +G E+F+YNR VAYD I+   +K+++  F+KF       +  
Sbjct: 121  EEKDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFF------EGG 174

Query: 180  AXXXXXXXXXXXXXXXXAGTFKSDSSTTNDRVFQEELSERPQFLDFLPIDFKVSHGSLII 239
                             + +  S+  +TNDR FQE+ S R   L FLPI  KV+ G++++
Sbjct: 175  EDSLHSSEEKLEDETLASDSSVSNVDSTNDRNFQEQDS-RSMLLQFLPIHLKVNRGAVLL 233

Query: 240  GNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMK 299
            GN  TPS+MI    S  G++DVCQ +EKLDLYK+R+ LDF    + IK NI F +E  +K
Sbjct: 234  GNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIK 293

Query: 300  FKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVS--EEDPFYEKWRGLSLYR----- 352
              I  +R+S++W++F K+     SH  L+H  + K+   +   F+EKWRGL+LY      
Sbjct: 294  SYIVHSRMSRVWKKFKKIFFERMSHY-LAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVT 352

Query: 353  ---GTIFGKSXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTA 409
                ++  +             NHEYAK++ I+++ +   T+  DIPG+VPHGA  T+  
Sbjct: 353  TSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQ 412

Query: 410  TDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPG 469
             DGPDVGNSGAPPEFSL+ ++ G +IC+GPWA RQ+  L R+L PI SR+A P K+LTPG
Sbjct: 413  RDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPG 472

Query: 470  CTRIYTQFKXXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYI 529
              RIYT+F           WRIPTRESSKD +FL+ YRE+  + RPFGW+D+K +K+T +
Sbjct: 473  SRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDL 532

Query: 530  CSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWT 589
              TV  CPT  GF+N L  HL   EIRSSVNHDI  K  +     D+G+PLGWN EA W 
Sbjct: 533  FMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWV 592

Query: 590  IDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVND 649
                S Q+  F LR+HI L++D   DF SG PTPYELFRPFVYR  W I+ YS+YLNVND
Sbjct: 593  FQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVND 652

Query: 650  HNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWN 709
             NI+NNPLDFNENCYLS HGD L+ID  V  + ++   T V+Y+I TP F L L+TP W+
Sbjct: 653  ANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWS 712

Query: 710  TLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTN 769
            TL+EFMKNKEVGRS+DF + GSY  +S++D+ N+DTI+IEC S+ T LQC GFVIRYL N
Sbjct: 713  TLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMN 772

Query: 770  VKMNYFGDFFHFVTSEEYTGEIR-------ANEVQNQFTDRQLYEDKAXXXXXXXXXXXX 822
            + MNYFGDF HF T+EEYT E++       A  + +  +D                    
Sbjct: 773  INMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEY 832

Query: 823  VRKEQTGDSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDF 882
               E   D K+KR+DLKR  NE D+WFTF V +G ++ PE IY+C  CIGLHF  L +D 
Sbjct: 833  DLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDL 892

Query: 883  RSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGL 942
            R  NYYMDL AS++   ++R+       I++ VR   G  +   G LS++ IHAHRM+GL
Sbjct: 893  RYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFGL 952

Query: 943  PPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTS 1002
            P +E TYFC+WDF +G+LD++ DI F +G I +F+KI FG  D EN+L+YE     DMTS
Sbjct: 953  PIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTS 1012

Query: 1003 LTVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNG 1062
            LT+    IS  + +   +  +    +++  S I+FENE+Y  ++  +IP   L + +   
Sbjct: 1013 LTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLV-SEKS 1071

Query: 1063 AKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQ 1122
            +K E    FET ++L+ F +  D   H++ Q+ +ITLHD+PYHRCAF+LP   Q + +Y 
Sbjct: 1072 SKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLYN 1131

Query: 1123 DLFGXXXXXXXXXXXXXXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNP 1182
             LFG                  TID I + LLG   +  E  +        A + +  + 
Sbjct: 1132 KLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKETAITEENSSF 1191

Query: 1183 FEGSDTESD-EELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHF 1241
             +GS + S  +EL        +      F  D+F+I++    ++INP     L +    F
Sbjct: 1192 IQGSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQF 1251

Query: 1242 CSQDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDL---FWGDRQNAGISLY-- 1296
            C   I  I+D  EI IV   S  +  +E +    L++L   +   F   +    +S Y  
Sbjct: 1252 CVGSIDDIIDANEIDIVEKFS--KYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSDYDH 1309

Query: 1297 ----LDRIDLEMCQ-KMLEENNETKI---TEVTFLNKIRSVRATINEASSVGKADERP-P 1347
                ++   L++CQ K+  + N +K+    EVT   K  S+   IN+     K   +  P
Sbjct: 1310 LYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVTSSLKASSINFFINQQQLKPKTLLKARP 1369

Query: 1348 ALSLVIEGSEIWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQS 1407
              S+V E  E WS  + +  NSLN  + D  ++ +Q++WL  Y+   +  + ++ ++   
Sbjct: 1370 VFSIVFEELEFWSDSSESSKNSLNARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSK 1429

Query: 1408 IQESRSTTRKQLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRH 1467
             +      +K+L+ + A+AS  Y I HD  VITKPA+ITRLS+ H+RENRSW+IITRLRH
Sbjct: 1430 SKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRH 1489

Query: 1468 ILTYLPIDWLRVIDEMRNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEG 1527
            IL YLP  W +  +E   +++     D  + F+ +FSNWR+WEFSD+ + YIY+ +F   
Sbjct: 1490 ILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFL-S 1548

Query: 1528 HSKKQENSMENSIKLKLASLFFTVYSTGYEVEHNFILTR------TNVVVE-TLPAIS-- 1578
             S K+        K+ L  + F++ S+ +E E +F++ +      +N ++E +LP  +  
Sbjct: 1549 RSMKKNRITGADFKVNLERISFSLSSSTHEDE-DFMVVKNLKSVISNELIESSLPPSAKN 1607

Query: 1579 -DSSIIQEKIINVTGSLGTIKGKTSHKLINLKKL-----------LPELSMKKNLKPSTP 1626
             + S   EK+I ++ ++ +I+G     ++ L ++           L   S+K ++KP   
Sbjct: 1608 TEDSASTEKMI-ISCNIKSIRGDLGDNIVKLVRMYDGLSNLSDTNLKTTSVKHDVKPKL- 1665

Query: 1627 FLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPKDLASKAISMTVYAQRS 1686
                  +  +LL +R++    L   +++ R F  + S   E     +   +S+      S
Sbjct: 1666 ------IQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLAATCASS 1719

Query: 1687 EMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCTDIHFRAMTATDVLAKSVGX 1746
            E W++H + +L ES +++ ++  +   +       V L+   +   AM +T+     +  
Sbjct: 1720 EAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAMASTEQYIHFIWS 1779

Query: 1747 XXXXXXXXXXXFYXX--XXXXXXXXXXYPVMEQKINMV-LTCYFTNVNLEIMPLSPFSFR 1803
                                        P    ++N V L    +  +L I PL+PF   
Sbjct: 1780 IKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNIQPLTPFGIH 1839

Query: 1804 HNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLK-GNILENPNYT 1862
             +   ++++  +    +  +++ D D+ L+S  +K+ Y +FS   + L   N  E     
Sbjct: 1840 QSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVISNTPEQNAMF 1899

Query: 1863 INIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSL-KLFQRKKPAPSTEKSGRT 1921
            +N+ V++ I KLT+ D R  I S ++DE + I++  Q  SL + F  K    S ++    
Sbjct: 1900 LNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKNQEKSKQRKQTN 1959

Query: 1922 VTWSLESNINYFGLLVPISSTYFILELHMLLMSL-NKIQG---ISSKYNGLSGQFSIDNV 1977
            + W L  N+ Y G++V + S  ++LEL+ +L SL N I     +    +G+ G FSI+NV
Sbjct: 1960 IIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHGIVGDFSIENV 2019

Query: 1978 CFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSLAHMLWRGN 2037
              L+    L  +LSK++D ++ +   Q+     ++ QIES HFRV L P SL  +LW  N
Sbjct: 2020 LLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKVLWAIN 2079

Query: 2038 QALTNIRYYKEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFCVGWLFSPEFDNEP 2097
            +       YK  +S+   K        + +E+   F S  +LSYNFC+GW+F    + +P
Sbjct: 2080 EFTRVSEAYKTRSSLLQHKKT---APTDISELSNKFRSIQILSYNFCIGWIFDAGSETDP 2136

Query: 2098 GLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISY 2157
            GLI GY RLF+AY+K +GKLTL+DAYFS+A+G +SDTFFS G EKD++NRSYLP+MQI Y
Sbjct: 2137 GLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGY 2196

Query: 2158 WLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLVGTASNIKEQT 2217
            W   EG   ++++R  GE LDVNFL+S I +   +++SIQ FQELK+ +V   +     T
Sbjct: 2197 WFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFA-----T 2251

Query: 2218 QSTTQEPIGD----ISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVI 2273
              TT++P+      + P  + IR+ NC  +Y GGVFK+FS  +  N+ KPSFE++SP+V 
Sbjct: 2252 NKTTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVE 2311

Query: 2274 IDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVKRHSSDREPS 2333
            + ++YK+     ++  WIR L+T++ ++NTLF  C P+++  ++ ++ M+K  +S  +P 
Sbjct: 2312 VAIDYKHLPDVIKS-HWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPKPD 2370

Query: 2334 -GTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDY 2392
              + IS   ++YK++L +FD+A  V   KQ +SL CEP+AKVQAD+GF+     + TN+ 
Sbjct: 2371 RNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTNNL 2430

Query: 2393 DPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILGTGLISDVH 2452
            D  EPL  ++ +E   A+ +HIFSRE STSF +D ID   + THP  I   GT L+SDV 
Sbjct: 2431 DNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQ 2490

Query: 2453 VFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRT----DLKSLSSVQSKDTDSTIPW 2508
            ++FN+KQLQ+L LFLDIWK  + +   P     ++R+    D   +S  Q     +  PW
Sbjct: 2491 IYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGTNAFPW 2550

Query: 2509 CFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSKGRLSG 2568
             +TLIFSNI GD+DLGP+LGVLS+   R+W  +DH+   R+ L  + + I L+S GRL G
Sbjct: 2551 NYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLGG 2610

Query: 2569 ILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNIDVHIH 2628
             L ++   W SE++WP+     + PL+S+SL +  +  K +FDYHMFL+  + ++ + ++
Sbjct: 2611 FLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLKLY 2670

Query: 2629 SEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIETLKESN 2688
            +E+D  GI  DLL V+V C  I L  TAL +AN +DIYNT++R+RQDNK SYIETLK+SN
Sbjct: 2671 NERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKDSN 2730

Query: 2689 TSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISARSETH 2748
            T   +     +++L SL+L++TD+SV I    +Q+ P +LFD E+LV+  E++SA ++T 
Sbjct: 2731 TQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQTQ 2790

Query: 2749 AGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAPRLLI 2808
              +K+KT L  Q+++  V+LS  K + +E+I++ I V++Y+ +A ++ GG I+ AP +L+
Sbjct: 2791 GDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAILV 2850

Query: 2809 AMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRR--SQIDVT 2866
             MTT+Q+  S+++E LYT SFG K+ V+WNLGP+NFI+EMWATHVRA+A+RR     D  
Sbjct: 2851 DMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRALALRRVHDMRDKN 2910

Query: 2867 FGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAF 2926
                 +E + ++IK  +  +++ Y+PLEEPRI+MPQI+DLGDATPP+EWFG+NR+RFP  
Sbjct: 2911 KSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGL 2970

Query: 2927 THQTAVILVQKLVHTAEKEYGSILGH 2952
            THQ+ V+ +QKL H AE+EY  +LG+
Sbjct: 2971 THQSVVVPLQKLAHMAEEEYARVLGN 2996

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1912 bits (4953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1089/3034 (35%), Positives = 1719/3034 (56%), Gaps = 155/3034 (5%)

Query: 5    SQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRSNVKI 64
            SQF+R+ L+  +DFSWVFLVDW               R   Y ++F+LEW  WKR  VKI
Sbjct: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62

Query: 65   NIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPDKASA 124
            +I+S++IS LGGR+FFKN+ ++ Q+ T SFL+ ++TWRYWLLN RK+ +       KAS 
Sbjct: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFA------KASE 116

Query: 125  N---SV-KLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDS-K 179
            N   SV KLPCRF +E +GLE F+YN+  A+DNI+    +E+  +F+ F  +    ++ +
Sbjct: 117  NIDKSVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKNTDE 176

Query: 180  AXXXXXXXXXXXXXXXXAGTFKSDSSTTNDRVFQEELSERPQFLDFLPIDFKVSHGSLII 239
                               +  S S + NDR FQ   S  P FL  LP+++ V  G+++I
Sbjct: 177  CSVDEDSAGQRSHLETSTSSPSSKSKSLNDRSFQSPDST-PPFLKLLPLEYSVQKGAVVI 235

Query: 240  GNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMK 299
            GNK + S+M+ S     G++D C P  K+DLYK++   +F+ F I +K N+    E  +K
Sbjct: 236  GNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLK 295

Query: 300  FKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFGKS 359
              + R+++SK+W +  ++     S    +   S K    +P  ++WRGL LY      + 
Sbjct: 296  SFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNPL-KRWRGLGLYWKE---ED 351

Query: 360  XXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNSG 419
                       + HEYA+++ +++    +  +  D PGIVPHGA PT    DGPDVGNSG
Sbjct: 352  AAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSG 411

Query: 420  APPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFKX 479
             PP++S++IQISG S+ +GPW+  ++  L +L SP+ SR+++P ++LTPG  RIYT+ + 
Sbjct: 412  PPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRL 471

Query: 480  XXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPTK 539
                     WRIPTRE+SKD EFL+ +RET +E RPFGW+++  S+ + +   +A CPT 
Sbjct: 472  SILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTA 531

Query: 540  EGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLEA 599
             GF NTLD+H    EIR+SVNHDILL  ++ +    +G+PLGWN++A W  D  S Q + 
Sbjct: 532  TGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQI 591

Query: 600  FILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDF 659
            FIL++HITL+ D ++DF SGEPTPYELFRPF Y  NW   GYS+YLNVND NIVNNP++F
Sbjct: 592  FILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLNVNDANIVNNPVNF 651

Query: 660  NENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKE 719
            NENCYLSFHGD L+++  VP+  ++   T+++Y ++TP+FRL +NTP WNTL+EFMK+KE
Sbjct: 652  NENCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKE 711

Query: 720  VGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFF 779
            VGRS +F ++GSYL +S+LD+DN+DTIIIEC S+ST L+CYG+V+RY   VKMNYFGDF 
Sbjct: 712  VGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFV 771

Query: 780  HFVTSEEYTGEIRA----------NEVQNQFTDRQLYEDKAXXXXXXXXXXXXVRKEQTG 829
            HF T+EEY  E+R           +E + Q   +Q+ ED +             R++   
Sbjct: 772  HFKTTEEYMEELRGTNAVTKTTHDSETEIQEAPKQMDEDSSQ------------REQHIK 819

Query: 830  DS-KIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYY 888
            D    K++ LKR  NE D+WFTF V +G  +LPE +Y+CD C  L F  L ID R  NYY
Sbjct: 820  DPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYY 879

Query: 889  MDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPT 948
            MD+ A+++ + +RR I     E++E  +    CG    G LS + IH HRM+GLPP E T
Sbjct: 880  MDMQAALSPLRIRRLIDCGCEEVFEQ-KGRALCGELVAGRLSRLHIHTHRMFGLPPAEET 938

Query: 949  YFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVK 1008
            YFC+WDFSLGTLDL+ D+ F  GFI ++ K+ FG  D ENI+ Y+   I DMTS+T+ + 
Sbjct: 939  YFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAID 998

Query: 1009 KISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKL 1068
             I     + + +T +   A+++     + EN  Y +R+DL +      +   N + K  +
Sbjct: 999  AIVFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTASIIDKNKSNK-AI 1057

Query: 1069 FEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGXX 1128
              F T + +SNF +  D+  H  +Q+ +I  +DAP+HRC F++P +LQ+S  Y+ LFG  
Sbjct: 1058 ASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFG-- 1115

Query: 1129 XXXXXXXXXXXXXXXXTIDYIVDDLLGCFPEILESENP---FRIPFSPATSPKLGNPFEG 1185
                             +    +++   F   L++EN    F   + P    K  N    
Sbjct: 1116 -----CIPPGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSL 1170

Query: 1186 SDTESDEELDPL---EFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFC 1242
             D +   +L P+        +S    TF  +  V+++    LSI+P  +  + N  E   
Sbjct: 1171 KDFKG--QLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQCH 1228

Query: 1243 SQDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWG--DRQN-----AGISL 1295
             + I Q +D+IE+ +V H   +    +  +NI++ +  LD+ +   +++N       + +
Sbjct: 1229 KKLIEQFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKV 1288

Query: 1296 YLDRIDLEMCQK--MLEENNETKITEVTFLNKIRS----VRATINEASSVGKADERPPAL 1349
              +++ L+   K  +    ++    + T L KI S    V   +++ +   + DE   A 
Sbjct: 1289 TANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDEN-IAF 1347

Query: 1350 SLVIEGSEIWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQ 1409
               ++  E WS +     +SL + S + ++   + +WL  ++ K    S+++ + L    
Sbjct: 1348 GCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCT 1407

Query: 1410 ESRSTTRKQLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIL 1469
                   ++   +++ AS+ YQI+HDP VITKPA+ITRL   HVRE+RSWKI+TRLRHIL
Sbjct: 1408 GQFRKAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHIL 1467

Query: 1470 TYLPIDWLRVIDEMRNQQDSHTLPDPGNA---FISVFSNWRNWEFSDIARSYIYRNMFSE 1526
             YLP     +I ++ N   +   P    A   F+ +FSNW NW++SD+ + Y+YR +F+ 
Sbjct: 1468 NYLPT---TLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFT- 1523

Query: 1527 GHSKKQENSMENSIKLKLASL---FFTVYSTGYEVEHNFILTRTNVVVETLPAISDSSII 1583
             ++     + E+S K++  +    FF   +TG +     ++ +      TL A  D +  
Sbjct: 1524 -NTLDDTVAHESSTKIETGTFMLNFFDSINTGSDS----VILKNLKAQRTLEACKDEA-- 1576

Query: 1584 QEKIINVTGSLGTIKGKTSH---------------KLINLKKLLP----ELSMKKNLKPS 1624
             EK  N++ +   ++ + S                KL+++++L        ++K+N K  
Sbjct: 1577 AEKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVKENEK-- 1634

Query: 1625 TPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPKDLASKAISMTVYAQ 1684
               L  F+     L +R ++Q + GA++   + FG  L+++ E+  + A  A S      
Sbjct: 1635 ---LPAFQ-QYTALVDRCDIQLLCGANRANLKSFGNTLTIVRENKSEDAD-AFSTAFAWS 1689

Query: 1685 RSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVL-VNLQCTDIHFRAMTATDVLAKS 1743
              E  ++H N IL ++  R  S  + A  +S K +   ++L+      +  + +      
Sbjct: 1690 WFEFGIRHRNTILLDAFSR--SSAVGAHGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTF 1747

Query: 1744 VGXXXXXXXXXXXXFYXXXXXXXXXXXXYPVMEQKI--NMVLTCYFTNVNLEIMPLSPFS 1801
            +                           +    +K+     L    +++  +I  LS  +
Sbjct: 1748 IDSLEESWNNLRLAL---GPNTGFLEKPHSAATEKVAPQFALNIDISDLTTDISLLSSLA 1804

Query: 1802 FRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQL-----KGNIL 1856
               N K+L + + +  S+ L L+    D+ + S  T ++Y + S  NI       K N  
Sbjct: 1805 ITKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNA 1864

Query: 1857 ENPNYTINIDVSASIVKLTLGDIRRLIPSFLQD---EKILIESLEQ-FSSLKLFQRKK-P 1911
              P  T+ +D  ++I KL L D R +     +D    K  + SL+  F  L     K   
Sbjct: 1865 SPP--TVKLD--SNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIM 1920

Query: 1912 APSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHML--LMSLNKIQGISSK--YNG 1967
            +    K   + +W  +  +NY GLL+P+ ST +I EL+ +   ++ ++    +S+     
Sbjct: 1921 SQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGA 1980

Query: 1968 LSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPG 2027
            L G  S  ++ FL+ ++ LP  LS+++DF++ +   ++ +   RS QIESP+FR+ LSP 
Sbjct: 1981 LRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPF 2040

Query: 2028 SLAHMLWRGNQALTNIRYYKEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFCVGW 2087
            SL  +L+  N+ L+ +   ++  +V   K+        +   +  F S  VLSYNFC+GW
Sbjct: 2041 SLVRILFLVNE-LSRLSELQKRQTVG--KLPESVEVRETFRFRRAFRSVQVLSYNFCLGW 2097

Query: 2088 LFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNR 2147
            +F      EPGLI GY RLF+A+EK +GKLTL+DAYFS+A G TSD F++  +  +  NR
Sbjct: 2098 IFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNR 2157

Query: 2148 SYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLV 2207
            S+LP+MQI YW++++GL  ++++R +GE LDV FL+  IDV    ++S+  F ELK+  V
Sbjct: 2158 SFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYV 2217

Query: 2208 G---TASNIKEQTQSTTQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPS 2264
                + +N K  + ++T        P  + I+ ++C+ QY GGVF+++S  +  N   PS
Sbjct: 2218 DPFKSVANPKRPSATSTFSKF----PGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPS 2273

Query: 2265 FEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVK 2324
            F+++SP+V I  +Y+       +   +R  + + S+HNT+F  C P++ E +  I++++K
Sbjct: 2274 FQLESPSVEILFDYRRMVHGKHSHI-LRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLK 2332

Query: 2325 R-HSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSF 2383
              + S +E S  ++S++++DY+  L   D++  +   KQ +S  CEP+AKVQAD+GF+  
Sbjct: 2333 GFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKL 2392

Query: 2384 TFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINIL 2443
               V TND D  EPL  ++ + +  A  +HIFSRE STS  +D +    + THP++I+  
Sbjct: 2393 AVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTY 2452

Query: 2444 GTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSR---TDLKSLSSVQSK 2500
            G   I ++ V+FN+KQLQ+L +F++IWK  + + ++P  +   SR   ++ K L +   K
Sbjct: 2453 GIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKK 2512

Query: 2501 DTDST-IPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGIT 2559
             + +T  PW F LI S I GD+DLG +LGVLSL   R W  TDHY    + L    + I 
Sbjct: 2513 VSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKIL 2572

Query: 2560 LTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGA 2619
            L+S GRL G L L   SW+S + WP+ E + + PLV++ + +D  + K++FDYH+ L+ +
Sbjct: 2573 LSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIAS 2632

Query: 2620 INNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKIS 2679
            +  + + + +++D  GI  +LL V +   + +L  TAL  ANILD+YNT++R+R+DN+ S
Sbjct: 2633 VEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKS 2692

Query: 2680 YIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIE 2739
            Y ETL +SNT + R A   KDIL SL+ ++T++ V +  ++IQI P  LFD E+L    +
Sbjct: 2693 YFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAK 2752

Query: 2740 NISARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGV 2799
            +   +S+     KLKT L+ Q++   +ALS  K +L E   + I V++Y+ +A +  GG 
Sbjct: 2753 DFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGT 2812

Query: 2800 IIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVR 2859
            I+  P +LI MTT+    ++ +E LY+ SFG KI +RWNLG +NF++EMWATHVRAMA+R
Sbjct: 2813 ILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALR 2872

Query: 2860 RSQIDVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLN 2919
            RS      G   +E + ++++  +    ++YVPLEEP I++PQ +DLG+ATPP+EWFG+N
Sbjct: 2873 RSHNGQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVN 2932

Query: 2920 RKRFPAFTHQTAVILVQKLVHTAEKEYGSILGHS 2953
            RK+FP  THQ  ++ +QKL H AE E+  ILG +
Sbjct: 2933 RKQFPGLTHQAMIVPLQKLAHIAETEWARILGRA 2966

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1820 bits (4715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1057/3028 (34%), Positives = 1683/3028 (55%), Gaps = 168/3028 (5%)

Query: 5    SQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRSNVKI 64
            S+F+R+P++  +DFSWVFL DW               R L Y I+ ILE+  WKR  VK+
Sbjct: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

Query: 65   NIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPDKASA 124
                       GRVFFKN+ +I QD T S L  ++TWRYWLL+ RK+  ++       S 
Sbjct: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLES------QSE 105

Query: 125  NSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSKAXXXX 184
             + KLPCRF +E +GLE F+YNR  A+DNI+    +E++   +KF ++     ++     
Sbjct: 106  KAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEETSTE 165

Query: 185  XXXXXXXXXXXXAGTFKSDSSTT-NDRVFQEELSERPQFLDFLPIDFKVSHGSLIIGNKF 243
                        + +  S S+ + NDR +Q   S  P FL  LP+++ V  G+LIIGNK 
Sbjct: 166  NDSAAQKSHLETSMSSPSASTESLNDRTYQLPNS-MPSFLRLLPLEYSVQKGALIIGNKK 224

Query: 244  TPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMKFKID 303
            T S+M+ S     G +D C P  K+DLYK++   D   F + ++ N+ ++ +  +K    
Sbjct: 225  TSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPK 284

Query: 304  RNRVSKMWQQFNKVLLTCYSHM--KLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFGKSXX 361
             NR+ K+  ++ +  L        + S   S +    +P  E+WRGL LY          
Sbjct: 285  ANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPL-ERWRGLGLYWKE---NDPA 340

Query: 362  XXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNSGAP 421
                       HEYA++S +++    +  +  D PG+VPHGA PTL   DGPDVGN GAP
Sbjct: 341  WDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAP 400

Query: 422  PEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFKXXX 481
            P+FSL+IQ+ G +I +GPWA  ++  + ++ SP+ SR++ PT+RL+ G TR++T+ +   
Sbjct: 401  PDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISI 460

Query: 482  XXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPTKEG 541
                   WRIPTRE SKD +FL+ Y+ET ++ RPFGW++L  ++ + +   +A CPT  G
Sbjct: 461  MIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTG 520

Query: 542  FKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLEAFI 601
            F N LD+H    EIR+SVNHDILL  ++ +    IG+PLGWN +A W  DL+S Q   FI
Sbjct: 521  FDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFI 580

Query: 602  LREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDFNE 661
            L++HITL+ D L+DF +G+PTPY+LFRPF+Y  NW++ GYS+YLNVND NIVNNP+DFNE
Sbjct: 581  LKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNE 640

Query: 662  NCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKEVG 721
            NCYLSFHGD L+I   VP+  ++   T + Y +YTP+FRL +NTP WNTL+EFMK+KEVG
Sbjct: 641  NCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVG 700

Query: 722  RSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFFHF 781
            R+ DF + GSYL +S+LD++N+DTIIIEC S+ T L+CYG+V+R+L  VKMNYFGDF HF
Sbjct: 701  RACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHF 760

Query: 782  VTSEEYTGEIRANEVQNQFTDRQLYEDKAXXXXXXXXXXXXVRKEQTGDSKI-KRSDLKR 840
             T+EEY  E+R   V+ +    Q                    K  T D  + K+  LKR
Sbjct: 761  KTTEEYMEELRDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKR 820

Query: 841  ATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDISL 900
              NE D+WFTF V +G ++LP+ +Y+C+ C    F  L ID R  NYYMDL A+++ + +
Sbjct: 821  MVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIV 880

Query: 901  RRYIGKQQNEIYESVRQDNGCGNK-KYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLGT 959
            R         ++     +  C ++  +GS+SD+ IHAHRM+GLPP E TYFC+WDFS+G 
Sbjct: 881  RNLSDCDPAHLFSG--SEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGV 938

Query: 960  LDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESEM 1019
            LD++ D+S +  F  +++K++F   D ENI+ Y+   I DMTS+     +I + I +  +
Sbjct: 939  LDISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAV 998

Query: 1020 DTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLF-EFETKVNLS 1078
            D +++   E +    ++FENE+Y +R D  + I ++ +    G K   L  +F + + ++
Sbjct: 999  DYYIIVEVENVTARGVDFENERYSSRAD--VDIHSITVQVKEGGKDGSLIGDFSSSLKIT 1056

Query: 1079 NFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGXXXXXXXXXXXX 1138
             F +  +   H  +Q+ +I  +DAP+HRC+F+LP ++Q S+ Y+ L G            
Sbjct: 1057 KFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMV 1116

Query: 1139 XXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTESDEE----L 1194
                   +  I+D       E L+ E           S ++GN    S  E D       
Sbjct: 1117 EPITPENVTMILD-------EFLKGEK---------NSLQMGNEHFCSKKEEDGYAFNFA 1160

Query: 1195 DPLEFKTETSGDSETFASDNFVIDI-----SYCSLSINPRLWSYLDNCREHFCSQDIVQI 1249
              L   TE   + E   S++ V+ +     S  +  I P   S+ D    +F    + Q+
Sbjct: 1161 SGLMSSTENDSNVE---SESLVVKLIKPQASISACCIKP-FRSFSDQAYSNF----VEQL 1212

Query: 1250 LDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQ--- 1306
            +D  EI +V H  +     +  +N+K+     ++   +  +  IS   D +D+ + +   
Sbjct: 1213 IDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISV 1272

Query: 1307 --KMLEE-----NNETKITEVTFLNKIRSVRATINEASSVGKAD--ERPPALSLVIEGSE 1357
               M EE     + ++ + ++T L K+ S+   ++  S  G  +        S  I+  E
Sbjct: 1273 DISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLE 1332

Query: 1358 IWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRK 1417
             W    + + +S N  S D  +   + +    ++         I   +   +E     ++
Sbjct: 1333 FWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQR 1392

Query: 1418 QLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWL 1477
                +++ AS+ YQI HDP VITKPA+ITRL   HVREN+SWKIITRLRHIL YLP   L
Sbjct: 1393 DFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLL 1452

Query: 1478 RVIDEMRNQQDSHTLPDPGNA---FISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQEN 1534
                E+     S +   P NA   F+++FS WR+WE SD+ + Y+YR  F   +S+ +  
Sbjct: 1453 A---EIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAF---YSQYEGQ 1506

Query: 1535 SMENSIKLKLASLFFTVYSTGYEVEHNFILTRTNV----------VVETLPAISDSSIIQ 1584
            +   ++++++ S   TV  + ++ E + I  +             +V ++ AI D +   
Sbjct: 1507 AGPLNLRVEVDSCSATVSDSTHK-EGDMIAVKGLKLLKKFILKSEMVGSILAIDDGTATD 1565

Query: 1585 EKIINVTGSLGTIKG---KTSHKLINLKKLLPELSMKKNLK-----PSTPFLRCFKLNML 1636
                +++ SL  +K    +T+ KL+  ++L    + +  L      PS   L+  +L   
Sbjct: 1566 GN--SLSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMEL--A 1621

Query: 1637 LLFERSELQFVLGASKVMSRVFGGKLSMLW---ESPKDLASKAISMTVYAQRSEMWMKHH 1693
            LL +R E++  L +     + FG  +S      ES +D  S   SM +     E  ++H+
Sbjct: 1622 LLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGS---SMALAWSWFEFDVRHN 1678

Query: 1694 NIILAESQMREFSI---IITAESWSYKPTVLVNLQCTDIHFRAMTATDVLAKSVGXXXXX 1750
            N I+ ++  R  S+   I  +ES +      V+L    +  +  ++T    K        
Sbjct: 1679 NAIIVDAFARRGSLGSFISQSESTTLH---RVHLGSQKLRLKVPSST----KDYCNFINS 1731

Query: 1751 XXXXXXXFYXXXXXXXXXXXXYPVMEQKINMVLTCYFTNVNLEIMPLSPFSFRHNAKQLD 1810
                                  P M+    +    +  +   EI  LSP S     K L 
Sbjct: 1732 LSESWSSLAPKLKFNTRSKDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLT 1791

Query: 1811 IYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLKGNILEN-PNYTINIDVSA 1869
            + F +  ++ L L V + DL L+S +T ++Y + S   ++L   I +        + + +
Sbjct: 1792 VQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLES 1851

Query: 1870 SIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLKLFQRKKPAP-STEKSGRTV------ 1922
            ++ K  L D R +I +  QD   L+ + +    LK+      A   T+ +   V      
Sbjct: 1852 ALTKFKLCDPREIIETLTQD---LVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALW 1908

Query: 1923 --TWSLESNINYFGLLVPISSTYFILELHMLLMSLNKIQGISSKYNGLSGQFSIDNVCFL 1980
               W  + ++ Y GLLVP+ +T +I E++ L  SL+  +     +  + G+ S+  + FL
Sbjct: 1909 PREWLWQLDMKYVGLLVPLGTTSYISEINELSSSLSCDEAAEFSFPLVHGELSVAGISFL 1968

Query: 1981 LKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQA- 2039
            + +K LP DLSK+L+F+ ++   +  + + +S QIES HFR+ L P SL  +L    +A 
Sbjct: 1969 INDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEAT 2028

Query: 2040 -LTNIRYYKEHTSVAWEKVINFKNTNNSAE---VQADFPSFHVLSYNFCVGWLFSPEFDN 2095
             L+ ++  K++  V        K+++++ +   +   F S  +LSY+FC+GW+F+ +  +
Sbjct: 2029 HLSGLQALKDNAGV--------KSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGAS 2080

Query: 2096 EPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQI 2155
              GL  GY RLF+A+EK +GKLTL+DAYF +A G TS+ F+ +  E DR NRS LP+MQI
Sbjct: 2081 NSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQI 2140

Query: 2156 SYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLVGTASNIKE 2215
             YW +  G   ++++R +GE LDV+FL+  I +      S+  FQELKR  +       +
Sbjct: 2141 CYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPF----K 2196

Query: 2216 QTQSTTQEPIGDI---SPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNV 2272
              +   + P G      P  + I  +NC+ +Y GGVFK++S  +      PSF+++SP+V
Sbjct: 2197 PEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSV 2256

Query: 2273 IIDMNYKYNEKKT-QTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVK--RHSSD 2329
              D+ ++Y +  T +    +R L++++S+HNTLF  C P+I+E +  I++++K    SS 
Sbjct: 2257 --DVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSV 2314

Query: 2330 REPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFTFTVTT 2389
              P  +N+ ++ I+Y+ +L   D++  +   KQ +SL CEP+AKVQAD+GF+ F   + T
Sbjct: 2315 ETPRTSNM-QEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFT 2373

Query: 2390 NDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILGTGLIS 2449
            ND+D  EPL  +L +    A+ +HIFSRE STS  ++ +    M THP++I+  G   I 
Sbjct: 2374 NDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIP 2433

Query: 2450 DVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPM--NEVVKSRTDL-KSLSSVQSKD-TDST 2505
             + V+FN+KQLQ+L +F++IWKL + + S+P   N+ V   T+L K L+S   K  ++S+
Sbjct: 2434 TIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSS 2493

Query: 2506 IPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSKGR 2565
             PW F +I S I G++DLG +LGVLSL  ++ W  TDHY    + L      ++L+S GR
Sbjct: 2494 FPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGR 2553

Query: 2566 LSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNIDV 2625
            L G   L    W+S++ WP+ E   + PLV +++ +D    K+ FDYH+ L+ ++  + +
Sbjct: 2554 LGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSL 2613

Query: 2626 HIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIETLK 2685
             + +++D  G+  +LL V++  ++ ++  TAL  ANI D+YNT++R+R+DN+ SY+ETL 
Sbjct: 2614 SLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLG 2673

Query: 2686 ESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISARS 2745
            +SNT + + +    +IL SL+ ++T++SV +  ++IQ+ P +LFD E++     + S  S
Sbjct: 2674 DSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFS 2733

Query: 2746 ETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAPR 2805
            +T    KLKT+L+++V++  +ALST K +L E + + I V++Y+ +A ++ GG I+  P 
Sbjct: 2734 QTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPA 2793

Query: 2806 LLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQIDV 2865
            +LI MTT+    ++ +E LY+ SFG KI VRWNLG +NF++EMWATH RAMA+RRS    
Sbjct: 2794 ILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQ 2853

Query: 2866 TFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPA 2925
            +     +E +G ++K  +    + Y+PLEEP I++PQ +DLG+ATPP+EWFG+NRK+FP 
Sbjct: 2854 SKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPG 2913

Query: 2926 FTHQTAVILVQKLVHTAEKEYGSILGHS 2953
             THQ  ++ +QKL H AE E+  ILG +
Sbjct: 2914 LTHQGVIVPLQKLAHLAESEWARILGRA 2941

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 1693 bits (4385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 986/2830 (34%), Positives = 1580/2830 (55%), Gaps = 150/2830 (5%)

Query: 202  SDSSTTNDRVFQEELSERPQFLDFLPIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDV 261
            + + + NDR +Q   S  P FL  LP+++ V  G+LIIGNK T S+M+ S     G +D 
Sbjct: 6    ASTESLNDRTYQLPNS-MPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDA 64

Query: 262  CQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTC 321
            C P  K+DLYK++   D   F + ++ N+ ++ +  +K     NR+ K+  ++ +  L  
Sbjct: 65   CAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRV 124

Query: 322  YSHM--KLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFGKSXXXXXXXXXXXANHEYAKFS 379
                  + S   S +    +P  E+WRGL LY                     HEYA++S
Sbjct: 125  RKRYLSRGSKTESTRKDLRNPL-ERWRGLGLYWKE---NDPAWDDVFHFELPKHEYARYS 180

Query: 380  SIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNSGAPPEFSLEIQISGGSICFGP 439
             +++    +  +  D PG+VPHGA PTL   DGPDVGN GAPP+FSL+IQ+ G +I +GP
Sbjct: 181  KVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGP 240

Query: 440  WAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFKXXXXXXXXXXWRIPTRESSKD 499
            WA  ++  + ++ SP+ SR++ PT+RL+ G TR++T+ +          WRIPTRE SKD
Sbjct: 241  WAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKD 300

Query: 500  PEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSV 559
             +FL+ Y+ET ++ RPFGW++L  ++ + +   +A CPT  GF N LD+H    EIR+SV
Sbjct: 301  LDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSV 360

Query: 560  NHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLEAFILREHITLIADTLTDFSSG 619
            NHDILL  ++ +    IG+PLGWN +A W  DL+S Q   FIL++HITL+ D L+DF +G
Sbjct: 361  NHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTG 420

Query: 620  EPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVP 679
            +PTPY+LFRPF+Y  NW++ GYS+YLNVND NIVNNP+DFNENCYLSFHGD L+I   VP
Sbjct: 421  DPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVP 480

Query: 680  KREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELD 739
            +  ++   T + Y +YTP+FRL +NTP WNTL+EFMK+KEVGR+ DF + GSYL +S+LD
Sbjct: 481  QDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLD 540

Query: 740  IDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFFHFVTSEEYTGEIRANEVQNQ 799
            ++N+DTIIIEC S+ T L+CYG+V+R+L  VKMNYFGDF HF T+EEY  E+R   V+ +
Sbjct: 541  VENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPK 600

Query: 800  FTDRQLYEDKAXXXXXXXXXXXXVRKEQTGDSKI-KRSDLKRATNETDLWFTFTVWEGAI 858
                Q                    K  T D  + K+  LKR  NE D+WFTF V +G +
Sbjct: 601  ANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCL 660

Query: 859  LLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQD 918
            +LP+ +Y+C+ C    F  L ID R  NYYMDL A+++ + +R         ++     +
Sbjct: 661  ILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSG--SE 718

Query: 919  NGCGNK-KYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFN 977
              C ++  +GS+SD+ IHAHRM+GLPP E TYFC+WDFS+G LD++ D+S +  F  +++
Sbjct: 719  GRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWS 778

Query: 978  KISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESEMDTFLLCTAEELYFSNINF 1037
            K++F   D ENI+ Y+   I DMTS+     +I + I +  +D +++   E +    ++F
Sbjct: 779  KLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDF 838

Query: 1038 ENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLF-EFETKVNLSNFEKPNDIATHKSKQQEY 1096
            ENE+Y +R D  + I ++ +    G K   L  +F + + ++ F +  +   H  +Q+ +
Sbjct: 839  ENERYSSRAD--VDIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSH 896

Query: 1097 ITLHDAPYHRCAFILPPSLQDSEIYQDLFGXXXXXXXXXXXXXXXXXXTIDYIVDDLLGC 1156
            I  +DAP+HRC+F+LP ++Q S+ Y+ L G                   +  I+D     
Sbjct: 897  IATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILD----- 951

Query: 1157 FPEILESENPFRIPFSPATSPKLGNPFEGSDTESDEE----LDPLEFKTETSGDSETFAS 1212
              E L+ E           S ++GN    S  E D         L   TE   + E   S
Sbjct: 952  --EFLKGEK---------NSLQMGNEHFCSKKEEDGYAFNFASGLMSSTENDSNVE---S 997

Query: 1213 DNFVIDI-----SYCSLSINPRLWSYLDNCREHFCSQDIVQILDDIEIGIVNHLSDLQEG 1267
            ++ V+ +     S  +  I P   S+ D    +F    + Q++D  EI +V H  +    
Sbjct: 998  ESLVVKLIKPQASISACCIKP-FRSFSDQAYSNF----VEQLIDSNEIEVVLHFIETTLK 1052

Query: 1268 IETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQ-----KMLEE-----NNETKI 1317
             +  +N+K+     ++   +  +  IS   D +D+ + +      M EE     + ++ +
Sbjct: 1053 RKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTV 1112

Query: 1318 TEVTFLNKIRSVRATINEASSVGKAD--ERPPALSLVIEGSEIWSCITNAQVNSLNILSA 1375
             ++T L K+ S+   ++  S  G  +        S  I+  E W    + + +S N  S 
Sbjct: 1113 QDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSI 1172

Query: 1376 DITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHD 1435
            D  +   + +    ++         I   +   +E     ++    +++ AS+ YQI HD
Sbjct: 1173 DTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHD 1232

Query: 1436 PYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDP 1495
            P VITKPA+ITRL   HVREN+SWKIITRLRHIL YLP   L    E+     S +   P
Sbjct: 1233 PPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLA---EIYGALKSASFEAP 1289

Query: 1496 GNA---FISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVY 1552
             NA   F+++FS WR+WE SD+ + Y+YR  F   +S+ +  +   ++++++ S   TV 
Sbjct: 1290 TNAGEIFLNIFSKWRSWESSDVEQCYMYRKAF---YSQYEGQAGPLNLRVEVDSCSATVS 1346

Query: 1553 STGYEVEHNFILTRTNV----------VVETLPAISDSSIIQEKIINVTGSLGTIKG--- 1599
             + ++ E + I  +             +V ++ AI D +       +++ SL  +K    
Sbjct: 1347 DSTHK-EGDMIAVKGLKLLKKFILKSEMVGSILAIDDGTATDGN--SLSCSLKAVKASIS 1403

Query: 1600 KTSHKLINLKKLLPELSMKKNLK-----PSTPFLRCFKLNMLLLFERSELQFVLGASKVM 1654
            +T+ KL+  ++L    + +  L      PS   L+  +L   LL +R E++  L +    
Sbjct: 1404 ETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMEL--ALLIDRCEIKISLDSKTAN 1461

Query: 1655 SRVFGGKLSMLW---ESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSI---I 1708
             + FG  +S      ES +D  S   SM +     E  ++H+N I+ ++  R  S+   I
Sbjct: 1462 LKSFGNSISFALVDTESARDTGS---SMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFI 1518

Query: 1709 ITAESWSYKPTVLVNLQCTDIHFRAMTATDVLAKSVGXXXXXXXXXXXXFYXXXXXXXXX 1768
              +ES +      V+L    +  +  ++T    K                          
Sbjct: 1519 SQSESTTLH---RVHLGSQKLRLKVPSST----KDYCNFINSLSESWSSLAPKLKFNTRS 1571

Query: 1769 XXXYPVMEQKINMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDT 1828
                P M+    +    +  +   EI  LSP S     K L + F +  ++ L L V + 
Sbjct: 1572 KDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENF 1631

Query: 1829 DLFLISHLTKEEYFRFSFGNIQLKGNILEN-PNYTINIDVSASIVKLTLGDIRRLIPSFL 1887
            DL L+S +T ++Y + S   ++L   I +        + + +++ K  L D R +I +  
Sbjct: 1632 DLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLT 1691

Query: 1888 QDEKILIESLEQFSSLKLFQRKKPAP-STEKSGRTV--------TWSLESNINYFGLLVP 1938
            QD   L+ + +    LK+      A   T+ +   V         W  + ++ Y GLLVP
Sbjct: 1692 QD---LVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVP 1748

Query: 1939 ISSTYFILELHMLLMSLNKIQGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSI 1998
            + +T +I E++ L  SL+  +     +  + G+ S+  + FL+ +K LP DLSK+L+F+ 
Sbjct: 1749 LGTTSYISEINELSSSLSCDEAAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAF 1808

Query: 1999 KVSTLQKLKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQA--LTNIRYYKEHTSVAWEK 2056
            ++   +  + + +S QIES HFR+ L P SL  +L    +A  L+ ++  K++  V    
Sbjct: 1809 RIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGV---- 1864

Query: 2057 VINFKNTNNSAE---VQADFPSFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKN 2113
                K+++++ +   +   F S  +LSY+FC+GW+F+ +  +  GL  GY RLF+A+EK 
Sbjct: 1865 ----KSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKP 1920

Query: 2114 FGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFH 2173
            +GKLTL+DAYF +A G TS+ F+ +  E DR NRS LP+MQI YW +  G   ++++R +
Sbjct: 1921 YGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRIN 1980

Query: 2174 GEALDVNFLASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDI---SP 2230
            GE LDV+FL+  I +      S+  FQELKR  +       +  +   + P G      P
Sbjct: 1981 GERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPF----KPEEPVKRVPAGSAFSKLP 2036

Query: 2231 FFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKT-QTPT 2289
              + I  +NC+ +Y GGVFK++S  +      PSF+++SP+V  D+ ++Y +  T +   
Sbjct: 2037 ILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSV--DVIFEYTKMLTGKRKH 2094

Query: 2290 WIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVK--RHSSDREPSGTNISKQNIDYKRM 2347
             +R L++++S+HNTLF  C P+I+E +  I++++K    SS   P  +N+ ++ I+Y+ +
Sbjct: 2095 LLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNM-QEGINYRSL 2153

Query: 2348 LDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKT 2407
            L   D++  +   KQ +SL CEP+AKVQAD+GF+ F   + TND+D  EPL  +L +   
Sbjct: 2154 LQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNI 2213

Query: 2408 EASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFL 2467
             A+ +HIFSRE STS  ++ +    M THP++I+  G   I  + V+FN+KQLQ+L +F+
Sbjct: 2214 TATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFI 2273

Query: 2468 DIWKLSNLLNSKPM--NEVVKSRTDL-KSLSSVQSKD-TDSTIPWCFTLIFSNINGDVDL 2523
            +IWKL + + S+P   N+ V   T+L K L+S   K  ++S+ PW F +I S I G++DL
Sbjct: 2274 NIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDL 2333

Query: 2524 GPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNW 2583
            G +LGVLSL  ++ W  TDHY    + L      ++L+S GRL G   L    W+S++ W
Sbjct: 2334 GISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKW 2393

Query: 2584 PIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKV 2643
            P+ E   + PLV +++ +D    K+ FDYH+ L+ ++  + + + +++D  G+  +LL V
Sbjct: 2394 PLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSV 2453

Query: 2644 NVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKDILR 2703
            ++  ++ ++  TAL  ANI D+YNT++R+R+DN+ SY+ETL +SNT + + +    +IL 
Sbjct: 2454 SLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILS 2513

Query: 2704 SLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYD 2763
            SL+ ++T++SV +  ++IQ+ P +LFD E++     + S  S+T    KLKT+L+++V++
Sbjct: 2514 SLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHN 2573

Query: 2764 ASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEY 2823
              +ALST K +L E + + I V++Y+ +A ++ GG I+  P +LI MTT+    ++ +E 
Sbjct: 2574 VKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVEL 2633

Query: 2824 LYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKRIKKEE 2883
            LY+ SFG KI VRWNLG +NF++EMWATH RAMA+RRS    +     +E +G ++K  +
Sbjct: 2634 LYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFEDEHLGDKLKDVD 2693

Query: 2884 EFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAE 2943
                + Y+PLEEP I++PQ +DLG+ATPP+EWFG+NRK+FP  THQ  ++ +QKL H AE
Sbjct: 2694 LGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAE 2753

Query: 2944 KEYGSILGHS 2953
             E+  ILG +
Sbjct: 2754 SEWARILGRA 2763

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1578 (32%), Positives = 800/1578 (50%), Gaps = 120/1578 (7%)

Query: 1    MDAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRS 60
            MD  ++F+ I +  ++ F WVFLV+W               R + Y ++ IL W +WKR 
Sbjct: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60

Query: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120
             V INI+S+  S +GG+V+FKN+ I  +D TIS L+   TWRYWLLN R +      + D
Sbjct: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIND 120

Query: 121  KASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFL--NEQVFTDS 178
            + S       CRF LE +G+E+F+YN+   Y++I+ + +K +++   KF   +E +F   
Sbjct: 121  ENSK------CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGRV 174

Query: 179  KAXXXXXXXXXXXXXXXXAGTFKSDSSTTNDRVFQEEL------SERPQFLDFLPIDFKV 232
            K                       D S+   +V Q  L      S  P +LDFLP +  +
Sbjct: 175  KTDSSVMFDPL-------------DESSEQSKVGQTILNSVSNQSAVPLYLDFLPAEVIL 221

Query: 233  SHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGF 292
            S G++++GNK TPS+ I   +   G+IDV  P+  LD YKLR   +  +  + +K NI F
Sbjct: 222  SSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISF 281

Query: 293  -NEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLY 351
             N   S K KID  +   +WQ+    LL   SH+         ++ ++ F   W+GL++Y
Sbjct: 282  GNGSSSKKHKID-GKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMY 340

Query: 352  RGTIFGKSXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATD 411
                   S            NHEYAK+++I+   +    +  D PG++      T T   
Sbjct: 341  D---VATSDTFSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVI------TETLIK 391

Query: 412  GPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCT 471
            G + G+    PE+S+++Q+   +  +GPWA RQL   I++ SP  SR+    ++   G +
Sbjct: 392  GYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKS 451

Query: 472  RIYTQFKXXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICS 531
            R +  F+          WRIPT+E SKD  FL  Y+ TN+E R FGWID+K +KDT I  
Sbjct: 452  REHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISI 511

Query: 532  TVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTID 591
             +    ++ GF+NT   +L +  I +SVNHD+L   K+   +    +P  WN   TW + 
Sbjct: 512  ELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALH 571

Query: 592  LESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHN 651
              S+ LE FILR+H  L+ D  TDF+SG+  PYELFRP +Y+ +W I+ YSLYLN ND N
Sbjct: 572  FISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDAN 631

Query: 652  IVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTL 711
            IVNNPLDFNENCY+S HG+  +I + +P   +S     +SY IYTP F + L TPPW+TL
Sbjct: 632  IVNNPLDFNENCYISIHGNSARIGVKLPIETISEESITISYEIYTPKFDIQLKTPPWHTL 691

Query: 712  NEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVK 771
            +EFM  + VGRSH+F  +GSYL Y+++DIDNVDTI +EC +       YGF++RY+ N+K
Sbjct: 692  HEFMAQRFVGRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLRYVMNLK 751

Query: 772  MNYFGDFFHFVTSEEYTGEIR-----ANEVQNQFTDRQLYEDKAXXXXXXXXXXXXVRKE 826
            +NYFG+F  F T+EEY+ E+      A ++ N   D Q  E               V   
Sbjct: 752  LNYFGEFAQFRTTEEYSEELAQRNDVATDIFNNNDDDQTTE--------------LVEPN 797

Query: 827  QTGDS--------KIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGEL 878
              G+S        KI ++ LKR  NE D+W TF   +G  +LPE+ Y+   C GLHF  +
Sbjct: 798  SYGESGFDILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNI 857

Query: 879  LIDFRSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHR 938
              D R  +YY DL  SMN   ++RY     N +++    +    +   G LS+  IH HR
Sbjct: 858  TFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHR 917

Query: 939  MYGLPPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVID 998
            M+GLPP E TY  + D SLG L    DI  L+GFI    K SFG  + E++L YE     
Sbjct: 918  MFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSF 977

Query: 999  DMTSLTVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMY 1058
            D++ L+     ISI +   + + F+  +   +    ++F   KY  R ++ IP F+  + 
Sbjct: 978  DISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVS 1037

Query: 1059 TMNGAKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDS 1118
            +M+      L    T ++ + F +  D  T  + Q ++I L DAP+ RC+F+ P   Q S
Sbjct: 1038 SMDD-HNIVLGTISTSISFAIFSRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTS 1096

Query: 1119 EIYQDLFGXXXXXXXXXXXXXXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPK 1178
            ++Y+ L+                     D I ++LLG   +   SE  F I         
Sbjct: 1097 DLYKLLYASIPPSSSIPLLPEPIGPNNFDTIFENLLGDIYQDYISEGTFDI--------- 1147

Query: 1179 LGNPFEGSDTESDEELDPLEFKTETSGDSETFASDNFVIDI--------------SYCSL 1224
                   +DT+    +D  EFK  +        + N  IDI               + ++
Sbjct: 1148 ------SNDTKLQLNID--EFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINI 1199

Query: 1225 SINPRLWSYLDNCREHFCSQDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDL- 1283
             I+  +     +      +  I   +D + + IVN+ S    G  +    K+    +D  
Sbjct: 1200 DIHIDVLEVFADLYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFR 1259

Query: 1284 -----FWG--DRQNAGISLYLDRIDLEMCQKMLEENNETKITEVTFLNKIRSVRAT---- 1332
                 ++   D ++  +S  ++++DL +  +  E + E+  +E+   NK+     T    
Sbjct: 1260 LRMYEYYALEDVKHYFVS-DINKLDLNLRLRQ-EYDKESANSEMNSKNKLSVYYKTALIN 1317

Query: 1333 ---INEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSADITIDEAQIDWLFQ 1389
               +++ + +  ++    +     E  E ++   +  V   N+    + I++   D + +
Sbjct: 1318 GKMLSKENFIYPSESSEFSYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISE 1377

Query: 1390 YIDKQLTLSQEIASALQSIQESRS---TTRKQLVSKLAVASEYYQISHDPYVITKPAFIT 1446
            +I    TL  +  + ++S+  S++   + +++L+ ++A A + Y I HDP VITKPA IT
Sbjct: 1378 FIK---TLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVIT 1434

Query: 1447 RLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDPGNAFISVFSNW 1506
            RLSR HVRE+RSW+I+TRLRH+L YLP  W         +    +  D    F+ +F+ W
Sbjct: 1435 RLSRHHVRESRSWRIVTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRW 1494

Query: 1507 RNWEFSDIARSYIYRNMF 1524
            R+WEF+D+ R ++Y+  +
Sbjct: 1495 RSWEFADVERCFLYKKTY 1512

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/1210 (35%), Positives = 694/1210 (57%), Gaps = 65/1210 (5%)

Query: 1773 PVMEQKINMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIY--FNRLGSNDLVLSVWDTDL 1830
            P+   K+N+        +N+++  L PF  R++ K+ +I   F R+  + L  S+ DT +
Sbjct: 1766 PIAMVKMNIAA------INIQLQLLLPFILRYSCKEFEINVDFGRILQSSL--SLQDTSV 1817

Query: 1831 FLISHLTKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDE 1890
             L+S   +E Y ++S   ++L G  L N +    I + +S  KL++ + ++ +  FL D 
Sbjct: 1818 ELLSLEFQEPYMKYSHSYLKLIGMDLGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDI 1877

Query: 1891 KILIESLEQFSSLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHM 1950
            +  ++++E   S  L  +     +     R +   L  N+ Y GLL+   +T ++LE + 
Sbjct: 1878 EQAVKNIEILRSTMLETKSSTVQNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNN 1937

Query: 1951 LLMSLNKIQGISSKY-NGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVT 2009
            L  S +K +  S+      S  +S +++CFL+K++ +   LSK+LDFS+++  ++   + 
Sbjct: 1938 LEFSFSKDKTSSNPVVPTFSSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLA 1997

Query: 2010 PRSFQIESPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVINFKNTNNSAEV 2069
             +S QIES +    LSP SL  +L   N+       Y +         I  ++T++++ +
Sbjct: 1998 IQSLQIESSYLHAVLSPMSLVRLLSFVNEFSIMKSIYHD---------IKPRSTSSNSTL 2048

Query: 2070 QA---DFPSFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSV 2126
                    S H+LSYN C+GWLF   ++   GLI GY RLF+ Y+K +GKLTL+DAYFSV
Sbjct: 2049 SILPISIKSAHILSYNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSV 2108

Query: 2127 ANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFI 2186
            A+G +S T++  G+EK   NRSYLP+MQI+YWL+ E   +D+++R +GE LDV+ LA + 
Sbjct: 2109 AHGFSSSTYYPDGNEKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWF 2168

Query: 2187 DVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPI-GDI----SPFFTGIRSINCQ 2241
             +++ + +S+ KF++LK         I +  + T+ +PI G+     +P  + +RSINC 
Sbjct: 2169 TIVDEATQSLHKFKKLKE-------TILDPLKVTSNDPILGEWNYLDNPLASSVRSINCI 2221

Query: 2242 FQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTH 2301
              Y G   K++S  +   H   SFEI+SP   + ++YKY   K ++  WIRTL T+N+TH
Sbjct: 2222 INYAGSSMKLYSRDDI-QHGTCSFEIRSPAHTVTIDYKYYPSKKKS-HWIRTLATVNTTH 2279

Query: 2302 NTLFAKCAPLIAEFSEGIQKMVKRHSSDREPSGTNI--SKQNIDYKRMLDSFDVAVEVIS 2359
            NTLF  C PL+ E       M+K   S       N+  +K  I+Y+ +L++FD+AV +  
Sbjct: 2280 NTLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKAEINYRDLLEAFDIAVIINV 2339

Query: 2360 AKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREA 2419
             KQ +SL CEP AK+QA IGF+ F   + TN   P+EPL  ++ +    AS +H+FSRE 
Sbjct: 2340 GKQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREI 2399

Query: 2420 STSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSK 2479
            S+S  +  I +    TH   I+  G+ LIS    +FNVKQ+++L LFL+IW +      K
Sbjct: 2400 SSSLSLQQISMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIE---KQK 2456

Query: 2480 PMNEVVKSRTDLKSLSSV------QSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLH 2533
             +N+++ +     S  SV      Q    ++T  W + LI S I  ++DLGP+LG++ + 
Sbjct: 2457 SVNDIILAPVTASSFESVPSMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVK 2516

Query: 2534 FKRTWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYP 2593
                W  + H     + L    K I ++S GRL G + +    W S++ WPI  N +  P
Sbjct: 2517 SDNLWGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVP 2576

Query: 2594 LVSISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLC 2653
            LV +SL +    TK++FDYHMF +  I N  + + +++D  G   DLL V+V  + I++ 
Sbjct: 2577 LVELSLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVF 2636

Query: 2654 STALVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDVS 2713
             T+L  AN+ DIY+T+ R+R D+  + ++ L ESN  +   + D   +L SL  ++T++S
Sbjct: 2637 ITSLAYANLFDIYSTIRRMRNDSGRTNLDLL-ESNELKKISSFDNSKMLASLLSLRTELS 2695

Query: 2714 VDIYTLNIQISPISLFDAEILVVNIENI------SARSETHAGNKLKTELEMQVYDASVA 2767
            V+   LN+ I   +L   E++V+    +       A S+T +  K++TEL  Q+ D S++
Sbjct: 2696 VNAQLLNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLS 2755

Query: 2768 LSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTC 2827
            LS+ K +LDE+ +  I V DY+  A  I GG+I+EAP + + M T+Q + S+++E LY+ 
Sbjct: 2756 LSSFKHQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSS 2815

Query: 2828 SFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSE------EDVGKRIKK 2881
            SFG+ +S+ WNL P+NFIK+MW+ H+ AM +R  Q     G  SE      ED+  ++ K
Sbjct: 2816 SFGNGVSITWNLRPINFIKDMWSIHINAMKLRHMQK----GNSSEIHIPKDEDIEAKLAK 2871

Query: 2882 EEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHT 2941
             +  +++ Y PLEEP I+MP+I+DLGDATPP+EWFGLNR RFP  THQ  V+ +QKL   
Sbjct: 2872 VDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAV 2931

Query: 2942 AEKEYGSILG 2951
            AEKEY  ILG
Sbjct: 2932 AEKEYVRILG 2941

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/1581 (30%), Positives = 801/1581 (50%), Gaps = 82/1581 (5%)

Query: 1    MDAISQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRS 60
            MD+ S F+ I ++ +KD S  FLVDW               R LA+ ++  L++++W++ 
Sbjct: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60

Query: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120
             +KIN++SI++S LGGR+FFKN+ ++  D+TISFLE + TWRYWLL+ R  G D      
Sbjct: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120

Query: 121  KASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNII-GQFSKEERNQFEKFLNEQVFTDSK 179
             AS N+ KLPCRF L+ +GLE+FVYN+   Y++++   F+   ++  E   N+ +  +++
Sbjct: 121  DASENA-KLPCRFLLQCDGLEVFVYNKIDVYESVLRDHFTNVTKDGQETESNDDITINTE 179

Query: 180  AXXXXXXXXXXXXXXXXAGTFKSDSSTTNDRVFQEELSERPQFLDFLPIDFKVSHGSLII 239
                               +  +D+          +LS + +     PI  + +  ++++
Sbjct: 180  KAAANSKLSNSSRYSYSGRSKSTDAP---------KLSAKTKLF---PIQLEANRAAIVL 227

Query: 240  GNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMK 299
            GN+ T  + +       G+ D+      LD Y+ +  LD      +++ N+G+  +  +K
Sbjct: 228  GNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIK 287

Query: 300  FKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNK-VSEEDPFYEKWRGLSLYRGTIFGK 358
              +    + K+WQ   K    C S  KL      K ++ +  + + W+GL LY  T   K
Sbjct: 288  TFVVEKTMDKIWQTVKK---QCISISKLLLPNQGKTINNQQAYIDSWKGLDLYHHT---K 341

Query: 359  SXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNS 418
            +              EYA++S +++  +   T+  DIPGIVP  +    + +D  +  N 
Sbjct: 342  AVQEENVDTTVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNC 401

Query: 419  GA---PPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYT 475
                  P F  +I I   ++ +GPWA + +  +IRL SPI SR+     +  PG  RIY 
Sbjct: 402  NQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYE 461

Query: 476  QFKXXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQ 535
             FK            IPTRESSKD EF++ Y+ T + +R FGW+++  ++   I   +A 
Sbjct: 462  NFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLAL 521

Query: 536  CPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLEST 595
            C   +   N L + L + EI+SSVNH++L +C +     +IG+P GWN++A W  +L+S 
Sbjct: 522  CSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSR 581

Query: 596  QLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNN 655
              E F+LR+HI+LI+D  TDFS+ +   YELFRPF Y I W    Y L+LNVND NI+NN
Sbjct: 582  TAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFLNVNDANIINN 641

Query: 656  PLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFM 715
             LD NENC+LS  GDIL   + +P   +     E ++ + +P+ +L ++ P WNTL+EF+
Sbjct: 642  LLDLNENCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFL 701

Query: 716  KNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYF 775
                 G   DF +TG+Y+ +  +D+DN DTI+I+  S ST    +GFV+RYL N+K+NYF
Sbjct: 702  SETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYF 761

Query: 776  GDFFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKAXXXXXXXXXXXXVRKEQTGDS---- 831
            GDF HF T+EEY+ ++   E  +  T  + ++++                 Q  D+    
Sbjct: 762  GDFNHFKTTEEYSNDLSMEE--DTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTINEN 819

Query: 832  KIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDL 891
             I +S L R  NETD+W TF V +G I++PE +Y+C     L F  L  D R  NY+MDL
Sbjct: 820  TIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDL 879

Query: 892  LASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFC 951
             A  +    R Y+       +  V       ++  G L D+ +H HRM+G+PP+E TY C
Sbjct: 880  TAFFS----RIYLNHSNEFSFNRVVAIEESHSENTGYLDDLNLHGHRMFGVPPVEETYLC 935

Query: 952  QWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKIS 1011
            +WD S+G+L  + D  FL  F+ +  K+ F   D ENIL+Y     +D+TSLT+ + ++S
Sbjct: 936  KWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVS 995

Query: 1012 IMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLFEF 1071
             ++R +   +  L +  ++  ++ +  N +Y  R+DL +   ++        KK  LF  
Sbjct: 996  SIVRTNHGGSATL-SLNDITINSWDLSNSRYSKRVDLLVAAISVCAI---DEKKTVLFTC 1051

Query: 1072 ETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILP-PSLQDSEIYQDLFGXXXX 1130
            +T V L+ F   +++  H+  QQ  + L+D+P+HRC F+L    L  S +Y DL G    
Sbjct: 1052 DTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLLGSITP 1111

Query: 1131 XXXXXXXXXXXXXXTIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTES 1190
                          T D I + LLG +  ++  +              +       D   
Sbjct: 1112 SISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDI-----------IDTKNLTDDRPD 1160

Query: 1191 DEELDPLE--FKTETSGD-SETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIV 1247
            D+ L PL      + SG  +E F S+N  ++IS  S+ + P+ +++ +N      +    
Sbjct: 1161 DKRLLPLSNTVSNDLSGQLAEEFESENTTVNISTLSVFVTPKAFTFAENAAHFMLTMSTE 1220

Query: 1248 QILDDIEIGIVNHLS--DLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMC 1305
             I+D  E+ IVN  S   +  G     ++ L+ + +++      +      LDR++L + 
Sbjct: 1221 SIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISDETALDKTQLEALDRLELSVS 1280

Query: 1306 ------------QKMLEENNETKITEVTFLN-KIRSVRATINEASSVGKADERPPA-LSL 1351
                        Q + + N  T IT+ + ++    S++  I ++S        P A   +
Sbjct: 1281 NISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFKSSKNRLTKVLPIAWFEI 1340

Query: 1352 VIEGSEIWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQES 1411
            ++  + ++S +   +V+ L   S    I +A ++W  +Y+ K      +   +   + + 
Sbjct: 1341 LMFNTVLFSDV--GKVSKLIFGSIKSAILDADVEWTVEYLLKLAKAFCKEGKSCIELGKL 1398

Query: 1412 RSTTRKQLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTY 1471
            RS   K+ + ++A   +   I   PY+ITKPA+ITRLS+ HVR+  SWKIITRLRH+  +
Sbjct: 1399 RSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTASWKIITRLRHVSKH 1458

Query: 1472 LPIDWLRVIDEMRNQQDS-----HTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSE 1526
                    + E  +Q D        +    + F+ +F +W+NW+  ++ +S ++  +FS 
Sbjct: 1459 TS-----HVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYEVEQSSLFTLLFS- 1512

Query: 1527 GHSKKQENSMENSIKLKLASL 1547
            G S   E  + N + L L  L
Sbjct: 1513 GESTVHEEDLFNELSLSLEML 1533

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1195 (33%), Positives = 660/1195 (55%), Gaps = 64/1195 (5%)

Query: 1782 VLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEY 1841
            VL+    ++ L+     PF  R     LD  F  L    ++++   T+L L  +  + + 
Sbjct: 1762 VLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGISIIVNY--TELLLDFYFNQLKL 1819

Query: 1842 FRFS--FGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQ 1899
             R S     +  + N L       +I +   IVKLTL D R  I          +  L  
Sbjct: 1820 LRISNSVTKVDYRSNTL-----LTDIGLDTDIVKLTLSDNRVYIEELTDSLNGTVSEL-- 1872

Query: 1900 FSSLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSL---- 1955
               +K+F+ K  A +   + +    S + N  Y GLL  + +T ++LE +    S     
Sbjct: 1873 ---IKIFKNKN-ADNEPAAPKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRA 1928

Query: 1956 NKIQGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQI 2015
              ++   +  N       I NVC L+    +   LSKI D    +  ++      ++ QI
Sbjct: 1929 EALEETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIED--DIKKTLQI 1986

Query: 2016 ESPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVINFKNTNNSAEVQADFP- 2074
            E+PH RV L+P +L  +++   +A  +++  K+           F +++N+ E+   F  
Sbjct: 1987 ETPHSRVMLAPSTLIAVIFFIQEAKVSLQKVKQKGK--------FNSSSNAIEIPPYFET 2038

Query: 2075 -SFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSD 2133
             S ++LS   C+GW+F  + D E G++IGY  LF+AYEK +GKLT++D Y + A GK S+
Sbjct: 2039 LSVNILSNKLCLGWIFEEDTD-ENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESN 2097

Query: 2134 TFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSL 2193
             FF   +     NRS+L +MQI++W   + + +D+++R + + LDV  L + ++++    
Sbjct: 2098 NFFF-ANGVPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMR 2156

Query: 2194 ESIQKFQELKRDLVGTASNIKEQTQST--TQEPIGDISPFFTGIRSINCQFQYDGGVFKV 2251
             SI+ FQ+     +   SNIK+ + ST    E + D     + IRSINC  +Y GG+  +
Sbjct: 2157 SSIESFQKK----LAKISNIKKSSISTHNVAENLSDKVSILS-IRSINCIAKYGGGIINL 2211

Query: 2252 FSSAE-ASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAP 2310
            ++  + A +  K S E+ SP++ + ++Y +N   +Q   WIR+L+ + STHN LF+ C P
Sbjct: 2212 YTPDDIAQDSPKSSLELTSPSIEVSLDYMHN-FPSQKQHWIRSLVNVESTHNILFSSCVP 2270

Query: 2311 LIAEFSEGIQKMVKRHSSDR-------EPSGTNISKQNIDYKRMLDSFDVAVEVISAKQL 2363
            ++   +  IQK ++R +S++       +   TN  + + DYK +    D A+ +    Q 
Sbjct: 2271 VLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQN 2330

Query: 2364 LSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSF 2423
            ++L CEPRAK+QAD+GF +F  ++ T+  D  EPL  +L   + E S +HIFSRE S+S 
Sbjct: 2331 ITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSA 2390

Query: 2424 GVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIW----KLSNLLNSK 2479
            G++ + L  M TH N+I   G  LISD+  + N+KQLQ + LFLDIW    K +  L S 
Sbjct: 2391 GINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSG 2450

Query: 2480 PMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWF 2539
            P        +  K      ++ T   IPW + +IF N +  +D+ P+LG ++      W 
Sbjct: 2451 P-------HSGQKCQPQALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWI 2503

Query: 2540 ATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSISL 2599
            ++ H       +  Y   +   S GRL G+ E+    + S ++WP+ +N  + PL++++ 
Sbjct: 2504 SSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAF 2563

Query: 2600 NIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVA 2659
             +  + +K+ FDYH FL+  ++++ + I +E+D +G+  DLL V++   ++ +  TAL +
Sbjct: 2564 KMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALAS 2623

Query: 2660 ANILDIYNTVMRLRQDNKISYIETLKESN-TSEPRQALDYKDILRSLNLIQTDVSVDIYT 2718
            AN+ DIY T  R+R +NK SY++TLKESN  S  +      ++L  L L +T+++ +I +
Sbjct: 2624 ANLYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRL-RTNLTAEIGS 2682

Query: 2719 LNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELDED 2778
              + + P +LFD+E+LV+    ++  + T    K KT+L  Q+ D +++L+  K EL E+
Sbjct: 2683 FRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEE 2742

Query: 2779 IIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWN 2838
              A +SVE+Y   A  + G +I+ AP + + +TT+QK     +E+LY+ SFGDK+ ++WN
Sbjct: 2743 QFAELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWN 2802

Query: 2839 LGPVNFIKEMWATHVRAMAVRRSQIDVTFGP--VSEEDVGKRIKKEEEFSRFQYVPLEEP 2896
            L P+NFI+EMWATHVRA++VRR   + +       +E++ ++IK     ++++Y+PLEEP
Sbjct: 2803 LDPINFIREMWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEP 2862

Query: 2897 RIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSILG 2951
             I+MP +RDLG+ATPP+EWFG+NRKRFP   HQ  V+ +QKL++ AE +Y   LG
Sbjct: 2863 HIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/1512 (31%), Positives = 738/1512 (48%), Gaps = 95/1512 (6%)

Query: 42   RTLAYGISFILEWFLWKRSNVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTW 101
            R L Y +S      LWK+  V ++I+S+  SPL G+V FKNV +  QD  IS L+  +TW
Sbjct: 11   RVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVLKGTITW 70

Query: 102  RYWLLN-VRKSGYDTPELPDKASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSK 160
            RYWL+   R+SG          +A+  +  CRF L+FEG E FVYNR   YD I  +   
Sbjct: 71   RYWLIGRYRRSG----------TADGARR-CRFALKFEGFEYFVYNRNGVYDRIARELDG 119

Query: 161  EERNQFEKFLNEQVFTDSKAXXXXXXXXXXXXXXXXAGTFKSDSSTTNDRVFQEELSERP 220
            E               D+ A                    +   S  +      EL + P
Sbjct: 120  E---------------DTSA--------------------EPTVSVPSVEEVIAELQDDP 144

Query: 221  QFLDFLPIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFK 280
                FLP++F  + G++++GNK T S+ I +     G + +  P +       R      
Sbjct: 145  LIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKIS 204

Query: 281  TFAIDIKQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDP 340
               + IK NI +  +  +K  ++  R +++W+++ K LL       L   R  +  +   
Sbjct: 205  NCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKY-KTLLGTVLEATLHAKRKKEQHQTPK 263

Query: 341  FYEKWRGLSLYRGTIFGKSXXXXXXXXXXXANHEYAKFSSIVRTPQAIFTFECDIPGIVP 400
            +Y+ WRGLS+Y   +                +HEYAK +++++  Q   T+   +PG   
Sbjct: 264  WYDNWRGLSMYDVNL---DEELDEEVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPG--- 317

Query: 401  HGAHPTLTATDGPDVGNSGAP-PEF--SLEIQISGGSICFGPWAQRQLNSLIRLLSPIAS 457
                 T   TD  +  N     PE   S++I +   +  +GPWA RQ+   +R+ SP   
Sbjct: 318  -----TARVTDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQVQQCLRVFSPTVC 372

Query: 458  RNAKPTKRLTPGCTRIYTQFKXXXXXXXXXXWRIPTRESSKDPEFLQHYRETNEEYRPFG 517
            RN K               FK           R+P +ESSKD  FL+ Y++T +E RPFG
Sbjct: 373  RNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRPFG 432

Query: 518  WIDLKFSKDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIG 577
            WID++ +K++ I   +A  PT+ GF+N L  +L D  I +SVNHD LLK KS +  +D  
Sbjct: 433  WIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVDFS 492

Query: 578  FPLGWNEEATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWK 637
            +P GW ++A W  ++ STQ E F+LR+H+ LI+D +TDFS GE   YE FRPF YR  W 
Sbjct: 493  YPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFRWD 552

Query: 638  INGYSLYLNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTP 697
            I GYS YLNVND NI+NNP+DF ENCYLS HGD  +I   +P   +   +  V + I+TP
Sbjct: 553  IRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIFTP 612

Query: 698  MFRLVLNTPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVL 757
             F L LN PPW+T +E +  KE+GRS +F I GSY  YSE+D+DNVD + I C +   V+
Sbjct: 613  HFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYIVV 672

Query: 758  QCYGFVIRYLTNVKMNYFGDFFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKAXXXXXXX 817
             CYG +++ + NVK+NYFG+  HF T+EEY  E++    QN  T R    D         
Sbjct: 673  LCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSDVV 732

Query: 818  XXXXXVRKEQT-----GDSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIG 872
                    + +     G   IK+S LKR+ NE D+WFTF    G    PE IY  D C+G
Sbjct: 733  ATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDACLG 792

Query: 873  LHFGELLIDFRSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDM 932
             +F  L    R  NYY+D   S++ I  +R+       +++ +       +     LS  
Sbjct: 793  FYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLSQF 852

Query: 933  VIHAHRMYGLPPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLY 992
                H+M G+ P E +Y C++D  + TLD++CD++ L+ F+ +   ++FG  D+EN L Y
Sbjct: 853  SFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSLQY 912

Query: 993  EKEVIDDMTSLTVDVKKISIMIR--ESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRI 1050
            E+E + D+  ++  ++ +++ ++  + + D +L         ++ +  NE+Y  R DL I
Sbjct: 913  EREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRRSDLSI 972

Query: 1051 PIFNLFMYTMNGAKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFI 1110
            P   LF      ++   L  F T V ++ FE+    A  +  Q+++I ++DAP+HRC+F+
Sbjct: 973  PEL-LFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHRCSFM 1031

Query: 1111 LPPSLQDSEIYQDLFGXXXXXXXXXXXXXXXXXXTIDYIVDDLLGCFPEILESENPFRIP 1170
            LPP  +   IY+ L+G                    + I + LLG   +   S++ ++I 
Sbjct: 1032 LPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIFEKLLGEIYQEYASDSSYQIT 1091

Query: 1171 FSPATSPKLGNPFEGSDTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRL 1230
                +S           TE D     +     TS  S    S N    +S   +  +P +
Sbjct: 1092 DDSISS-----------TEHDYHNQTVNAAIGTSS-SLFIRSQNHQQTLSSFIVEFDP-I 1138

Query: 1231 WSYLDNCREHFCSQ--------DIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLD 1282
              YLD     F  +         + + +D +EIGI+N              +++    + 
Sbjct: 1139 DGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCPNIS 1198

Query: 1283 LFWGDRQNA----GISLYLDRIDLEMCQKMLEENNETKITEVTFLNKIRSVRATINEASS 1338
            L   ++Q+      +S  +  +D+    K  + N +    + T   KI  +RA I +   
Sbjct: 1199 LSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRANIVQDGI 1258

Query: 1339 VGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLS 1398
            V    +     S  IE  E +       +   N+ S  +T+       LF++++  ++  
Sbjct: 1259 VVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNPFISTF 1318

Query: 1399 QEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRS 1458
              +   L S +++   ++++ +  +      Y+I HDP VITKPA ITR S  H+R   S
Sbjct: 1319 DLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIRSAES 1378

Query: 1459 WKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSY 1518
            W+II RLRHIL YLP +W +        QD  +  + G  F+S+FS+WR+WE +D+  S+
Sbjct: 1379 WRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEPTDVQGSF 1438

Query: 1519 IYRNMFSEGHSK 1530
            ++  +F++  S+
Sbjct: 1439 VHEKVFTKKRSR 1450

 Score =  612 bits (1579), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 392/1205 (32%), Positives = 641/1205 (53%), Gaps = 47/1205 (3%)

Query: 1778 KINMVL-TCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHL 1836
            KI+ VL      N+ L++  LSPF   + A+  ++      S    L+  ++ + + S  
Sbjct: 1700 KIHAVLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYMEISSAK 1759

Query: 1837 TKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIES 1896
             K +YF+++   ++L G    +     +I     I+KL++ D++  I   LQD K  + S
Sbjct: 1760 QKLDYFKYTHTCLKLSGTS-SSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAALFS 1818

Query: 1897 LEQFSSLKLFQRKKPAPSTEKSGRTVTW-SLESNINYFGLLVPISSTYFILELHMLLM-- 1953
            ++  S +    +  P  S   S  ++   +L     Y GLL+    T +ILE +      
Sbjct: 1819 MKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFNNFEAKH 1878

Query: 1954 SLNKIQGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSF 2013
            + + +    +         SI++  FL+K++ +   L+K++DF++  + +    +  +S 
Sbjct: 1879 TRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSV 1938

Query: 2014 QIESPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVINFKNTNNSAEVQADF 2073
            QIES H ++ L+P ++  +L   N+     + + E +             NNS   +   
Sbjct: 1939 QIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSA-----HNNSTATECLE 1993

Query: 2074 PSF--------HVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFS 2125
            PS         H+LS++F + WLF     +  GLI GY RLFS YEK +GKLTL++AYFS
Sbjct: 1994 PSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFS 2053

Query: 2126 VANGKTSDT-FFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLAS 2184
             A    S+  F+S    K R N SYL +MQ+ YW   +    D+++R HG  L V+  A 
Sbjct: 2054 AAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAE 2113

Query: 2185 FIDVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDISPFFTGIRSINCQFQY 2244
             + ++E +++SIQ F  LK+ LV      K+Q    ++EP    +   TG+RS+NC   Y
Sbjct: 2114 IVTLLEETIQSIQTFNNLKKALVDPFRT-KKQDSDISKEPYNWNNQLATGVRSLNCIINY 2172

Query: 2245 DGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKY--NEKKTQTPTWIRTLITINSTHN 2302
             G   K+ S  +      P  E+ SP+  + ++YKY  N +KT      RTLIT   THN
Sbjct: 2173 AGVTLKLHSH-DGRGDASP-LELTSPSYKVAIDYKYFPNLEKTHR---FRTLITATPTHN 2227

Query: 2303 TLFAKCAPLIAEFSEGIQKMVKRHSSDREPSGTN----ISKQNIDYKRMLDSFDVAVEVI 2358
            T ++  A LI +      K++K  S++ + S  +    I  +  D   +L S D+ + + 
Sbjct: 2228 TFYSTSAFLIHDLCYRFSKLLKTSSTENKSSSASTSSSIKVEGSDNSTLLGSIDLVIILN 2287

Query: 2359 SAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSRE 2418
              KQ ++  CEP+AKVQA +GF+ F   +  N+ + EE L  A+ +E    + +HI+SRE
Sbjct: 2288 VGKQEVTFSCEPKAKVQATVGFEKFDIKIFNNNINDEESLCLAIEIENLMTNSRHIYSRE 2347

Query: 2419 ASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIW-KLSNLLN 2477
               S  +  I +           I G+ LIS    +FN+KQLQ+L LF+D W      +N
Sbjct: 2348 VCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWFPQKTPMN 2407

Query: 2478 SKPMNEVVKSRTDLKSLSSVQSK-DTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKR 2536
            +    E V      +S+ S   K  + S+  W +++I +    +++LGP+LGVL++  + 
Sbjct: 2408 TGSYPEGVLVDDISRSIGSKFYKGSSSSSFTWGYSVIVAGSCAEIELGPSLGVLNVTSED 2467

Query: 2537 TWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVS 2596
             W  +       + L      + +TS GRL G   +  A    E+ WP  ++    PLV 
Sbjct: 2468 VWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVPLVC 2527

Query: 2597 ISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTA 2656
            + L  D V+TK++FDYH F + ++      + +E+D +G   DLL V V  E++ +  TA
Sbjct: 2528 VKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFLTA 2587

Query: 2657 LVAANILDIYNTVMRLRQDNKISYIETLKESN--TSEPRQALDYKDILRSLNLIQTDVSV 2714
            L AANI DI N++ RL++DN++SY+ +   S+  + EP +      I  +L+L++T +S+
Sbjct: 2588 LAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPEED---GGIFDTLSLLRTQLSL 2644

Query: 2715 DIYTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEE 2774
            ++    +QISP SLFD+++L++    + A +   A  K+KT+L  Q+ D S+AL      
Sbjct: 2645 NLGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNNS 2704

Query: 2775 LDEDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKIS 2834
            LDE  +AT+ V  Y+  +  I GG I  AP +++ MTT+Q+ +S+++E LY+ SFG  + 
Sbjct: 2705 LDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTVK 2764

Query: 2835 VRWNLGPVNFIKEMWATHVRAMAVRR------SQIDVTFGPVSEEDVGKRIKKEEEFSRF 2888
            +RWNLGP++FIK+MW  H+ AM +R       ++  V   P++ + V   +      S +
Sbjct: 2765 IRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLG---SDY 2821

Query: 2889 QYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGS 2948
            QY+PL+EP I+MP+I+DLGDATPP+EWFG+NR +FP FTHQ  ++ +QKL  TAEKEY  
Sbjct: 2822 QYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEK 2881

Query: 2949 ILGHS 2953
            ILG +
Sbjct: 2882 ILGRA 2886

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 58.9 bits (141), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 25/60 (41%), Positives = 34/60 (56%)

Query: 5  SQFQRIPLTKQKDFSWVFLVDWXXXXXXXXXXXXXXSRTLAYGISFILEWFLWKRSNVKI 64
          S+F+R+P++  +DFSWVFL DW               R L Y I+ ILE+  WKR  VK+
Sbjct: 3  SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

>CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON}
            similar to uniprot|P34230 Saccharomyces cerevisiae
            YKL188c PXA2 ABC transporter
          Length = 861

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 6/56 (10%)

Query: 2458 KQLQNLYLFLD----IW--KLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDTDSTIP 2507
            K+L  L   LD    +W  +L +LL++K  N + KS TDL++L  + +  TDS IP
Sbjct: 759  KRLNELNSLLDQQVPLWEKRLRDLLDAKKSNVIRKSETDLQTLQKMANATTDSDIP 814

>TBLA0I01570 Chr9 (342266..346123) [3858 bp, 1285 aa] {ON} Anc_2.559
            YMR012W
          Length = 1285

 Score = 34.3 bits (77), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 15/103 (14%)

Query: 2128 NGKT---SDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLR----FHGEALDVN 2180
            NGK     +TF    ++KD+   ++  N+ I  +  NE L   + +R    F  E++D  
Sbjct: 83   NGKILNHDETFEEILNDKDKKIDNFTLNIDIKPYTTNEALKHIINVREFIGFSDESVDA- 141

Query: 2181 FLASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQE 2223
             L+ F      ++ +  KF ELK D +   S+I+E T STT+E
Sbjct: 142  -LSEF------AISTGSKFSELKFDEIKEKSSIEEVTSSTTEE 177

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 310,180,615
Number of extensions: 13989619
Number of successful extensions: 38880
Number of sequences better than 10.0: 38
Number of HSP's gapped: 39204
Number of HSP's successfully gapped: 57
Length of query: 2959
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2831
Effective length of database: 38,804,151
Effective search space: 109854551481
Effective search space used: 109854551481
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)