Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B019708.259ON1415141567850.0
NCAS0B050008.259ON1409141737940.0
Smik_12.1458.259ON1418137335930.0
Suva_10.1708.259ON1416137335810.0
KAFR0B027108.259ON1416138735770.0
Skud_12.1548.259ON1417137435340.0
YLR086W (SMC4)8.259ON1418137735340.0
TDEL0F038608.259ON1399137234910.0
ZYRO0C01716g8.259ON1413139734210.0
Kpol_392.88.259ON1427140234180.0
SAKL0H17094g8.259ON1422139833820.0
Ecym_43118.259ON1376137132930.0
KNAG0G020208.259ON1444139032890.0
KLTH0G13750g8.259ON1399139032670.0
AGR089C8.259ON1370138032210.0
Kwal_56.238258.259ON1396137331500.0
TBLA0E044108.259ON1422137131240.0
KLLA0F19085g8.259ON1372137530260.0
CAGL0L12188g8.259ON1398141229780.0
TPHA0J007208.259ON1393142629630.0
YFL008W (SMC1)8.68ON12257514281e-41
KLTH0A02706g8.68ON12281573484e-32
Kwal_23.50438.68ON12251533412e-31
Skud_6.648.68ON12301533351e-30
NDAI0G033208.68ON12311533342e-30
Smik_6.718.68ON12281533342e-30
Suva_6.528.68ON12641533342e-30
TPHA0P003408.68ON12191533332e-30
KNAG0G009108.68ON12261633323e-30
NCAS0C040008.68ON12231533323e-30
KAFR0C032008.68ON12231533313e-30
SAKL0B02288g8.68ON12281533296e-30
Kpol_1011.58.68ON12211543252e-29
KLLA0D07502g8.68ON12431553191e-28
TBLA0G035308.68ON12321533181e-28
ZYRO0F03828g8.68ON12177343162e-28
TDEL0C009608.68ON12221443144e-28
CAGL0F02079g8.68ON12231533064e-27
Ecym_73038.68ON12221653037e-27
AGL023W8.68ON12221632983e-26
AGR236W7.186ON11703622751e-23
TDEL0H026107.186ON11701792652e-22
SAKL0F07282g7.186ON11703152643e-22
CAGL0D05258g7.186ON11703472617e-22
KAFR0G029307.186ON11701882591e-21
KNAG0L011607.186ON11703742591e-21
YFR031C (SMC2)7.186ON11702672591e-21
NDAI0G020707.186ON11711882581e-21
Suva_6.1047.186ON11701882582e-21
ZYRO0D15642g7.186ON11701802572e-21
Smik_7.3467.186ON11701882572e-21
Kwal_55.204217.186ON11703272563e-21
Ecym_43907.186ON11703072563e-21
Skud_6.1197.186ON11703172527e-21
NCAS0E019207.186ON11701882528e-21
KLTH0E04774g7.186ON11702342492e-20
Kpol_1063.207.186ON11711882492e-20
TBLA0D046107.186ON11741882421e-19
KLLA0D16005g7.186ON11701882393e-19
TPHA0C044407.186ON11701882294e-18
KAFR0A016101.295ON12271092062e-15
ZYRO0G21296g1.295ON12271082044e-15
Kwal_14.24351.295ON1247972018e-15
NDAI0G056301.295ON12297082001e-14
KLTH0H09966g1.295ON12241231992e-14
SAKL0D06116g1.295ON12291061982e-14
NCAS0A093301.295ON12271161954e-14
KNAG0B052301.295ON1225951938e-14
TDEL0D016201.295ON12231011911e-13
TPHA0I010901.295ON12161111902e-13
Kpol_1018.21.295ON12111141892e-13
Smik_10.1671.295ON12291101883e-13
TBLA0C027401.295ON11191451849e-13
YJL074C (SMC3)1.295ON12301051849e-13
CAGL0H02805g1.295ON12191091821e-12
Ecym_63221.295ON12321091812e-12
Suva_6.1491.295ON12301051812e-12
Skud_10.1701.295ON12301111784e-12
AAL182W1.295ON1231961768e-12
KLLA0A00286g1.295ON1224721651e-10
NCAS0I005707.101ON10952751364e-07
SAKL0B09526g7.101ON10992561345e-07
KNAG0L006307.101ON11082571346e-07
ZYRO0G01584g7.101ON10883691274e-06
KLLA0F07997g7.101ON11192891274e-06
KLTH0D02816g7.101ON10942591257e-06
AEL337C7.101ON10973621231e-05
Kwal_26.72047.101ON11173731221e-05
Suva_15.1337.101ON10922821193e-05
Smik_15.1317.101ON10932771123e-04
TDEL0E013404.237ON1106851113e-04
YOL034W (SMC5)7.101ON10933651078e-04
NDAI0A084507.101ON11192781079e-04
KAFR0D013307.101ON10801831060.001
ZYRO0B12122g4.237ON1109781020.003
NCAS0J013904.237ON109668970.014
CAGL0H05071g4.237ON111076960.015
TPHA0B008404.237ON111968960.017
CAGL0F01155g7.101ON1105173960.018
TBLA0E021907.101ON1089159960.019
Kpol_483.104.237ON111867960.019
Skud_12.4684.237ON112068960.019
YLR383W (SMC6)4.237ON111468950.020
Suva_10.5004.237ON111568950.021
Smik_12.4704.237ON111468950.021
NDAI0J021804.237ON110868950.022
Skud_15.1217.101ON109362950.024
KNAG0B060104.237ON111768940.029
Kpol_1044.137.101ON110362940.029
TPHA0L006007.101ON111762930.036
Ecym_26257.101ON1097120930.036
TDEL0H034907.101ON110364930.040
KLLA0E05303g4.237ON109870910.062
Ecym_53444.237ON110254910.074
TBLA0I028904.237ON109871900.084
TBLA0A053001.67ON70761890.12
CAGL0K05489g5.679ON340121870.13
AER044W4.237ON110353870.18
TDEL0G028102.351ON109471860.26
SAKL0H03322g4.237ON111166860.26
Kwal_26.93804.237ON110285850.32
KAFR0A060404.237ON1102124840.41
Ecym_40415.679ON330117800.86
NDAI0F011806.289ON639184810.92
KLTH0D14080g4.237ON110278810.92
NCAS0B087001.67ON71572801.2
Suva_4.1914.238ON1782269801.4
ZYRO0F17050g1.67ON71472782.0
NCAS0G028302.215ON21781753.1
ZYRO0A07524g2.351ON109071763.4
NCAS0A093801.282ON101883746.2
Kwal_33.155611.527ON129773738.4
SAKL0G00616g5.679ON3301237110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B01970
         (1415 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  2618   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1466   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1388   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1384   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1382   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1365   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1365   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1349   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1322   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1321   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1307   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1273   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1271   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1263   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1245   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1217   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1207   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1170   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1151   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1145   0.0  
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   169   1e-41
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   138   4e-32
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   135   2e-31
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   133   1e-30
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             133   2e-30
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   133   2e-30
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   133   2e-30
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   132   2e-30
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   132   3e-30
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   132   3e-30
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   132   3e-30
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   131   6e-30
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   129   2e-29
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   127   1e-28
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   127   1e-28
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   126   2e-28
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   125   4e-28
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   122   4e-27
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   121   7e-27
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   119   3e-26
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   110   1e-23
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....   106   2e-22
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...   106   3e-22
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...   105   7e-22
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...   104   1e-21
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...   104   1e-21
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...   104   1e-21
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....   103   1e-21
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...   103   2e-21
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   103   2e-21
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...   103   2e-21
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...   103   3e-21
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...   103   3e-21
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...   101   7e-21
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....   101   8e-21
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...   100   2e-20
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...   100   2e-20
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    98   1e-19
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    97   3e-19
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    93   4e-18
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    84   2e-15
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    83   4e-15
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    82   8e-15
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    82   1e-14
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    81   2e-14
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    81   2e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    80   4e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    79   8e-14
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    78   1e-13
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    78   2e-13
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    77   2e-13
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    77   3e-13
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    75   9e-13
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    75   9e-13
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    75   1e-12
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    74   2e-12
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    74   2e-12
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    73   4e-12
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    72   8e-12
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    68   1e-10
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    57   4e-07
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    56   5e-07
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    56   6e-07
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    54   4e-06
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    54   4e-06
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    53   7e-06
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    52   1e-05
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    52   1e-05
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    50   3e-05
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    48   3e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    47   3e-04
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    46   8e-04
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    46   9e-04
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    45   0.001
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    44   0.003
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.014
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    42   0.015
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.017
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    42   0.018
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    42   0.019
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    42   0.019
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.019
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    41   0.020
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    41   0.021
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    41   0.021
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    41   0.022
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    41   0.024
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    41   0.029
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    41   0.029
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    40   0.036
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    40   0.036
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    40   0.040
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    40   0.062
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    40   0.074
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    39   0.084
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    39   0.12 
CAGL0K05489g Chr11 (538801..539823) [1023 bp, 340 aa] {ON} simil...    38   0.13 
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    38   0.18 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    38   0.26 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.26 
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    37   0.32 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    37   0.41 
Ecym_4041 Chr4 complement(90697..91689) [993 bp, 330 aa] {ON} si...    35   0.86 
NDAI0F01180 Chr6 complement(284217..286136) [1920 bp, 639 aa] {O...    36   0.92 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    36   0.92 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    35   1.2  
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...    35   1.4  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    35   2.0  
NCAS0G02830 Chr7 complement(520473..521126) [654 bp, 217 aa] {ON...    33   3.1  
ZYRO0A07524g Chr1 (615902..619174) [3273 bp, 1090 aa] {ON} highl...    34   3.4  
NCAS0A09380 Chr1 (1859233..1862289) [3057 bp, 1018 aa] {ON} Anc_...    33   6.2  
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...    33   8.4  
SAKL0G00616g Chr7 complement(59495..60487) [993 bp, 330 aa] {ON}...    32   10.0 

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 2618 bits (6785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1310/1415 (92%), Positives = 1310/1415 (92%)

Query: 1    MPESTNIPSPKRQKVLESHTPXXXXXXXXXXXXSPLRFEHQQSAVSLSPPAISKSHTPRK 60
            MPESTNIPSPKRQKVLESHTP            SPLRFEHQQSAVSLSPPAISKSHTPRK
Sbjct: 1    MPESTNIPSPKRQKVLESHTPEQQEENRREDDESPLRFEHQQSAVSLSPPAISKSHTPRK 60

Query: 61   LILHQSDNRYAFSQPTVSASSLQVPSLQPPETXXXXXRGRRDIKVYXXXXXXXXXXXXXX 120
            LILHQSDNRYAFSQPTVSASSLQVPSLQPPET     RGRRDIKVY              
Sbjct: 61   LILHQSDNRYAFSQPTVSASSLQVPSLQPPETSSSSSRGRRDIKVYSQSPPRSPGRSPTR 120

Query: 121  KLELIQLSPVKNNRIRKLQELYNSQIKKERLFINKLVLNNFKSYAGEQVIGPFNTNFSAV 180
            KLELIQLSPVKNNRIRKLQELYNSQIKKERLFINKLVLNNFKSYAGEQVIGPFNTNFSAV
Sbjct: 121  KLELIQLSPVKNNRIRKLQELYNSQIKKERLFINKLVLNNFKSYAGEQVIGPFNTNFSAV 180

Query: 181  VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYVVDKS 240
            VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYVVDKS
Sbjct: 181  VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYVVDKS 240

Query: 241  NGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQG 300
            NGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQG
Sbjct: 241  NGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQG 300

Query: 301  EVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEI 360
            EVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEI
Sbjct: 301  EVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEI 360

Query: 361  VEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQN 420
            VEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQN
Sbjct: 361  VEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQN 420

Query: 421  ESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRK 480
            ESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRK
Sbjct: 421  ESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRK 480

Query: 481  KEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXXXXXXXXXXXXXXXXXSLKDK 540
            KEKASKSIAQSKKLLKNYRNEIETLNVD                           SLKDK
Sbjct: 481  KEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEIKLSLKDK 540

Query: 541  TTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQENQSKLKDEIEKLKNDLKCQ 600
            TTDISNEIAQHER                 VAESQISLLQENQSKLKDEIEKLKNDLKCQ
Sbjct: 541  TTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLKNDLKCQ 600

Query: 601  FENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDARSRL 660
            FENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDARSRL
Sbjct: 601  FENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDARSRL 660

Query: 661  ATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDSVEC 720
            ATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDSVEC
Sbjct: 661  ATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDSVEC 720

Query: 721  GQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVL 780
            GQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVL
Sbjct: 721  GQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVL 780

Query: 781  RNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQENI 840
            RNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQENI
Sbjct: 781  RNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQENI 840

Query: 841  DIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDIS 900
            DIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDIS
Sbjct: 841  DIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDIS 900

Query: 901  SKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXXXDSTKNISEKIDKLK 960
            SKELESTQDQLKQKITFYERHTQNKDEVVEIEH             DSTKNISEKIDKLK
Sbjct: 901  SKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNISEKIDKLK 960

Query: 961  KRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAELDF 1020
            KRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAELDF
Sbjct: 961  KRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAELDF 1020

Query: 1021 KTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEGTKFK 1080
            KTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEGTKFK
Sbjct: 1021 KTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEGTKFK 1080

Query: 1081 SYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNNSINGVDRTSH 1140
            SYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNNSINGVDRTSH
Sbjct: 1081 SYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNNSINGVDRTSH 1140

Query: 1141 GGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADEFSPGIPRISKAKLLQIDVQALEA 1200
            GGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADEFSPGIPRISKAKLLQIDVQALEA
Sbjct: 1141 GGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADEFSPGIPRISKAKLLQIDVQALEA 1200

Query: 1201 EIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVXXXXXXXXXXXXXXXXXYDE 1260
            EIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAV                 YDE
Sbjct: 1201 EIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVERREALKKLLDELKKKRYDE 1260

Query: 1261 FMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANLSGG 1320
            FMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANLSGG
Sbjct: 1261 FMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANLSGG 1320

Query: 1321 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN 1380
            EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN
Sbjct: 1321 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN 1380

Query: 1381 MFELAQQLIGIYKRDNKTKSAAIRNKDFLKEADIV 1415
            MFELAQQLIGIYKRDNKTKSAAIRNKDFLKEADIV
Sbjct: 1381 MFELAQQLIGIYKRDNKTKSAAIRNKDFLKEADIV 1415

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1466 bits (3794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 797/1417 (56%), Positives = 1007/1417 (71%), Gaps = 29/1417 (2%)

Query: 6    NIPSPKRQKVLE--SHTPXXXXXXXXXXXX--SPL-RFEHQQSAVSLSPPAISKSHTPRK 60
            ++P+ KRQKV E  S TP              SPL R EHQQS   +SP   SKSHTPRK
Sbjct: 2    SLPNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQS---ISPINNSKSHTPRK 58

Query: 61   LILHQSDNRYAFSQPTVSASSLQVPSLQPPETXXXXXRGRRDIKVYXXXXXXXXXXXXXX 120
            LIL Q+DNRYAFSQP+VS+SS QVP+LQPP++     RGR+DIK Y              
Sbjct: 59   LILGQNDNRYAFSQPSVSSSSFQVPTLQPPDSSSS--RGRKDIKSYSQSPPRSPGRSPKR 116

Query: 121  KLELIQLSPVKNNRIRKLQELY---NSQIKKERLFINKLVLNNFKSYAGEQVIGPFNTNF 177
            +LELIQLSPVKNNRI KL+ELY   NSQ KKERLFINKL LNNFKSYAG+QV+GPF+T+F
Sbjct: 117  RLELIQLSPVKNNRI-KLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSF 175

Query: 178  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYVV 237
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP+L SCSVDVEF Y +
Sbjct: 176  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAI 235

Query: 238  DKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLI 297
            D+ +G +KI + KPKL+I+RKAFKNNSSKY+INGKES+YT+VTKLLKEEGIDLDHKRFLI
Sbjct: 236  DEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLI 295

Query: 298  LQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENR 357
            LQGEVENIAQMKPKAE+E DDGLLEYLEDIIGT+ YK  IEK+ IE+++LNEICIEKENR
Sbjct: 296  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENR 355

Query: 358  FEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEE 417
            FEIV+REKNSLES KN ALEF++KE++LTLSKSKLLQYN+ + + KL +TLQK+S L EE
Sbjct: 356  FEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEE 415

Query: 418  YQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSY 477
            Y  E +K +  Q E N+ +    +   KI  ++ + K     KR L+ +  SL+EK+K+ 
Sbjct: 416  YNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNL 475

Query: 478  TRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXXXXXXXXXXXXXXXXXSL 537
            T+KK K  K IA ++K + +  +EI+ L                               L
Sbjct: 476  TQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKL 535

Query: 538  KDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQENQSKLKDEIEKLKNDL 597
            K+KT+ IS EI  HE                  + ESQISLLQE Q KLK++I+ L  ++
Sbjct: 536  KEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEV 595

Query: 598  KCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDAR 657
              Q   K  +EE L++LK Q S+I+ E   GE+EC + +SK+K+M++VL  QRQ+  +AR
Sbjct: 596  SNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEAR 655

Query: 658  SRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDS 717
              LA V+N+ KVL+AL+KLQKSGRI GF+GRLGDLG IDN YD+A+STA  RLDDIVV++
Sbjct: 656  LALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVET 715

Query: 718  VECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFY 777
            VECGQ CIEYLRKNKLGYARFILL+KLR+     IQTP+NV RLFDL+KP    F+PAFY
Sbjct: 716  VECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFY 775

Query: 778  SVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQ 837
            SVLR+TLVAKDLKQANRVAYG  R+RVVT+DGKLID+SGT++GGG   ++GLM L++KGQ
Sbjct: 776  SVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQ 835

Query: 838  ENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDT 897
               D Y+ +D+E+IEK+L ++E NF+ AN+ ++EME  LQ+L +RKPE+ELEISK +M+ 
Sbjct: 836  NYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEI 895

Query: 898  DISSKELESTQDQLKQKITFYERHTQNKDEV-VEIEHXXXXXXXXXXXXXDSTKNISEKI 956
            D  S E++S + QL++K        Q+ +E+ V IE+             D TK   +KI
Sbjct: 896  DTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIEN-LQKLKEEHLALQDKTKAKKKKI 954

Query: 957  DKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGA 1016
              LK++IM+IGGI+LQ+QNSKV SI+Q IDI+ +KQK+  +S KK + E+ +++K L  +
Sbjct: 955  ASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTS 1014

Query: 1017 ELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEG 1076
            + D    + ++   S+ ++ +  SL +ID++  + +     L+ EC  LK+K+ + E   
Sbjct: 1015 KNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENI 1074

Query: 1077 TKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNNSINGVD 1136
             +FKS+EI+V ++LEKLN LL HIK  IK  ++ L  L LR    +         +  +D
Sbjct: 1075 NEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQV---------LMALD 1125

Query: 1137 RTSHG----GGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADEFSPGIPRISKAKLLQ 1192
              S       G    +Q      + + N     +  M+ID+ A+  S G+P +S  +L  
Sbjct: 1126 EESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSA 1185

Query: 1193 IDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVXXXXXXXXXXXX 1252
            +D+  +E E+  LE+Y+  T+ NI+VLEEY +RL ++ +RKLDLN AV            
Sbjct: 1186 LDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEE 1245

Query: 1253 XXXXXYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWR 1312
                 Y+EFM GFGIISMTLKEMYQMITMGGNAELEL+DSLDPFSEGVTFSVMPPKKSWR
Sbjct: 1246 LKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR 1305

Query: 1313 NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1372
            NI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
Sbjct: 1306 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1365

Query: 1373 IVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409
            IVISLRNNMFELAQQL+GIYK +N+T SA I+N++ L
Sbjct: 1366 IVISLRNNMFELAQQLVGIYKCENRTHSATIKNREIL 1402

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1388 bits (3593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 748/1373 (54%), Positives = 962/1373 (70%), Gaps = 19/1373 (1%)

Query: 50   PAI----SKSHTPRKLILHQSDNRYAFSQPTVSAS-SLQVPSLQPPETXXXXXRGRRDIK 104
            PA+    +KSHTPRKL+L   +NRYAFSQPT SA+ SL VP+LQPP T     RGR D K
Sbjct: 49   PALETSYAKSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSS---RGR-DYK 104

Query: 105  VYXXXXXXXXXXXXXXKLELIQLSPVKNNRIRKLQELYNSQI----KKERLFINKLVLNN 160
             Y              +LEL+QLSPVKN+R+ +LQ+LYNS      ++ RLFIN+LVL N
Sbjct: 105  AYSQSPPRSPGRSPTRRLELLQLSPVKNSRV-ELQKLYNSHQSSTKQQGRLFINELVLEN 163

Query: 161  FKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSES 220
            FKSYAG QV+GPF+T+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE+
Sbjct: 164  FKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEA 223

Query: 221  FPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVT 280
            FPNL SCSV V F+YV+D+S+G+S+ID+ KP L+ITRKAFKNNSSKY+INGKESSYTEVT
Sbjct: 224  FPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVT 283

Query: 281  KLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKN 340
            KLLK EGIDLDHKRFLILQGEVENIAQMKPKAE+E DDGLLEYLEDIIGTA+YK  IE+ 
Sbjct: 284  KLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQ 343

Query: 341  TIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKE 400
              +++ LNE+C+EKENRFEIV+REKNSLES K  ALEF+ KE++LTL KSKL Q+ +L+ 
Sbjct: 344  MNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQS 403

Query: 401  HEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKK 460
            + KLASTL+K+S L ++++ E  KF+ + ++  +++   K++  +I S     K+   ++
Sbjct: 404  NSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLER 463

Query: 461  RELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXX 520
            REL+  + SLEE+ K+   K EK+ ++   +K+ +    + ++ L+              
Sbjct: 464  RELEGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLN 523

Query: 521  XXXXXXXXXXXXXXXSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQ 580
                           SLKDKT DIS EI QHE+                 +AES++SLL+
Sbjct: 524  QLLEEERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLE 583

Query: 581  ENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIK 640
            E QSKLK  +E ++  +  +  +K+  ++ +++LK + S++  E  +GE   ++A  K++
Sbjct: 584  ETQSKLKKNVETMEEKILARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLE 643

Query: 641  DMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYD 700
            +MQ VL T RQ+ M+ARS L+  +NKSKVL+AL KLQKSGRI+GF+GRLGDLG+IDN +D
Sbjct: 644  EMQKVLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFD 703

Query: 701  IAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKR 760
            +AISTA  RLDD+VVD+VEC Q CI+YLRKNKLGYARFILL++LR   L+ I TPENV R
Sbjct: 704  VAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPR 763

Query: 761  LFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITG 820
            LFDLVKP    F  AFYSVLR+TLVA+ LKQAN VAYG  RFRVVT+DGKLIDISGTI+G
Sbjct: 764  LFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISG 823

Query: 821  GGKQTAQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLK 880
            GG   ++GLM+L       ID Y+ +++ KIE EL ERENNF+ ANDT  EME  L+ L+
Sbjct: 824  GGNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLR 883

Query: 881  DRKPELELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXX 940
            D++P +E +ISK  M+ D  + EL   + Q+K+    Y     +K +V  I         
Sbjct: 884  DQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKG 943

Query: 941  XXXXXXDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMK 1000
                    TK   EKI  L+  IM+IGG  LQMQNSKV S+ Q +DI+ +K K+  S +K
Sbjct: 944  EHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIK 1003

Query: 1001 KIENEIRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEI 1060
            K E ++ + +K L  +E D +  S E+ +  ++++  +  L   D    +  N  SEL+ 
Sbjct: 1004 KSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRSELKE 1063

Query: 1061 ECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTT 1120
            E   LKE + E E    +FKS EI++K++LEKLN+LL HIK+ I + ++ L  L +R+ T
Sbjct: 1064 ESEQLKEMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVT 1123

Query: 1121 TIFGDEGDNNSINGV--DRTSHGGGVPLQDQNKVVRENNMRNEKNSTE--AEMEIDDVAD 1176
                +  DNN+++ V  D       V  +  ++   E N++ E+ + +    M+ID+ ++
Sbjct: 1124 HTL-EILDNNTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSN 1182

Query: 1177 EFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDL 1236
            E   GIPR S+ +L ++D++ LE EI +L  Y+  TNV+I VLEEYARRLA++  RKLDL
Sbjct: 1183 EVIRGIPRFSEEELKELDIELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRRKLDL 1242

Query: 1237 NQAVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPF 1296
            NQAV                 +DEFM GF IISMTLKEMYQMITMGGNAELEL+DSLDPF
Sbjct: 1243 NQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPF 1302

Query: 1297 SEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356
            SEGVTFSVMPPKKSWRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV
Sbjct: 1303 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1362

Query: 1357 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409
            SIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYKRDN+T+S  ++N D L
Sbjct: 1363 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDIL 1415

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1384 bits (3581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 739/1373 (53%), Positives = 959/1373 (69%), Gaps = 27/1373 (1%)

Query: 51   AISKSHTPRKLILHQSDNRYAFSQPTVSA-SSLQVPSLQPPETXXXXXRGRRDIKVYXXX 109
            + +KSHTPRKL+L   +NRYAFSQPT SA SSL VP+LQPPE      RGR D K Y   
Sbjct: 54   SYAKSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPS---RGR-DYKAYSQS 109

Query: 110  XXXXXXXXXXXKLELIQLSPVKNNRIRKLQELYNSQI----KKERLFINKLVLNNFKSYA 165
                       +LEL+QLSPVKN+RI +LQ+LY+S      ++ RLFI+KLVL NFKSYA
Sbjct: 110  PPRSPGRSPTRRLELLQLSPVKNSRI-ELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYA 168

Query: 166  GEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLP 225
            G+QV+GPF+T+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FPNL 
Sbjct: 169  GKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQ 228

Query: 226  SCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKE 285
            SCSV V F+YVVD+ +G+S+ID+ KP L+ITRKAF+NNSSKY+INGKES+YT+VTKLLK 
Sbjct: 229  SCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKN 288

Query: 286  EGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVD 345
            EGIDLDHKRFLILQGEVENIAQMK KAE+E DDGLLEYLEDIIGTA+YK  IE    +++
Sbjct: 289  EGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIE 348

Query: 346  TLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLA 405
            TLNEIC+EKENRFEIV REKNSLES K  ALEF++KE++LTL KSKL Q+ +L+ + KLA
Sbjct: 349  TLNEICLEKENRFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLA 408

Query: 406  STLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQN 465
            STL+K S L +++++E  KF+ + +E +++E   K++  ++ S     K    +KREL++
Sbjct: 409  STLEKTSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELES 468

Query: 466  KKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXXXXXXX 525
             + SLEE+ K+   K  KA K +  +   +    + +E L+ +                 
Sbjct: 469  TRVSLEERTKNLVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEE 528

Query: 526  XXXXXXXXXXSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQENQSK 585
                      SLKDKT DIS EI QHE+                 +AES++SLL+E Q K
Sbjct: 529  ERRILDDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVK 588

Query: 586  LKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHV 645
            LK   E L+ ++  +   K+  +  ++DLK    ++     +GE + + A  K+K+MQ +
Sbjct: 589  LKKNAEALEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTI 648

Query: 646  LQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAIST 705
            L   RQ+ M+ARS L+  ENKSKVL+AL +LQKSGRI+GF+GRLGDLGVID+ +D+AIST
Sbjct: 649  LNAHRQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAIST 708

Query: 706  ASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLV 765
            A  RLDD+VVD+VEC QHCI+YLRKNKLGYARFILL++LR   L+ + TPENV RLFDLV
Sbjct: 709  ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLV 768

Query: 766  KPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQT 825
            KP    F  AFYSVLR+TLVA+DLKQAN VAYG  RFRVVT+DGKLIDISGT++GGG   
Sbjct: 769  KPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHV 828

Query: 826  AQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPE 885
             +GLM++ K   + +D Y+ +++ KIE EL ERE NF+ ANDT  EMEQ L++++D++P+
Sbjct: 829  VKGLMRIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPD 888

Query: 886  LELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXX 945
            +E +I +  M+ D  + EL   ++Q+K+    Y++   +  ++ +I              
Sbjct: 889  MESQILRAEMEADSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDL 948

Query: 946  XDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENE 1005
               TK   E+I  L+ +IM+IGG +LQ+QNSKV S+ Q IDI+ +K K+  S +KK   +
Sbjct: 949  QAETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGD 1008

Query: 1006 IRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNL 1065
            + + +K L   E D +  S E+    ++ E ++  L   D     + N  S+LE +   L
Sbjct: 1009 VTKFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQL 1068

Query: 1066 KEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGD 1125
            KEK+ E E +  +FKS E+++K++LEKLN+LL +IK  IK+ +++L  L +R+ T     
Sbjct: 1069 KEKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLI 1128

Query: 1126 EGDNNSINGVDRTSHGGGVPLQDQNKVVRENNMRNEKNSTEAE---------MEIDDVAD 1176
              DNN ++ +D+         +D+ +  +E+     K  T+ E         M ID+ +D
Sbjct: 1129 -LDNNQMDILDKEG-------EDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETSD 1180

Query: 1177 EFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDL 1236
            E S GIPR+S+ +L +++++ LE +IG+L  Y+  TNV+I VLEEYARRLA++  RKLDL
Sbjct: 1181 EVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDL 1240

Query: 1237 NQAVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPF 1296
            NQAV                 +DEFM GF IISMTLKEMYQMITMGGNAELEL+DSLDPF
Sbjct: 1241 NQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPF 1300

Query: 1297 SEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356
            SEGVTFSVMPPKKSWRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV
Sbjct: 1301 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1360

Query: 1357 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409
            SIVANYIKERTKNAQFIVISLRNNMFELAQQL+G+YKRDN+TKS  ++N D L
Sbjct: 1361 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDIL 1413

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1382 bits (3577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 744/1387 (53%), Positives = 977/1387 (70%), Gaps = 31/1387 (2%)

Query: 47   LSPPAISKSHTPRKLILHQSDNRYAFSQPTVSASS-----LQVPSLQPPETXXXXXRGRR 101
            ++  +  KSHTPRKL+L  +DN+Y  SQP +S+SS     LQVP+LQPP       RGR 
Sbjct: 35   VTASSFLKSHTPRKLLLGSADNKYVLSQPIISSSSHGSSSLQVPNLQPP--LSQPSRGR- 91

Query: 102  DIKVYXXXXXXXXXXXXXXKLELIQLSPVKNNRIRKLQELYNSQIK-KERLFINKLVLNN 160
            D K Y              KLELIQLSP+KNNRI +LQ+LYNS+ + K RL+I+KLVL +
Sbjct: 92   DKKAYSQSPPRSPGRSPVRKLELIQLSPIKNNRI-ELQKLYNSKNQNKVRLYIDKLVLQD 150

Query: 161  FKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSES 220
            FKSYAG Q++GPFNT+FSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSE+
Sbjct: 151  FKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEA 210

Query: 221  FPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVT 280
            FPN+ SCSV+V FQYV+D+++G+SKI +++  L++ RKAFKNNSSKY+INGKES+YTEVT
Sbjct: 211  FPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVT 270

Query: 281  KLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKN 340
            +LLKEEGIDLDHKRFLILQGEVENIAQMK KAE+EGDDGLLEYLEDIIGT+ YK+ IE  
Sbjct: 271  RLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDK 330

Query: 341  TIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKE 400
             +E++ LNEIC+EKE RFEIVE EKNSLES K+AALEF+ KE++LTL +SKL QY + + 
Sbjct: 331  MVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQT 390

Query: 401  HEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKK 460
            + KLA+TL K+S  +   Q E +K+E  Q E ++     ++ N+KI +     +    KK
Sbjct: 391  NTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKK 450

Query: 461  RELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXX 520
            RE   +  S+EE+IK+ T+KK KA K++   +  ++   + ++ L               
Sbjct: 451  REYDGQCVSMEERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQ 510

Query: 521  XXXXXXXXXXXXXXXSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQ 580
                           SLKDKT DIS++I+ +E+                 +AES+ISLL+
Sbjct: 511  KELDKERSKLDDIKLSLKDKTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLK 570

Query: 581  ENQSKLKDEIEKLK---NDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKS 637
            E+Q+KLK+ +  LK   +D++ + +NK +  E   +LK +  ++  E   GESEC+ AK 
Sbjct: 571  ESQAKLKEGLGSLKVEIDDVRKEIDNKNSIIE---NLKKEQVSLKKEVSLGESECSRAKE 627

Query: 638  KIKDMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDN 697
            K K+M+ +L + RQ+ +DARS L   ENKS VLSAL +LQKSGRI+GF+GRLGDLGVI +
Sbjct: 628  KEKEMRVILNSHRQRAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIAD 687

Query: 698  EYDIAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPEN 757
            +YDIAISTA +RLDDIVVDSVECGQ CIEYLRKNKLGYARFILL+KLRN  L ++QTPEN
Sbjct: 688  KYDIAISTACSRLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPEN 747

Query: 758  VKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGT 817
            V RLFDLV+P    F  AFYSVLR+TLVA D++QANRVAYG  R+RVVT+DGKLIDISGT
Sbjct: 748  VLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGT 807

Query: 818  ITGGGKQTAQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQ 877
            +TGGG   ++GLMKL+    E++++Y   D+EKIE++L ERENNFK A+DT  EM   L+
Sbjct: 808  MTGGGSHVSKGLMKLKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELK 867

Query: 878  RLKDRKPELELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXX 937
            RL+D++PE+ELEI+K LMD D  + +L   + QLK+    Y      KD +   E     
Sbjct: 868  RLQDKEPEIELEIAKLLMDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQT 927

Query: 938  XXXXXXXXXDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGIS 997
                     D +++  EKI+ LK+ IM+IGG +LQ+QNSKV+S+ + I I+ +K K+  +
Sbjct: 928  LRNEHRALEDQSQSKKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKA 987

Query: 998  SMKKIENEIRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSE 1057
            ++K+ E E+++ ++    AELD   C  ++++    + ++   L   +  F  + NE  +
Sbjct: 988  TIKRTEKELQKVQRLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDD 1047

Query: 1058 LEIECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELR 1117
            L  +C +LKEKI + E    ++KS+EI++K++LEKLN+LL + K+ I+  +++L++  +R
Sbjct: 1048 LTGQCESLKEKIKDMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVR 1107

Query: 1118 NTTTIF---GDEGDNNSI------NGVD-RTSHGGGVPLQDQNKVVR--ENNMRNEKNST 1165
            + T       +E  NNS+      N +D  +SH   V   D    +   +N+ +NE    
Sbjct: 1108 DVTQSLEKIQNENANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEK 1167

Query: 1166 EAE---MEIDDVADEFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEY 1222
            E +   M++D+V +E S GIP+++   L  ID+ +LE+EI QL++YV  +N +I++LEEY
Sbjct: 1168 EQDADIMDLDNVTEEVSKGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEY 1227

Query: 1223 ARRLADYNSRKLDLNQAVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMITMG 1282
             RRL ++  RKLDLN  V                 +DEFM+GF IIS+TLKEMYQMITMG
Sbjct: 1228 IRRLEEFKKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMG 1287

Query: 1283 GNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLY 1342
            GNAELEL+DSLDPFSEGVTFSVMPPKKSWRNI NLSGGEKTLSSLALVFALHKYKPTPLY
Sbjct: 1288 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLY 1347

Query: 1343 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAA 1402
            VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYKR N T+SA 
Sbjct: 1348 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSAT 1407

Query: 1403 IRNKDFL 1409
            ++NKD L
Sbjct: 1408 LKNKDIL 1414

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1365 bits (3534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/1374 (53%), Positives = 954/1374 (69%), Gaps = 26/1374 (1%)

Query: 51   AISKSHTPRKLILHQSDNRYAFSQPTVSAS-SLQVPSLQPPETXXXXXRGRRDIKVYXXX 109
            + ++SHTPRKL+L   +NRYAFSQPT SA+ SL VP+LQPP+      RGR D K Y   
Sbjct: 54   SYARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSS---RGR-DYKAYSQS 109

Query: 110  XXXXXXXXXXXKLELIQLSPVKNNRIRKLQELYNSQI----KKERLFINKLVLNNFKSYA 165
                       +LEL+QLSPVKN+RI +LQ+LY+S      ++ RLFINKLVL+NFKSYA
Sbjct: 110  PPRSPGRSPARRLELLQLSPVKNSRI-ELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYA 168

Query: 166  GEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLP 225
            G QV+GPF+T+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE+FP+L 
Sbjct: 169  GRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQ 228

Query: 226  SCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKE 285
            +CSV V F+Y++D+ +G+S+ID+ KP L+ITR+AFKNNSSKY+IN KESSYTEVTKLLK+
Sbjct: 229  ACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKK 288

Query: 286  EGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVD 345
            EGIDLDHKRFLILQGEVENIAQMKPKAE+E DDGLLEYLEDIIGTA+YK  IE+   +++
Sbjct: 289  EGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIE 348

Query: 346  TLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLA 405
            +LNEIC+EK NRFEIV+REKNSLES K  ALEF+KKE++LTL KSKLLQ+ +L+ + KLA
Sbjct: 349  SLNEICLEKANRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLA 408

Query: 406  STLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQN 465
            STL+K+S L  E+++E  KF+ + RE ++++   K +  +I S     K  + +KREL+ 
Sbjct: 409  STLEKISSLNREFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEG 468

Query: 466  KKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXXXXXXX 525
             + SLEE+ K+   K  KA K++  +K  +    +  + L                    
Sbjct: 469  SRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEE 528

Query: 526  XXXXXXXXXXSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQENQSK 585
                      SLKDKT DIS +I +HE+                 +AES++SLL+E ++K
Sbjct: 529  ERIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAK 588

Query: 586  LKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHV 645
            LK   E L+  +  + + K+  +  ++DL  +  ++     +GE +  +A  K+K+MQ +
Sbjct: 589  LKKNAEALEEKIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRI 648

Query: 646  LQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAIST 705
            L   RQ+ M+ARS L+  +NK+ VL+AL KLQKSGRI+GF+GRLGDLGVIDN +D+AIST
Sbjct: 649  LNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAIST 708

Query: 706  ASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLV 765
            A  RLDD+VVD+VEC QHCI+YLRKNKLGYARFILL++LR   L+ I TPENV RLFD+V
Sbjct: 709  ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVV 768

Query: 766  KPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQT 825
            KP    F  AFYSVL++TLVA+DLKQAN+VAYG  RFRVVT+DGKLIDISGT++GGG   
Sbjct: 769  KPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHV 828

Query: 826  AQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPE 885
             +GLM+L     + I+ Y+ +++ KIE EL ERE NF+ ANDT  EME+ L++++D++P+
Sbjct: 829  MKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPD 888

Query: 886  LELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXX 945
            LE +IS+  M+ D  + EL   + Q K+    Y++    K +V E+              
Sbjct: 889  LESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDL 948

Query: 946  XDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENE 1005
               T+   E+I  L+ +IM+IGG  L  QNSKV S+ Q IDI+  K K+  S +KK E +
Sbjct: 949  QSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGD 1008

Query: 1006 IRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNL 1065
            + + +K L   E D +  S E+    ++++  + +L   D    ++ N  SEL+ +   L
Sbjct: 1009 VLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQL 1068

Query: 1066 KEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGD 1125
            KE++ E E    +FKS EI++K++LEKLN+LL HIK  IK+ D++L  L +R+ T     
Sbjct: 1069 KERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTL-Q 1127

Query: 1126 EGDNNSINGVD---------RTSHGGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVAD 1176
              DNN ++ V+               G+P  D  K+  +++  N  +S    M ID+++ 
Sbjct: 1128 MLDNNQMDVVEDGIKDEQDADQDKPSGIP--DDEKIQEKDDADNNHHS----MNIDEMSS 1181

Query: 1177 EFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDL 1236
            E S GIP++ + +L  +D++ LE++I  L  Y+  T+V+I VLEEY RRL ++  RKLDL
Sbjct: 1182 EISRGIPKLCEEELKDLDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDL 1241

Query: 1237 NQAVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPF 1296
            NQAV                 +DEFM GF IISMTLKEMYQMITMGGNAELEL+DSLDPF
Sbjct: 1242 NQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPF 1301

Query: 1297 SEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356
            SEGVTFSVMPPKKSWRNI NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNV
Sbjct: 1302 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNV 1361

Query: 1357 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFLK 1410
            SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDN+TKS  ++N D LK
Sbjct: 1362 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILK 1415

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1365 bits (3534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/1377 (53%), Positives = 964/1377 (70%), Gaps = 27/1377 (1%)

Query: 50   PAI----SKSHTPRKLILHQSDNRYAFSQPTVSAS-SLQVPSLQPPETXXXXXRGRRDIK 104
            PA+    SKS+TPRKL+L   +NRYAFSQPT S + SL VP+LQPP+T     RGR D K
Sbjct: 49   PALEASYSKSYTPRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSS---RGR-DHK 104

Query: 105  VYXXXXXXXXXXXXXXKLELIQLSPVKNNRIRKLQELYN----SQIKKERLFINKLVLNN 160
             Y              +LEL+QLSPVKN+R+ +LQ++Y+    S  ++ RLFIN+LVL N
Sbjct: 105  SYSQSPPRSPGRSPTRRLELLQLSPVKNSRV-ELQKIYDRHQSSSKQQSRLFINELVLEN 163

Query: 161  FKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSES 220
            FKSYAG+QV+GPF+T+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE+
Sbjct: 164  FKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEA 223

Query: 221  FPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVT 280
            FP+L SCSV V FQYV+D+S+G+S+ID+ KP LIITRKAFKNNSSKY+IN KESSYTEVT
Sbjct: 224  FPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVT 283

Query: 281  KLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKN 340
            KLLK EGIDLDHKRFLILQGEVENIAQMKPKAE+E DDGLLEYLEDIIGTA+YK  IE+ 
Sbjct: 284  KLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEER 343

Query: 341  TIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKE 400
              +++ LNE+C+EKENRFEIV+REKNSLES K  ALEF++KE++LTL +SKL Q+ +L+ 
Sbjct: 344  MGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQS 403

Query: 401  HEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKK 460
            + KLASTL+K+S   ++ ++E  KF+ + ++ ++++   K++  +I S     K    ++
Sbjct: 404  NSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLER 463

Query: 461  RELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXX 520
            REL+  + SLEE+ K+   K EKA K++  +K  +    N +E L               
Sbjct: 464  RELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLT 523

Query: 521  XXXXXXXXXXXXXXXSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQ 580
                           SLKDKT +IS EI +HE+                 +AES++SLL+
Sbjct: 524  QLLEKERSILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLE 583

Query: 581  ENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIK 640
            E Q+KLK  +E L+  +  +  +K+  ++ ++DLK + +++  E  +GE    +A  K+K
Sbjct: 584  ETQAKLKKNVETLEEKILAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLK 643

Query: 641  DMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYD 700
            +MQ VL   RQ+ M+ARS L+  +NKSKVL+AL +LQKSGRI+GF+GRLGDLGVID+ +D
Sbjct: 644  EMQKVLNAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFD 703

Query: 701  IAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKR 760
            +AISTA  RLDD+VVD+VEC QHCI+YLRKNKLGYARFILL++LR   L+ I TPENV R
Sbjct: 704  VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPR 763

Query: 761  LFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITG 820
            LFDLVKP    F  AFYSVLR+TLVA++LKQAN VAYG  RFRVVT+DGKLIDISGT++G
Sbjct: 764  LFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSG 823

Query: 821  GGKQTAQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLK 880
            GG   A+GLMKL     + +D Y+ ++++KIE+EL ERENNF+ A+DT  EME+ L++L+
Sbjct: 824  GGNHVAKGLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLR 883

Query: 881  DRKPELELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXX 940
            D +P+LE +ISK  M+ D  + EL   + Q+K+    Y +   +K ++  +         
Sbjct: 884  DHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRG 943

Query: 941  XXXXXXDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMK 1000
                    TK   EKI  L+  IM+IGGI LQMQNSKV S+ Q +DI+ +K K+  S+ K
Sbjct: 944  EYNDLQSETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASK 1003

Query: 1001 KIENEIRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEI 1060
            K   ++ + +K L  +E D +  S E+    ++++  + +L   D    +  N   EL+ 
Sbjct: 1004 KSGGDVVKFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKE 1063

Query: 1061 ECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTT 1120
            +   LKE++ + E    +FKS EI++K++LEKLN+LL +IK  I + ++ L  L +R+ T
Sbjct: 1064 QSEQLKEQMEDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVT 1123

Query: 1121 TIFGDEGDNNSINGVDRTSHGGGVPLQDQNKVVRENNMRNEKNSTEAE--------MEID 1172
               G   D+N ++ V           Q+ ++  R    ++E    +AE        M ID
Sbjct: 1124 HTLG-MLDDNKMDSVKEDVKNN----QELDQEYRSCETQDESEIKDAETSCDNYHPMNID 1178

Query: 1173 DVADEFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSR 1232
            + +DE S GIPR+S+ +L ++DV+ +E++I +L  YV  TNV+I VLEEYARRLA++  R
Sbjct: 1179 ETSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRR 1238

Query: 1233 KLDLNQAVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDS 1292
            KLDLN AV                 +DEFM GF IISMTLKEMYQMITMGGNAELEL+DS
Sbjct: 1239 KLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDS 1298

Query: 1293 LDPFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1352
            LDPFSEGVTFSVMPPKKSWRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD
Sbjct: 1299 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1358

Query: 1353 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409
            FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+G+YKRDN+TKS  I+N D L
Sbjct: 1359 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDIL 1415

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1349 bits (3491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 719/1372 (52%), Positives = 956/1372 (69%), Gaps = 32/1372 (2%)

Query: 55   SHTPRKLILHQSDNRYAFSQPTVSASSLQVPSLQPPETXXXXXRGRRDIKVYXXXXXXXX 114
            SHTP+KL++  +D+  + SQP VS+SSLQ PSLQ P +     RGR   + Y        
Sbjct: 40   SHTPKKLVIGTNDDTTSQSQPIVSSSSLQAPSLQHPNSSS---RGREQ-RTYSQSPPRSP 95

Query: 115  XXXXXXKLELIQLSPVKNNRIRKLQELYN---SQIKKERLFINKLVLNNFKSYAGEQVIG 171
                  KLELI++SPVK NR+ +LQ LY+   SQ    RL INKLVL +FKSYAG QV+G
Sbjct: 96   GRSPTRKLELIKISPVKKNRL-ELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVG 154

Query: 172  PFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDV 231
            PF+++FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE  PNL SCSV+V
Sbjct: 155  PFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEV 214

Query: 232  EFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLD 291
             FQYVVD+ +G+++ID+ KP L++TRKAFKNNSSKY++N KES+YTEVT+LLK+EGIDLD
Sbjct: 215  HFQYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLD 274

Query: 292  HKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEIC 351
            HKRFLILQGEVENIAQM+PKAE+EG+DGLLEYLEDI GTA YK  IE    E++ LNE C
Sbjct: 275  HKRFLILQGEVENIAQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESC 334

Query: 352  IEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKL 411
            IEKENRF IV++EK+SLE+ K+ ALEF++KE+ LTL +SK++QY I +   KL STL K 
Sbjct: 335  IEKENRFHIVDQEKSSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKS 394

Query: 412  SVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLE 471
            S L+ +   E+ K+  T +E + L+D  KQ+ K+I ++  + K   ++KR L  ++ ++E
Sbjct: 395  SKLKGQLDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIE 454

Query: 472  EKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXXXXXXXXXXXXX 531
            EKIKS  +K  KA K +  ++  L      +  L                          
Sbjct: 455  EKIKSVNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLE 514

Query: 532  XXXXSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQENQSKLKDEIE 591
                SLK+KT +IS  IAQ+E+                 +AES++SLL++  +++  +IE
Sbjct: 515  DVKISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIE 574

Query: 592  KLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQ 651
            +LKN++    E K  +E+ + +LK + S ++ E     +EC++A +++K M  +L  QRQ
Sbjct: 575  QLKNEIARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQ 634

Query: 652  KVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLD 711
            + +DAR+  ++ +NKS VL+AL KLQKSGRISGF+GRLGDLGVID +YD+AISTA  RL+
Sbjct: 635  RTLDARAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLE 694

Query: 712  DIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDI 771
            DIVV+SVECGQ CIEYLRKNKLGYARFILL+KLR     +IQTPENV RLFDLVKP  D 
Sbjct: 695  DIVVESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDK 754

Query: 772  FIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMK 831
            FIPAFYSVLR+TL A+ L QANRVAYG  RFRVV++DGKLIDISGT++GGG    +GLM+
Sbjct: 755  FIPAFYSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMR 814

Query: 832  LRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEIS 891
            L +    + DI+S +++ ++E EL E+E +F+ A+DT+ EME  L++LKDR PE++L++S
Sbjct: 815  LSQNNSYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVS 874

Query: 892  KCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXXXDSTKN 951
            K +M+T+    EL+  +  L +++   ++ T   +E    E              D T  
Sbjct: 875  KLVMETESWMSELKLKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTT 934

Query: 952  ISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEK 1011
              +KI  LK +IMEIGG +LQ+QNSKV S IQ ++I+ SKQK+G +S+KK ENE+++S K
Sbjct: 935  TRQKIAVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAK 994

Query: 1012 ALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINE 1071
             +   + D    S+E+ S  +  ++V+++L S++++  + ++ + E+  +   LK+++ +
Sbjct: 995  IVGNTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQ 1054

Query: 1072 AEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFG--DEGD- 1128
             E   T+FKS +I++ D+LEKLN LL HI + +++ +  L  L++R+ T      DEG+ 
Sbjct: 1055 MEAGFTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGES 1114

Query: 1129 -NNS----------INGVDRTSHGGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADE 1177
             NNS            G D T   G     +++ V    +M  EK++ E  ME+D+   E
Sbjct: 1115 TNNSKMPNELQEKRTEGADATRQEG-----EESDV----SMEEEKSNDEV-MEVDEKPHE 1164

Query: 1178 FSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLN 1237
               G+PR+S+A+L  +DV+ L A+I  L+ YV   NV++++LEEYA+RLA++  RK+DLN
Sbjct: 1165 LENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLN 1224

Query: 1238 QAVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFS 1297
            +AV                 +DEFMQGFGIISMTLKEMYQMITMGGNAELEL+DSLDPFS
Sbjct: 1225 EAVGERDAMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFS 1284

Query: 1298 EGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1357
            EGVTFSVMPPKKSWRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS
Sbjct: 1285 EGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1344

Query: 1358 IVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409
            IVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK  N TKSA+++N D L
Sbjct: 1345 IVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDIL 1396

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1322 bits (3421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 722/1397 (51%), Positives = 968/1397 (69%), Gaps = 52/1397 (3%)

Query: 46   SLSPPAISKSH-------TPRKLILHQSDNRYAFSQPTVSASSLQVPSLQPPETXXXXXR 98
            +LS P  S S        TPRKL++   DNRYA S  ++S+SSLQVP LQPP T     R
Sbjct: 33   NLSLPTTSSSQNTFAHAKTPRKLVVGNGDNRYAHSSQSISSSSLQVPPLQPPATSS---R 89

Query: 99   GRRDIKVYXXXXXXXXXXXXXXKLELIQLSPVKNNRIRKLQELYNSQ---IKKERLFINK 155
            GR   K Y              KLELIQ+SP+KN+R+ +LQ++Y++Q    +  RL I++
Sbjct: 90   GRGS-KTYSQSPPRSPGRSPTRKLELIQISPLKNSRL-ELQKIYDAQQNQARHTRLCIDQ 147

Query: 156  LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
            L+L +FKSYAG QV+GPFNT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI
Sbjct: 148  LILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 207

Query: 216  HKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESS 275
            HKSE +P+LPSCSV+V F+YV+D+ +G ++ID+ KP L++TRKAF+NN+SKY++N +E++
Sbjct: 208  HKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETN 267

Query: 276  YTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKS 335
            Y EVTKLLK+EG+DLDHKRFLILQGEVENIAQMK KAEREG+DGLLEYLEDIIGTA YK 
Sbjct: 268  YGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKP 327

Query: 336  SIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQY 395
             IEKN  ++++LN+ICIEKENRF+IV+REKNSLE+ K  AL F++ ER+LT+SKSKL QY
Sbjct: 328  LIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQY 387

Query: 396  NILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKN 455
            +IL  + KL +TL K++ L ++ + ES K  + ++E +KL     ++  K+ +   + K 
Sbjct: 388  HILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQ 447

Query: 456  NTSKKRELQNKKASLEEKIKSYTRKKEKASKS--------------IAQSKKLLKNYRNE 501
               KKREL  K    EEKIK++ +K++KA K+              +++ K+L  +Y N 
Sbjct: 448  LLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENS 507

Query: 502  IETLNVDXXXXXXXXXXXXXXXXXXXXXXXXXXXSLKDKTTDISNEIAQHERXXXXXXXX 561
            ++ LN                             SLKDKT  IS EIAQ E+        
Sbjct: 508  LKELN--------------EQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQ 553

Query: 562  XXXXXXXXXVAESQISLLQENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAI 621
                     +AESQISL++E ++KL  EI++ K +++ + +      ++L  L  Q  ++
Sbjct: 554  LQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSV 613

Query: 622  STEFDRGESECANAKSKIKDMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGR 681
              E   GE EC NA+ ++K+MQ++L TQRQK +DARS L+  ENKSKVL+AL +LQKSGR
Sbjct: 614  KEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGR 673

Query: 682  ISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILL 741
            ISGF+GRLGDLGVID +YD+AISTA  RL+DIVV++VECGQ CIEYLRKNKLGYARFILL
Sbjct: 674  ISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILL 733

Query: 742  EKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATR 801
            +KLR   L  I TPE+V RLFDL+ P    F  AF+SVL NTLVA DLKQANRVAYG  R
Sbjct: 734  DKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKR 793

Query: 802  FRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENN 861
            FRVVT+DG LIDISGT++GGG + ++GLM++ +   E+I+IYS++++ ++E  LVERE N
Sbjct: 794  FRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKN 853

Query: 862  FKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDISSKELESTQDQLKQKITFYERH 921
            F+ A+DT ++ME+ L+ LK+++P +E  IS+  M+ +  + E++  + Q+ +    Y   
Sbjct: 854  FQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSAT 913

Query: 922  TQNKDEVVEIEHXXXXXXXXXXXXXDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSI 981
              N  E+ E                + TK+   +I+ LK  IMEIGG +L++Q+SKV+S+
Sbjct: 914  QDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSV 973

Query: 982  IQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSL 1041
            IQ IDI+ SKQK+  S +KK ENEI +S K       D +  ++E+ +    +E ++ SL
Sbjct: 974  IQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSL 1033

Query: 1042 GSIDETFLKLENENSELEIECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIK 1101
              + E+   +++    L  E   L++K+N+   +   FKS+E+++K+ LEKLN+L  H+K
Sbjct: 1034 NKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLK 1093

Query: 1102 RVIKEYDEQLRALELRNTTTIFG---DEGDN------NSINGVDRTSHGGGVPLQDQNKV 1152
            + IK Y+E+L  L++R+ T I     DE +N      N ++ V+ +    G    +   +
Sbjct: 1094 KEIKHYEEKLGDLKIRDVTQILHDLKDESNNASDPSENPVSDVEESESSVGEGKDENKDL 1153

Query: 1153 VRENNMRNEKNSTEAEMEIDDVADEFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAIT 1212
              ++ +++ +   + +M+++D  +    G+ + S+ +L +I+++ LE EI  L+ ++  +
Sbjct: 1154 DAQDQVQDAEKQGDNQMDVEDGGEYSDRGLTQFSEDELHEIEIEELEKEIEDLQNFLDAS 1213

Query: 1213 NVNIDVLEEYARRLADYNSRKLDLNQAVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTL 1272
            N +IDVLEEYARRL ++ SR+LDLNQAV                 +DEFMQGFGIISMTL
Sbjct: 1214 NADIDVLEEYARRLIEFKSRRLDLNQAVEERNKVKEKLDELKKKRFDEFMQGFGIISMTL 1273

Query: 1273 KEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFA 1332
            KEMYQMITMGGNAELEL+D+LDPFSEGVTFSVMPPKKSWRNI NLSGGEKTLSSLALVFA
Sbjct: 1274 KEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFA 1333

Query: 1333 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIY 1392
            LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIY
Sbjct: 1334 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIY 1393

Query: 1393 KRDNKTKSAAIRNKDFL 1409
            KRDNKTKSA I+N DF+
Sbjct: 1394 KRDNKTKSATIKNIDFV 1410

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1321 bits (3418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 738/1402 (52%), Positives = 960/1402 (68%), Gaps = 36/1402 (2%)

Query: 37   RFEHQQSAVSLS---PPAIS----KSHTPRKLILHQSDNRYAFSQPTVS---ASSLQVPS 86
            R+  Q+  VS +     A+S    KS TP+KLIL   D+  A + PT +   +SSLQ PS
Sbjct: 30   RYNRQEIKVSPTTQDAAAVSHLNFKSQTPKKLILRDYDS-IAIT-PTAAMPPSSSLQAPS 87

Query: 87   LQPPETXXXXXRGRRDIKVYXXXX----XXXXXXXXXXKLELIQLSPVKNNRIRKLQELY 142
            L PP       RGR   + Y                  KLELIQLSPVKN+RI  LQ++Y
Sbjct: 88   LHPP--TESSSRGRT-ARTYSQSPPRSPARSPARSPTRKLELIQLSPVKNSRI-ALQKIY 143

Query: 143  NSQIKK--ERLFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFG 200
             S+ +K  ERL I+KLVL++FKSYAG QV+GPF+++FSAVVGPNGSGKSNVIDSMLFVFG
Sbjct: 144  ESKNEKQIERLCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFG 203

Query: 201  FRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAF 260
            FRA+KMRQDRLSDLIHKSE+FP+L SCSV+V F+YV+DK +G++ I+  K KL+ITRKAF
Sbjct: 204  FRASKMRQDRLSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAF 263

Query: 261  KNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGL 320
            KNN+SKY+INGKES+YT VTKLLK+EGIDLDH RFLILQGEVENIAQMKPKAE +GDDGL
Sbjct: 264  KNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENDGDDGL 323

Query: 321  LEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVK 380
            LEYLEDIIGTA YK  IEK   E++ LNEICIEKENRFEIV+REK SLES K+ ALEF++
Sbjct: 324  LEYLEDIIGTAKYKPLIEKKFEEIEALNEICIEKENRFEIVDREKASLESGKDEALEFLE 383

Query: 381  KERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFK 440
            KE+ LTL KSKL QY + ++++KL++TL+KLS ++EE++    K   T+ + N++  ++ 
Sbjct: 384  KEKELTLVKSKLYQYKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYH 443

Query: 441  QMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRN 500
            +M K I + +E  K    +KR    ++ SLEE+ K+  +KK+K  K +    K + N + 
Sbjct: 444  EMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQRKNIMKKKKKMEKELEDCNKTISNTKI 503

Query: 501  EIETLNVDXXXXXXXXXXXXXXXXXXXXXXXXXXXSLKDKTTDISNEIAQHERXXXXXXX 560
            +IE L  +                           SLKDKT + S+EI+QHE+       
Sbjct: 504  KIEDLGKNESEYESQLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNL 563

Query: 561  XXXXXXXXXXVAESQISLLQENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSA 620
                      V ES+ISL++E + KL+++IE L + +  + E K ++E+++  L+ + + 
Sbjct: 564  QLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSLISVKIEEKISREKEIGSLRNELNR 623

Query: 621  ISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSG 680
            I+ E   G++E  NAK K+++M+ VL   RQK +DAR+ L+  ENK++VL++L +LQKSG
Sbjct: 624  ITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSG 683

Query: 681  RISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFIL 740
            RISGFYGRLGDLG ID+ YDIAISTA  RL+D+VV++VECGQ CIEYLRKNKLGYARFIL
Sbjct: 684  RISGFYGRLGDLGAIDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFIL 743

Query: 741  LEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGAT 800
            LEKLRN  + +I TP NV RLFDLV      F+PAFYSVLR+TLV  +LK ANRVAYG  
Sbjct: 744  LEKLRNFDMNKISTPNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNK 803

Query: 801  RFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQENIDIYSNDDIEKIEKELVEREN 860
            RFRVVT+ G+LID+SGT++GGG QT++GLMKL K G      Y+ +D+EKIEKEL  RE 
Sbjct: 804  RFRVVTLSGELIDVSGTMSGGGTQTSRGLMKLTKSGNSGFKSYTIEDVEKIEKELAAREK 863

Query: 861  NFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDISSKELESTQDQLKQKITFYER 920
            NF+ AN+T+ EME  L+RLKDRKP++ELEISK  ++      E E  Q QL +K    + 
Sbjct: 864  NFEIANETFTEMETELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSLDE 923

Query: 921  HTQNKDEVVEIEHXXXXXXXXXXXXXDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNS 980
               N +E+  +EH               TK+  ++I  LK  IM++GGI LQ+Q+SKV+S
Sbjct: 924  CMSNNEELSTMEHELGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDS 983

Query: 981  IIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAELDFKTCSKEMDSFSQEMESVERS 1040
            IIQ  DI+  K K+  + +KK E E++R  K  S    D  T + ++++   ++  + +S
Sbjct: 984  IIQKKDILNGKHKKDKNDLKKAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKISKS 1043

Query: 1041 LGSIDETFLKLENENSELEIECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHI 1100
            L   +    +LE    E      NLK+++ E E     FK ++++ +++ EKLNNLL  I
Sbjct: 1044 LSETETLLHELEFSREESLQNSENLKDQLKEFEENLNSFKVFQLEHQNKEEKLNNLLNFI 1103

Query: 1101 KRVIKEYDEQLRALELRNTTTIFGDEGDNNSING--VDRTSHGGGVPLQDQNKVVRENNM 1158
            K+ I+  D +L++L++R+ T     E DN +I+    D +     V +   N +    NM
Sbjct: 1104 KKDIRSTDSELQSLKIRDITHTL-QELDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENM 1162

Query: 1159 RN---EKNSTEA--------EMEIDDVADEFSPGIPRISKAKLLQIDVQALEAEIGQLEE 1207
                 E N ++         EMEID+  +E S GIPRIS+ +   +DV+ LEA+  QL++
Sbjct: 1163 EGVEIETNESDVSPDANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQD 1222

Query: 1208 YVAITNVNIDVLEEYARRLADYNSRKLDLNQAVXXXXXXXXXXXXXXXXXYDEFMQGFGI 1267
            Y+   NVNIDVLEEYARR+A+Y  RKLDLN AV                 ++EFMQGFG+
Sbjct: 1223 YIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGV 1282

Query: 1268 ISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSL 1327
            IS+TLKEMYQMITMGGNAELEL+DSLDPFSEGVTFSVMPPKKSWRNI NLSGGEKTLSSL
Sbjct: 1283 ISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSL 1342

Query: 1328 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ 1387
            ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+Q
Sbjct: 1343 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQ 1402

Query: 1388 LIGIYKRDNKTKSAAIRNKDFL 1409
            L+GIYK +N+TKSA ++N D +
Sbjct: 1403 LVGIYKSNNQTKSATLQNNDII 1424

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1307 bits (3382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 725/1398 (51%), Positives = 953/1398 (68%), Gaps = 49/1398 (3%)

Query: 44   AVSLSPPAISK--SHTPRKLILHQSDNRYAFSQPTVSASSLQVPSLQPPETXXXXXRGRR 101
            AV  SP    +  S TPRKL+L   + +YA+SQ   ++SSL VP+LQPP       RGRR
Sbjct: 39   AVKSSPTRQDRLPSPTPRKLVLGSPEKKYAYSQ-PSTSSSLSVPNLQPPNVDGS--RGRR 95

Query: 102  DIKVYXXXX----XXXXXXXXXXKLELIQLSPVKNNRIRKLQELYNSQIKK-----ERLF 152
                Y                  +LELIQLSPVKNNR  +LQ++Y+ + K       RL 
Sbjct: 96   ---FYSQSPPRSPHRSPNRSPTRRLELIQLSPVKNNRA-ELQKIYDEKNKDGNQCVHRLC 151

Query: 153  INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 212
            I+KL L+NFKSYAG Q+IGPF+T+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS
Sbjct: 152  IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLS 211

Query: 213  DLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGK 272
            DLIHKSE++PNL SCSVD+ F+YVVD+S+G+++ DD KP ++ITRKAF+NNSSKY+I+GK
Sbjct: 212  DLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGK 271

Query: 273  ESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTAD 332
            ES+YTEVT+LL+++GIDLDHKRFLILQGEVE+I+QMKPKAERE DDGLLEYLEDIIGTA 
Sbjct: 272  ESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAK 331

Query: 333  YKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKL 392
            YK+ IE   +E+DTLN++C+EKENRFE+VE+EKNSLES K+ ALEF++KE+ LTL KSKL
Sbjct: 332  YKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKL 391

Query: 393  LQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKED 452
             QY+I ++  KL+ TL K+S L E    E  K++  QRE  +L +      K++V + ++
Sbjct: 392  AQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKE 451

Query: 453  MKNNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXX 512
             K+ TSK+R +  +K S+EEK ++  +K+ KA K +  ++  + + ++++E LN      
Sbjct: 452  HKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQY 511

Query: 513  XXXXXXXXXXXXXXXXXXXXXXXSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVA 572
                                   SL+DKT++IS EIA HER                 + 
Sbjct: 512  KEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLT 571

Query: 573  ESQISLLQENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESEC 632
            ESQI++L+E++ K    I +LK +++   E    QE  +  L+ + + I    D GE EC
Sbjct: 572  ESQIAILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKEC 631

Query: 633  ANAKSKIKDMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDL 692
             +A SK+ +M++VL + RQ+ M+ARS L+ VENK+KVLSAL +LQ+SGRI+GF+GRLGDL
Sbjct: 632  GSASSKLGEMKNVLISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDL 691

Query: 693  GVIDNEYDIAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRI 752
            G ID+ YD+AISTA  RLDDIVVD+VECGQ CIE+LRKNKLGYARFI+L+KLR   L  I
Sbjct: 692  GTIDDMYDVAISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPI 751

Query: 753  QTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLI 812
            QTPE V RLFDLV+     F+PAFYSVLR+TLV  DLKQANRVAYG  RFRVVT+DGKLI
Sbjct: 752  QTPETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLI 811

Query: 813  DISGTITGGGKQTAQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEM 872
            D SGT++GGG    +GLMK +++       Y+ ++++ IEKEL ERE NF  A +T+ +M
Sbjct: 812  DTSGTLSGGGTHVMKGLMKSKQQPGAG---YTPEEVQNIEKELNEREKNFHIAIETFHDM 868

Query: 873  EQALQRLKDRKPELELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIE 932
            E+AL++ KDR+PE+E+EI+K  +D + SS EL+  Q+QLK+  T  +  +    E+ + E
Sbjct: 869  EEALKKFKDREPEIEVEIAKRRLDIESSSTELKLKQEQLKELETDRDGGSVEDRELADAE 928

Query: 933  HXXXXXXXXXXXXXDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQ 992
                          + TKN  + I+ LK++IM+IGG  LQ+QNSKVNSI + I+II SKQ
Sbjct: 929  SKLQVLSEEYDEIENETKNKQQLINSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQ 988

Query: 993  KRGISSMKKIENEIRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLE 1052
            K+  ++ KK EN+++R E     A  D ++C+ E+   S     +E  +  +D +  + E
Sbjct: 989  KKDRTATKKAENDLKRLENQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNETE 1048

Query: 1053 NENSELEIECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLR 1112
            +   E+E E   +K  + E     + FKS EI++ +RLEKLN L  HIK+ IK   ++L 
Sbjct: 1049 SLKEEVEEEFERVKTNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELN 1108

Query: 1113 ALELRNTTTIFG--DEGDNNSINGVDRTSHGGGVPLQDQNKVVRENNMRNEKNS------ 1164
            +L++R+ T      +EG     N  D         +QD+     +  M ++ N+      
Sbjct: 1109 SLKIRDITQTLQALNEGKLPEENEDD-------FEVQDEEVQREQREMSSDPNAMDIDEE 1161

Query: 1165 ----------TEAE---MEIDDVADEFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAI 1211
                      T+ E   M+ID+  +E S G+P+ S+A+L  I ++ +E +I +L  YV  
Sbjct: 1162 QAAEQFQVQQTDGEIDSMDIDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDN 1221

Query: 1212 TNVNIDVLEEYARRLADYNSRKLDLNQAVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMT 1271
             +V+IDVLEEYARRLA+Y  RKLDLNQAV                  D+FM+GF IISMT
Sbjct: 1222 AHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMT 1281

Query: 1272 LKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVF 1331
            LKEMYQMITMGGNAELEL+DSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVF
Sbjct: 1282 LKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVF 1341

Query: 1332 ALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGI 1391
            ALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GI
Sbjct: 1342 ALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1401

Query: 1392 YKRDNKTKSAAIRNKDFL 1409
            YK +N T+S  ++N D L
Sbjct: 1402 YKNNNMTRSTTLQNIDIL 1419

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1273 bits (3293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/1371 (50%), Positives = 924/1371 (67%), Gaps = 30/1371 (2%)

Query: 57   TPRKLILHQSDNRYAFSQPTV-SASSLQVPSLQPPETXXXXXRGRRDIKVYXXXXXXXXX 115
            TP KL+      ++  SQ +  S ++L+ PSLQPP T     RGR    VY         
Sbjct: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPP-TYSQLSRGR---SVYSQSPPRSPN 70

Query: 116  XXXXXKLELIQLSPVKNNRIRKLQELYNS-QIKKERLFINKLVLNNFKSYAGEQVIGPFN 174
                 ++ELIQLSP+KN+R+ +LQ++Y+  Q   +RL I  L+LNNFKSYAG QV+GPF+
Sbjct: 71   RSPARRIELIQLSPIKNSRL-ELQKIYDGKQTTTKRLSIKNLILNNFKSYAGVQVVGPFH 129

Query: 175  TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQ 234
            ++FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE+  NL  CSV++ FQ
Sbjct: 130  SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQ 189

Query: 235  YVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKR 294
            YV+D ++G++K+  +  +L + RK FKNN+SKY+INGKESSYTEVT+ L+ EGIDLDHKR
Sbjct: 190  YVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKR 249

Query: 295  FLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEK 354
            FLILQGEVE+IAQMKPKA+ EGDDGLLEYLEDIIGTA YKS I    +E+DTLN+IC+EK
Sbjct: 250  FLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEK 309

Query: 355  ENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVL 414
            E RFE+VE+EK SLE+ K  ALEF+ KE++LTL KSK LQ++I KE +KLA TL K+S  
Sbjct: 310  EIRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAF 369

Query: 415  QEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKI 474
             E+ +NE  K+   Q+E   L +    + ++I  I  +       K +LQ +  S EEK+
Sbjct: 370  TEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKL 429

Query: 475  KSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXXXXXXXXXXXXXXXX 534
            KS  +K+ KA K++  ++K +++  N I  LN                            
Sbjct: 430  KSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIK 489

Query: 535  XSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQENQSKLKDEIEKLK 594
             SL+DKT+ IS E+A  E+                 +AES+I +++E++ KL+ EI +L+
Sbjct: 490  MSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLR 549

Query: 595  NDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVM 654
             D++   +  +N ++K+  L+ + +AI++     + EC +AK K+ DM+ VL   RQ++ 
Sbjct: 550  KDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMT 609

Query: 655  DARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIV 714
            DAR  L+ VENK+KVL AL +LQKSGRI GF+GRLGDLG ID++YDIAIS A  RLDDIV
Sbjct: 610  DARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIV 669

Query: 715  VDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIP 774
            V++VEC Q CIE+LRKNKLGYARFILL+KL+   + ++ TPENV RLFDL  P  +IF P
Sbjct: 670  VETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAP 729

Query: 775  AFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRK 834
            A YSVLR+TLVAKDL QANRVAYG  RFRVVT+DGKLIDISGT++GGG +  +GLMK ++
Sbjct: 730  ALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQ 789

Query: 835  KGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCL 894
            +     D+Y++++++++E EL +RE NFK A DT+ EME ALQ+ KDR+P +++EISK  
Sbjct: 790  RSN---DMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHK 846

Query: 895  MDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXXXDSTKNISE 954
            +D D  S EL+S +D L +  +  E + ++   + +IE+             D +K  +E
Sbjct: 847  IDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNE 906

Query: 955  KIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALS 1014
            +I +L+ +IM+IGG+ LQ QNSKV+S+ Q + II +KQK+  + +KK E E+ R+ K   
Sbjct: 907  QISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKL 966

Query: 1015 GAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEI 1074
            GAE D   C  E+   +   E+++  L   +     +E++  +L  E    K+ +++   
Sbjct: 967  GAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAA 1026

Query: 1075 EGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNN---- 1130
               KFKS EI++   LEKL NL  HIK  I   DE+L  L+LR+   +     ++N    
Sbjct: 1027 YVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLE 1086

Query: 1131 SINGVDRTSHGGGVP---LQDQN--------KVVREN-NMRNEKNSTEAEMEIDDVADEF 1178
            S+     T     +P   ++D +        K++ E+ N  N++ S    M++D  A   
Sbjct: 1087 SLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQES----MDVDQDASYI 1142

Query: 1179 SPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQ 1238
             PG+P++++A+L  ID++ L  EI QL+EY+     +ID+LEEYA RLA+Y  RKLDLN+
Sbjct: 1143 GPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNE 1202

Query: 1239 AVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSE 1298
            +V                  +EFM GFGIISMT+KE+YQMITMGGNAELEL+DSLDPFSE
Sbjct: 1203 SVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSE 1262

Query: 1299 GVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1358
            GV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI
Sbjct: 1263 GVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1322

Query: 1359 VANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409
            VANYIKERTKNAQFIVISLRNNMFELAQQLIGIYK  N TKS  ++N D L
Sbjct: 1323 VANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDIL 1373

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1271 bits (3289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/1390 (49%), Positives = 939/1390 (67%), Gaps = 29/1390 (2%)

Query: 46   SLSPPAISKSHTPRKLILHQSDNRYAFSQPTVSASS-LQVPSLQPPET-XXXXXRGRRDI 103
            S+SP    K+ TPRKLI+  S+N+YA SQPT SASS LQVP+LQ          RGRR I
Sbjct: 56   SVSPLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRR-I 114

Query: 104  KVYXXXX----XXXXXXXXXXKLELIQLSPVKNNRI--RKLQELYNSQIKK-ERLFINKL 156
            K+Y                  KLELIQLSP+KN+R+  +KL + +N++I K  RL+I+KL
Sbjct: 115  KMYSQSPPRSPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKL 174

Query: 157  VLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH 216
            VL+NFKSYAGEQ IGPF+ +FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH
Sbjct: 175  VLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH 234

Query: 217  KSESFPNLPSCSVDVEFQYVVDKSNGSSKID--DNKPKLIITRKAFKNNSSKYFINGKES 274
            KSE F NL  CSV+V F+YV D+    +  D  + +  L+ITRKAFKNNSSKYFINGKES
Sbjct: 235  KSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKES 294

Query: 275  SYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYK 334
            ++TEVTKLLKE+GIDLDHKRFLILQGEVENIAQMK KAE++ +DGLLEYLEDIIGT  YK
Sbjct: 295  NFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYK 354

Query: 335  SSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQ 394
              IE+ T+E++ +NE+CIEKENRF IV+ EKNSLE  K+AALEF++KE++LTL KSKL Q
Sbjct: 355  PLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQ 414

Query: 395  YNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMK 454
            Y++   ++K+ +TL ++  L+ +++ E  +     +E   L+++  +    + S+  + K
Sbjct: 415  YHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEK 474

Query: 455  NNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXX 514
            +   +KRE+  +  SLEE  K+  +K +KA  ++  SK L+    +E++  +        
Sbjct: 475  SLIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEA 534

Query: 515  XXXXXXXXXXXXXXXXXXXXXSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAES 574
                                  LKDKT   S+EIA  E+                 + E 
Sbjct: 535  EVNDLSKQREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEM 594

Query: 575  QISLLQENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECAN 634
            +I L+++++ K+  EIE LK +L    ++ ++ E+ + DL      +  E   G+ EC +
Sbjct: 595  EIDLIRDSKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKD 654

Query: 635  AKSKIKDMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGV 694
            A  K+ +M+ +L + RQK M+ARS ++T +NK+KVL++L ++Q+SGRI+GF+GRLGDLG+
Sbjct: 655  AGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGI 714

Query: 695  IDNEYDIAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQT 754
            I ++YD+AISTA  RLDD+VV+SVECGQ CIE+LRKNKLGYARF++L+KL+   +  IQT
Sbjct: 715  IADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQT 774

Query: 755  PENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDI 814
            PENV RLFDLVKP +  F PA YSVLR+TLVAKDLKQANRVAYG  RFRVVT+DG+LIDI
Sbjct: 775  PENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDI 834

Query: 815  SGTITGGGKQTAQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQ 874
            SGT++GGG +  +GLM L  K     +I+S +D++K+E EL  RE  F  A++T+  MEQ
Sbjct: 835  SGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQ 894

Query: 875  ALQRLKDRKPELELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHX 934
             L++L DR+P+LELEISK L+D D  +++++ T+ QL +K   YE+  ++ D++  +   
Sbjct: 895  ELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGN 954

Query: 935  XXXXXXXXXXXXDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKR 994
                        D +K  SE++  LK  IM IGG +LQ+QNSKV+S+ Q IDI+++K K+
Sbjct: 955  LEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKK 1014

Query: 995  GISSMKKIENEIRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENE 1054
              + +KK+  E++++ K+L  +  +    ++E+       E  + SL  I+++   +++E
Sbjct: 1015 SKTVVKKLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDE 1074

Query: 1055 NSELEIECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRAL 1114
               LE E  N  +K++E+     +FK+ ++++++++E+ N++L ++K+   +  E+L   
Sbjct: 1075 KINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNF 1134

Query: 1115 ELRNTTTIF-------GDEGDNNSINGVDRTSH--------GGGVPLQDQNKVVRENNMR 1159
             LR+ T          G E +     G D T+              +++ N     N+++
Sbjct: 1135 RLRDVTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVK 1194

Query: 1160 NEKNSTEAEMEIDDVADEFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVL 1219
                S E  M++DD  D  S GIPR+S  +L  ID   L  EI QL+ ++   ++NI++L
Sbjct: 1195 --VASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEIL 1252

Query: 1220 EEYARRLADYNSRKLDLNQAVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMI 1279
            EEYA+RL ++  RK+DLN +V                 Y+EFM+GF IISMTLKEMYQMI
Sbjct: 1253 EEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMI 1312

Query: 1280 TMGGNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPT 1339
            TMGGNAELEL+DSLDPFSEGVTFSVMPPKKSWRNI NLSGGEKTLSSLALVFALHKYKPT
Sbjct: 1313 TMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPT 1372

Query: 1340 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTK 1399
            PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL+GIYK +N TK
Sbjct: 1373 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTK 1432

Query: 1400 SAAIRNKDFL 1409
            +A IRN++ L
Sbjct: 1433 NATIRNREDL 1442

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1263 bits (3267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/1390 (50%), Positives = 927/1390 (66%), Gaps = 36/1390 (2%)

Query: 42   QSAVSLSPPAISKSHTPRKLILHQSDNRYAFSQPTVSASSLQVPSLQPPETXXXXXRGRR 101
            Q+  S+     S+S TPRKL+L   D R+AFSQP  S+SS  VP LQP ++     RGR 
Sbjct: 21   QTEESVDVTRASRSRTPRKLVLGSPDKRFAFSQPVTSSSS-NVPYLQPLKSELSSSRGR- 78

Query: 102  DIKVYXXXXXXXXXXXXXXKLELIQLSPVKNNRI--RKLQELYNSQIKKERLFINKLVLN 159
               VY              KLELIQLSP K  R+  +K +++       ERL IN+L L+
Sbjct: 79   ---VYSQSPPRSPTRSPTRKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLH 135

Query: 160  NFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 219
            NFKSYAG QV+GPF+++FSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSE
Sbjct: 136  NFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSE 195

Query: 220  SFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEV 279
            + PNL SC V+V FQYV D+ +G + +  ++P L++TRKAFKNN+SKY++NGKESSYT+V
Sbjct: 196  AHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQV 255

Query: 280  TKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEK 339
            T+LL++EGIDLDHKRFLILQGEVE+IAQMKPKAE+EGDDGLLEYLEDIIGTA YK  IE+
Sbjct: 256  TELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQ 315

Query: 340  NTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILK 399
              +++D LN++C EKENR+EIVEREK+SLES K+ ALEF++KE++LT  +SKLLQ+ + K
Sbjct: 316  TLVQIDQLNDVCQEKENRYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWK 375

Query: 400  EHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSK 459
               K  +T +K+  L+E+   E  K+   +RE  +LE   K +N  I  IK+   + TS+
Sbjct: 376  NSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSE 435

Query: 460  KRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXX 519
            KR     + SLEEK+K+ ++KK KA K+   +   +   + ++E L  D           
Sbjct: 436  KRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDEL 495

Query: 520  XXXXXXXXXXXXXXXXSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLL 579
                            SLK KT  IS +I + E+                 + E++IS+L
Sbjct: 496  NKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVL 555

Query: 580  QENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKI 639
            +E+ +K+ +EI K +ND+    +    Q + +  L+ + + I  +   G++EC NA +K+
Sbjct: 556  KESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKM 615

Query: 640  KDMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEY 699
            K+M+ VL T RQ+ +DA+S L+T ENK+KVLSAL +LQ+SGRISGF+GRLGDLG ID++Y
Sbjct: 616  KEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKY 675

Query: 700  DIAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVK 759
            D+AISTA  RLDD+VV++VECGQ CIE+LRKNKLGYARFILL+KLR+  +  IQTP NV 
Sbjct: 676  DVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVS 735

Query: 760  RLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTIT 819
            RLFDLV P  + F  AFYSVLR+TLVAKDLK+ANRVAYG  RFRVVT+DGKLID+SGT++
Sbjct: 736  RLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMS 795

Query: 820  GGGKQTAQGLMKLRKKGQENIDI---YSNDDIEKIEKELVERENNFKFANDTYFEMEQAL 876
            GGG   A G+MK      E ++    ++ +++ +I++EL ERE NFK A DT  EME AL
Sbjct: 796  GGGNHRASGMMK-----SERLNTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDAL 850

Query: 877  QRLKDRKPELELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXX 936
            Q LKDR+PE+E +ISK  M+ D    E++  +D+        + +  + D ++E      
Sbjct: 851  QSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLD 910

Query: 937  XXXXXXXXXXDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGI 996
                         K+   KI +L+++IM+IGG  LQ+Q S V+SI Q I I   KQKR  
Sbjct: 911  SLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDK 970

Query: 997  SSMKKIENEIRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENS 1056
            +++KK EN+++R EK      +D   C+ E++S  + + S +  +  ++ +  KL+ E  
Sbjct: 971  TAVKKAENDLKRYEKQAGQLSVDIDQCTNELESIKELISSSDNKILELEASIDKLQKEGE 1030

Query: 1057 ELEIECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALEL 1116
            E+E +   ++  I E   EG  F  +E+D+ ++LEKLN+LL HI +   +  +QL +L++
Sbjct: 1031 EIEEKVREIERLIEEKSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKI 1090

Query: 1117 RNTTTIF-------------GDEGDNNSINGVDRTSHGGGVPLQDQNKVVRENNMRNEKN 1163
            R+ T                GDE    S     +    G +   D      E  M NE  
Sbjct: 1091 RDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVD----TVEGCMGNEPT 1146

Query: 1164 STEAE--MEIDDVAD-EFSPG-IPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVL 1219
            +++ E  M++D+  + E SP  +P++++A+L +++V+ +E EIGQL ++V     +I+VL
Sbjct: 1147 ASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKELNVEEVELEIGQLNDFVENAYADIEVL 1206

Query: 1220 EEYARRLADYNSRKLDLNQAVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMI 1279
            EEY +RL D+ +RKL+LN+AV                  DEFM GF  ISMTLKEMYQMI
Sbjct: 1207 EEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMI 1266

Query: 1280 TMGGNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPT 1339
            TMGGNAELEL+DSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPT
Sbjct: 1267 TMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPT 1326

Query: 1340 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTK 1399
            PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK  N TK
Sbjct: 1327 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTK 1386

Query: 1400 SAAIRNKDFL 1409
            S A+ NKD +
Sbjct: 1387 SVALENKDLI 1396

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1245 bits (3221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 683/1380 (49%), Positives = 926/1380 (67%), Gaps = 53/1380 (3%)

Query: 57   TPRKLILHQSDNRYAFSQPTVSASS--LQVPSLQPPETXXXXXRGRRDIKVYXXXXXXXX 114
            TP KL+    D +   S+ +  +++  L+ PSLQPP       RGR     Y        
Sbjct: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPP-VAHQISRGRSQ---YSQSPPRSP 69

Query: 115  XXXXXXKLELIQLSPVKNNRIRKLQELYNSQIKK-ERLFINKLVLNNFKSYAGEQVIGPF 173
                   +ELIQLSP+KN+R+ +LQ LY+++ KK ERL I  LVL NFKSYAG QV+GPF
Sbjct: 70   NRSPGRAVELIQLSPIKNSRL-ELQRLYDTKQKKVERLCIRTLVLENFKSYAGRQVVGPF 128

Query: 174  NTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEF 233
            +++FSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSE +P+L  CSV+++F
Sbjct: 129  HSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQF 188

Query: 234  QYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHK 293
            QYVVD+ +G++++   KP+L + RKAFKNN+SKY++NGKES+YTEVT+LL++EGIDLDHK
Sbjct: 189  QYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHK 248

Query: 294  RFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIE 353
            RFLILQGEVE+IAQMKPKAE EGDDGLLEYLEDIIGT  YK+ IE+  +EVD+LN+IC+E
Sbjct: 249  RFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICME 308

Query: 354  KENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSV 413
            KENRF++VE+EK SLE  K+ AL F+KKE+ LTL  SK  QY++     KLA TL  +S 
Sbjct: 309  KENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSN 368

Query: 414  LQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEK 473
               + + E  K    Q+E  +L D  +Q+  ++VS+    K + +K R+L+ +  S EEK
Sbjct: 369  TMNKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEK 428

Query: 474  IKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXXXXXXXXXXXXXXX 533
             KS  +K+ KA K++   +K +K   N+IE                              
Sbjct: 429  QKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKM 488

Query: 534  XXSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQENQSKLKDEIEKL 593
              +L DKT DI+ E+A  E+                 + ES+IS+++E   KL+ EI  L
Sbjct: 489  KLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANL 548

Query: 594  KNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKV 653
              +++    N  ++EE +  L V+ S+I      GE EC +A+SK+++M+ VL T RQ+V
Sbjct: 549  SQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRV 608

Query: 654  MDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDI 713
             DARS +++ ENK+KVL+AL +LQKSGRI G++GRLGDLG ID++YDIAISTA  RLDDI
Sbjct: 609  NDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDI 668

Query: 714  VVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFI 773
            VVD+VECGQ CIE+LRKNKLGYARFILL+KLR   L+   TPENV RLFDLVKP +  F 
Sbjct: 669  VVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFA 728

Query: 774  PAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLR 833
            PAFYSVLR+TLV  DL QANRVAYG  R+RVVT+DGKLIDISGT+TGGG + A GLM   
Sbjct: 729  PAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLM--- 785

Query: 834  KKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKC 893
             K  +   +Y+ ++++++E+EL ERE NFK A +T+ EME ALQ   DR+PE+E+E+SK 
Sbjct: 786  -KSTQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQ 844

Query: 894  LMDTDISSKELESTQDQLKQKITFYERHT----QNKDEVVEIEHXXXXXXXXXXXXXDST 949
             MD +  S ELES   ++++K+   ER      ++  E+   E               ++
Sbjct: 845  KMDIETISAELES---KIERKLEL-ERSNKTSIEDSSELRTAEEKLAALNADLNSFMSAS 900

Query: 950  KNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRS 1009
            ++ +++I +L+ +IMEIGG++LQ  NSKV+S+ Q I I+ +KQK+  ++ KK E E++R+
Sbjct: 901  ESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRA 960

Query: 1010 EKALSGAELDFKTCSKEM-------DSFSQEMESVERSLGSIDETFLKLENENSELEIEC 1062
             K    A+ D + C  E+       D+ S  M+ +++ L  + E    L +E++  + E 
Sbjct: 961  RKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHEL 1020

Query: 1063 CNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTI 1122
                EKI+        + S EI++ ++L+KL NL  ++K+ + EYD +L  L+LR+   +
Sbjct: 1021 DQKNEKID-------SYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQV 1073

Query: 1123 FGDEGDNNSINGVDRTSHGGGVPLQDQNKVVRENNM---------RNEKNSTEAE----M 1169
              D  +N S+      SH    P  D  +   +++M          NE+  + AE    M
Sbjct: 1074 MLDLEENKSLQSF---SHS---PTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSM 1127

Query: 1170 EIDDVADEFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADY 1229
            E+D+ A     G+P++  ++L ++D++ LE +I QL++Y+  + V+I++L+EYA+RLA+Y
Sbjct: 1128 EVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEY 1187

Query: 1230 NSRKLDLNQAVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMITMGGNAELEL 1289
              R++DLN+A+                  DEFM+GFGIIS+TLKEMYQMITMGGNAELEL
Sbjct: 1188 RRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELEL 1247

Query: 1290 IDSLDPFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1349
            +DSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA
Sbjct: 1248 VDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1307

Query: 1350 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409
            ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ+L+GIYK  N T+S  ++N+D +
Sbjct: 1308 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDII 1367

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1217 bits (3150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 676/1373 (49%), Positives = 911/1373 (66%), Gaps = 27/1373 (1%)

Query: 53   SKSHTPRKLILHQSDNRYAFSQPTVSASSLQVPSLQPPETXXXXXRGRRDIKVYXXXXXX 112
            S+S TPRKL+L   D R+AFSQP VS+SS  VP LQP +      RGR    VY      
Sbjct: 32   SRSRTPRKLVLGSPDKRFAFSQP-VSSSSSNVPHLQPLKNELSSSRGR----VYSQSPPR 86

Query: 113  XXXXXXXXKLELIQLSPVKNNRI--RKLQELYNSQIKKERLFINKLVLNNFKSYAGEQVI 170
                    KLELIQLSP+K +R+  +K QE        +RL I++LVL+NFKSYAG QV+
Sbjct: 87   SPNRSPTRKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVV 146

Query: 171  GPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVD 230
            GPF+ +FSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE  P+L SC VD
Sbjct: 147  GPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVD 206

Query: 231  VEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDL 290
            + FQYV D+ +G++ I   KP ++I RKAF+NN+SKY++NGKESSYT +T+LL++EGIDL
Sbjct: 207  IFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDL 266

Query: 291  DHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEI 350
            DHKRFLILQGEVE+IAQMKPKAE+E DDGLLEYLEDIIGTA YK  IE    E+  LN+I
Sbjct: 267  DHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDI 326

Query: 351  CIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQK 410
            C EKENRFEIVEREK+SLE  KN ALE+++KE+ LT+ +SKLLQY++ K  +KL ST +K
Sbjct: 327  CEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEK 386

Query: 411  LSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASL 470
            ++  QE+   E  K      E   ++ + + +   +  + E  K  T +KR     + SL
Sbjct: 387  IAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSL 446

Query: 471  EEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXXXXXXXXXXXX 530
            EEK+K+ T+K+ K+S+S+      +   + ++E L  D                      
Sbjct: 447  EEKLKNLTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEKL 506

Query: 531  XXXXXSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQENQSKLKDEI 590
                 SLKDK + IS +I + E+                 + E+ IS+ +E+ +K++ +I
Sbjct: 507  DEIKSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDI 566

Query: 591  EKLKNDLKCQFENKKN-QEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQ 649
              L N    +  NK N Q   +  L+ +   I  +   G+SEC NA  KIK+M+ +L   
Sbjct: 567  -ILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAH 625

Query: 650  RQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASAR 709
            RQ+ +DARS L+T ENK+KVL+AL +LQ+SGRISGF+GRLGDLG ID++YD+AISTA  R
Sbjct: 626  RQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPR 685

Query: 710  LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDK 769
            LDDIVV++VECGQ CIEYLRKNKLGYARFILL+KLRN  L  I+TPENV RL+DLV+P+ 
Sbjct: 686  LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNN 745

Query: 770  DIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGL 829
              F  AFYSVLR+TLVAKDLK+AN+VAYG  R+RVVT+DGKLID+SGT++GGG   A+G+
Sbjct: 746  PKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGM 805

Query: 830  MKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELE 889
            M   K  Q++   ++ +++++I+KEL ERE+NF+ A DT  EME+ALQ+LKDR+PE+EL+
Sbjct: 806  M---KSEQQSNSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELD 862

Query: 890  ISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXXXDST 949
            ISK  +D D  S E+++++ +L+  +    +   + +E+   E              +  
Sbjct: 863  ISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEM 922

Query: 950  KNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRS 1009
            ++  +++  L+++IM++GG  LQMQ+S V+S+ Q I I+ +K K+  + +KK +N+I+R 
Sbjct: 923  QSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQNDIKRY 982

Query: 1010 EKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKI 1069
            +K       + K+CS+E       ++S  + +  + E+  KL++E    E      +E I
Sbjct: 983  QKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESI 1042

Query: 1070 NEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFG--DEG 1127
            +E  +EG  F++ EI    +L+KL  L   + +   E+   L +L++R+ T      DE 
Sbjct: 1043 DEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDES 1102

Query: 1128 -DNNSINGVDRTSHG-----GGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDV----ADE 1177
             +N S N V   + G         L D   V  + N     ++TEA+++  +      +E
Sbjct: 1103 LENESKNEVAAETPGEEDGEHSSSLHDPMDV--DENQGESTSTTEAQLQAGEAERRNTEE 1160

Query: 1178 FSP-GIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDL 1236
              P G+P++ + +L   +V+ +E EI QL++YV     +I++LEEYARRL +Y +RK+DL
Sbjct: 1161 SLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDL 1220

Query: 1237 NQAVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPF 1296
            N AV                  DEFM+GF  I M LKEMYQMITMGGNAELEL+DSLDPF
Sbjct: 1221 NHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPF 1280

Query: 1297 SEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356
            SEGV FSVMPPKKSWRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV
Sbjct: 1281 SEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1340

Query: 1357 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409
            SIVANYIKERTKNAQFIVISLRNNMFELA+QL+G+YK  N TKS A++N D +
Sbjct: 1341 SIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLI 1393

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1207 bits (3124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/1371 (49%), Positives = 906/1371 (66%), Gaps = 34/1371 (2%)

Query: 54   KSHTPRKLILHQSDNRYAFSQPTVSASSLQVPSLQPPETXXXXXRGRRDIKVYXXXX--- 110
            +S TPRKLI+  +D+R+  SQP + ++  Q PSLQ P          R+ K Y       
Sbjct: 67   RSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHPSVSTG-----REHKFYSQSPPRS 121

Query: 111  -XXXXXXXXXXKLELIQLSPVKNNR--IRKLQELYNSQIKKERLFINKLVLNNFKSYAGE 167
                        LELIQLSP+KNNR  ++K+ EL  +Q +  RL I +LVL NFKSYAG 
Sbjct: 122  PHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYAGR 181

Query: 168  QVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSC 227
            QV+GPF+TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +P L SC
Sbjct: 182  QVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELSSC 241

Query: 228  SVDVEFQYVVDKSNGS-SKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEE 286
            SV++ FQYV+D  NG  SKID++K KL++ RKAFKNNSSKY+IN KESS+T+VT LLK E
Sbjct: 242  SVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKNE 301

Query: 287  GIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDT 346
            GIDLDHKRFLILQGEVENIAQMKPK+E+EGDDGLLEYLEDIIGT+ YK  IE N  +V+ 
Sbjct: 302  GIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVEA 361

Query: 347  LNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLAS 406
            LNEICIEKENRF IVE+EK+SL   KN AL+++  E+ L L+KSK  Q+ +  +++KL S
Sbjct: 362  LNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLTS 421

Query: 407  TLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNK 466
            TL K++  QE Y  E  K+    +E   L+D    +NK++   K+  +   S +R+  ++
Sbjct: 422  TLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNSE 481

Query: 467  KASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXXXXXXXX 526
              S +E IK+  +KK+ A K +  ++K +    N++ETLN                    
Sbjct: 482  LISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNEKLKIE 541

Query: 527  XXXXXXXXXSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQENQSKL 586
                     SLK KT   SNEI ++E+                 + +S+ISLL EN+  L
Sbjct: 542  KSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNENKDNL 601

Query: 587  KDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVL 646
             +EI  +K  ++ +  +     EK+   K Q      E + G+ E      KI++M+  L
Sbjct: 602  SNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDKL 661

Query: 647  QTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTA 706
             + RQK  D+R+ L+ V+NK+ VL+AL KLQKSGRISGFYGRLGDLGVID +YD+AISTA
Sbjct: 662  DSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAISTA 721

Query: 707  SARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVK 766
              RL+D+VVDSV+CGQ CI+YLRKN+LGYARFILL+KLR   L RI+TP+N  RLFDL++
Sbjct: 722  CPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDLIQ 781

Query: 767  PDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTA 826
              +D F+PAFYSVLR+TLVA +L  AN+VAYG  RFRVVT+DGKLIDISGT++GGG    
Sbjct: 782  VREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNYVL 841

Query: 827  QGLMKLRKKGQEN-IDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPE 885
            +GLMKL +   EN  +  S ++++K+E+EL   E NFK A ++  EM Q +  +K++ P 
Sbjct: 842  RGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQIPA 901

Query: 886  LELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXX 945
             EL ISK  ++ +    E++    QLK+K   +++ + N DE+   +             
Sbjct: 902  TELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYSL 961

Query: 946  XDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENE 1005
             D TK   ++I+KL+++IM+ GGI+L+MQNSKV S++  + I+ SKQK   S++KK  N 
Sbjct: 962  NDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIKKNNNI 1021

Query: 1006 IRRSEKALSGAE---LDFKT----CSKEMDSFSQEMESVERSLGSIDETFLKLENENSEL 1058
            +++ +  L+  +   L+FKT      K++   S+E+  +E     I++T    +N   E+
Sbjct: 1022 LKKLQNELNTTKDNSLEFKTNLENSKKKVTLLSEELAKLE---SDINDT----QNAKEEI 1074

Query: 1059 EIECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRN 1118
             +     KEK  E E +   FKS+E+++K++L+KL +L  H+++ I + D +L AL +R 
Sbjct: 1075 LLNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALTIRE 1134

Query: 1119 TTTIFGDEGDNNSINGVDRTSHGGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADEF 1178
             +     E  +  +   D + +G     Q  +  +  N++ N    T   M+ID   +E 
Sbjct: 1135 ISQNL--ESFDERLEKYDISKNGATEDTQHTSSAL--NSVSNINTDT---MDIDSTDNEI 1187

Query: 1179 SPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQ 1238
            +PGI R+S+ ++ ++D+++L+AEI  LEE +  +  NI++LEEY RRL++Y  RK DL++
Sbjct: 1188 NPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDE 1247

Query: 1239 AVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSE 1298
            ++                  +EF  GF IIS+TLKEMYQMITMGGNAELEL+DSLDPFSE
Sbjct: 1248 SISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSE 1307

Query: 1299 GVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1358
            GVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI
Sbjct: 1308 GVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1367

Query: 1359 VANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409
            VANYIKERTK+AQ IVISLRNNMFEL++QL+GIYK +N T+SA + N D L
Sbjct: 1368 VANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDML 1418

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1170 bits (3026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/1375 (49%), Positives = 905/1375 (65%), Gaps = 36/1375 (2%)

Query: 45   VSLSPPAISKSHTPRKLILHQSDNRYAFS--QPTVSAS-SLQVPSLQPPETXXXXXRGRR 101
            VS SP     + TPRKL+L   + +YA S  Q T +AS ++  PSLQPP       RGR 
Sbjct: 21   VSQSP-----TRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPP--TAHAVRGRE 73

Query: 102  DIKVYXXXXXXXXXXXXXXKLELIQLSPVKNNRIRKLQELYNSQIK-KERLFINKLVLNN 160
              +                KLELI+LSP K+ R+ +LQ+++ +  +  +RL I+KLVLNN
Sbjct: 74   YSQSPPRSPTRSPTRSPTRKLELIRLSPKKSTRL-ELQKMHEANTQTSQRLCIDKLVLNN 132

Query: 161  FKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSES 220
            FKSYAG Q IGPF+T+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE 
Sbjct: 133  FKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQ 192

Query: 221  FPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVT 280
            FP+L SCSV + F YV D  NG +KI  +   +++ R+AFKNNSSKY++NGKES+YTEVT
Sbjct: 193  FPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVT 252

Query: 281  KLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKN 340
            +LLKEEGIDLDHKRFLILQGEVE+IAQMK KAE++ DDGLLEYLEDIIGTA +K  IEK 
Sbjct: 253  RLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKC 312

Query: 341  TIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKE 400
              E++TLNE+C+EKENRFE+V++EK +LES K  ALEF+ KER+ T+ K++LLQ  I   
Sbjct: 313  LEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDS 372

Query: 401  HEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKK 460
            + KLA++  K+S L  E+Q E +++E+ Q+E   L        K+  +++ + KN  SKK
Sbjct: 373  NRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKK 432

Query: 461  RELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXX 520
            R L+    + +EK+KS  RK + A K+ +QS+   K   NEIE+L  +            
Sbjct: 433  RSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLN 492

Query: 521  XXXXXXXXXXXXXXXSLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQ 580
                            L +KT D+S E+   ER                 ++E++I++L+
Sbjct: 493  HSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLK 552

Query: 581  ENQSKL---KDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKS 637
             + S L   K  IE    DL  Q E  K Q+E    L+ + S +       + EC  A+ 
Sbjct: 553  SSHSNLLKEKATIESKIEDL--QLEELK-QKETETSLRNEKSKVEARISTAQKECEEAQK 609

Query: 638  KIKDMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDN 697
            +  +M+ VL  QRQ V +A++ L   +NK++VL AL KLQ SGRI+GF+GRLGDLG ID+
Sbjct: 610  QTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDD 669

Query: 698  EYDIAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPEN 757
            +YDIAISTA  RLDDIVV++VECGQ CI++LRKNKLGY RFILL+KLR   L RI TPEN
Sbjct: 670  QYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPEN 729

Query: 758  VKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGT 817
            V RLFDL+ P +D+F PAFYSVLR+TLVA+DL+QANRVAYG  RFRVVT+DGKLIDISGT
Sbjct: 730  VPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGT 789

Query: 818  ITGGGKQTAQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQ 877
            ++GGG     GLM+ +         YS D++EK+E +L  +E N++ A     EME ALQ
Sbjct: 790  MSGGGSSPQSGLMRSKATTASQ---YSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQ 846

Query: 878  RLKDRKPELELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXX 937
            +L DR PE++++ISK  ++      E+ES   +L Q       + +N+  +++ E     
Sbjct: 847  KLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDI 906

Query: 938  XXXXXXXXXDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGIS 997
                     D++K   +KID LK RIM+ GGI+L+MQ +KV S+ Q+I+I+  KQK+  +
Sbjct: 907  LRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEKQKKEKT 966

Query: 998  SMKKIENEIRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSE 1057
              KK++ ++ R+ +  +    +   C+K++   S+++ES+      I+E  ++     +E
Sbjct: 967  RSKKLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAE 1026

Query: 1058 LEIECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELR 1117
            L      LK+++   E +  +FK+ E++  DRLEKL+ L +++K+ ++ Y+  L++L++R
Sbjct: 1027 LNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIR 1086

Query: 1118 NTTTIFGDEGDNNSINGVDRTS---HGGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDV 1174
            + + +     D    +  D T+   +G  V  Q    V   + M   ++S EA       
Sbjct: 1087 DVSKLLSQLNDGIIESCTDVTAKVMNGDIVQTQSITDVGNNDAM---EDSGEAATH---- 1139

Query: 1175 ADEFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKL 1234
                  G+P +++ +L  +D++ LE E+ QL++Y+   N +I+VLEEYARRLA+Y  RKL
Sbjct: 1140 -----SGLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKL 1194

Query: 1235 DLNQAVXXXXXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLD 1294
            DLNQAV                  ++FM+GFGIISMTLKEMYQMITMGGNAELEL+DSLD
Sbjct: 1195 DLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLD 1254

Query: 1295 PFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1354
            PFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR
Sbjct: 1255 PFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1314

Query: 1355 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409
            NVSIVANYIKERTKNAQFIVISLRNNMFELAQ L+GIYK +N TKS  ++N D L
Sbjct: 1315 NVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDIL 1369

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1151 bits (2978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 676/1412 (47%), Positives = 914/1412 (64%), Gaps = 75/1412 (5%)

Query: 40   HQQSAVSL--SPPAISKSHTPRKLILHQSDNRYAFSQPTVSASSLQVPSLQPPETXXXXX 97
            H   AV+   SP AI    TPR L+   S+NR     PT  + +LQ+PSL PPE+     
Sbjct: 23   HTPKAVTFEQSPRAI----TPRNLL--GSENRNVL--PTGGSQNLQIPSLLPPESLGSA- 73

Query: 98   RGRRDIKVYXXXXXXXXXXXXXXKLELIQLSPVKNNRIRKLQELYNSQ---IKKERLFIN 154
            RGR D K Y              +L+LI+LSP+KN+R  +LQ+LY S+   +KKERLFI+
Sbjct: 74   RGR-DFKSYSQSPPRSPGRSPTRRLKLIELSPIKNSRA-ELQKLYESKKLDVKKERLFIH 131

Query: 155  KLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDL 214
            +LVLN+FKSYAG QVIGPF+T+FSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDL
Sbjct: 132  QLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDL 191

Query: 215  IHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKES 274
            IHKSE+FP+L SCSV+V F+YV+DK +GS+ ID+ K  L++TRKAFKNN+SKYF+NGKES
Sbjct: 192  IHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKES 251

Query: 275  SYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYK 334
            +YTEVT LLK+EGIDLDHKRFLILQGEVENIAQMK KAE+E DDGLLEYLEDIIGT+ YK
Sbjct: 252  NYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYK 311

Query: 335  SSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQ 394
             SIEK ++E+++LNEIC+EKENRF IVEREKNSLES K  AL+F+ KE+ L L KSKL Q
Sbjct: 312  ESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQ 371

Query: 395  YNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSI----- 449
            YN++++++KL   L K +              N Q+E  K ED F++ N  I  I     
Sbjct: 372  YNLMQDNKKLDDVLNKKT--------------NVQQEQTKQEDEFRKANSHISDITASLN 417

Query: 450  --KEDMK-------NNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRN 500
              K D++       N +  KR L+NKK   E+ + +   K+    K   +  K+L++  N
Sbjct: 418  VLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKR----KEFEEQSKILQDKIN 473

Query: 501  ----EIETLNVDXXXXXXXXXXXXXXXXXXXXXXXXXXXSLKDKTTDISNEIAQHERXXX 556
                EI+T+  +                            L++KT  ++ +IA++E+   
Sbjct: 474  STDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLREKTEHLTIQIAEYEKELS 533

Query: 557  XXXXXXXXXXXXXXVAESQISLLQENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKV 616
                          + ES++S+++EN+  L+++I  L+N +  Q  + + QE+++  L  
Sbjct: 534  PWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLE 593

Query: 617  QFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKL 676
            Q + +  E + GE EC NA++ + +++  ++  RQK ++ RS  +  EN +KVLSAL +L
Sbjct: 594  QKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRL 653

Query: 677  QKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYA 736
            QKSGR++GF+GRLGDL VID +YD+AISTA  RL+D+VVD+VE GQ CIEYLRKNKLGYA
Sbjct: 654  QKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYA 713

Query: 737  RFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVA 796
            RFILL+KL      RI TP+  +RLFDL+   +  F  AFYSVLR+TLV ++++QANRVA
Sbjct: 714  RFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVA 773

Query: 797  YGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQENIDIYSNDDIEKIEKELV 856
            YG  R+RVVT+DG LID+SGT+TGGG+  ++GLMKL K   +    +S ++++ IE EL 
Sbjct: 774  YGKKRYRVVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKSSSKGSAFFSPEEVQAIENELN 833

Query: 857  ERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDISSKELESTQDQLKQKIT 916
            ++EN +K A D Y EME+ L+RL+DR PE++  +SK  MD + +  ++ S  + L++K  
Sbjct: 834  QKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRK 893

Query: 917  FYERHTQNKDEVVEIEHXXXXXXXXXXXXXDSTKNISEKIDKLKKRIMEIGGIDLQMQNS 976
              E      D  + +                 TK+  +KI  +K +I+E+GG +L+ Q+ 
Sbjct: 894  KLESMKNQNDPSITLLAKLKELKSKLDDIDVQTKSTKDKIKTIKDKIIELGGDELKNQSL 953

Query: 977  KVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAELDFKTCSKEMDSFSQEMES 1036
             V  I   I     + K+  S+  K E+ +++  K L+ A  +    SK  ++   E + 
Sbjct: 954  LVTDITNKISENSRRLKKIKSNKLKKESLLKKFNKELTEANEELTNFSKNAENADIESKE 1013

Query: 1037 VERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEG---TKFKSYEIDVKDRLEKL 1093
            +E  L  I E+   L+    +LE E   ++ K NE E      + +KS  ++  ++LEKL
Sbjct: 1014 IESKLLDIKESIENLKENEVKLEHE---IEMKHNELESHQKVVSDYKSISLEYNNKLEKL 1070

Query: 1094 NNLLKHIKRVIKEYDEQLRALELRNTT----TIFGDEGDNNSINGVDR---------TSH 1140
                  +K+ IK Y++ L  L +R+ T    TI  +E  N S++  D           + 
Sbjct: 1071 EASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEE--NASVDKSDPKLENTSAVINAD 1128

Query: 1141 GGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADEFSPGIPRISKAKLLQIDVQALEA 1200
              G+    +N+    N+  ++ +S   +MEID      +PGIP +S ++L ++D Q +E 
Sbjct: 1129 DDGISAVSENQSFNHNDENDDIDSN--KMEIDSQGGFINPGIPVLSASELAKVDPQEVEL 1186

Query: 1201 EIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVXXXXXXXXXXXXXXXXXYDE 1260
             I  L++++  +  N+DVLEEYA R  ++N RK DLN AV                 YDE
Sbjct: 1187 LITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDE 1246

Query: 1261 FMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANLSGG 1320
            FM+GF IISMTLKEMYQMIT+GGNAELEL+DSLDPFSEGVTFSVMPPKKSWRNI+NLSGG
Sbjct: 1247 FMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGG 1306

Query: 1321 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN 1380
            EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN
Sbjct: 1307 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN 1366

Query: 1381 MFELAQQLIGIYKRDNKTKSAAIRNKDFLKEA 1412
            MFEL +QL+GIYK +N TKSAA+ N+D +  A
Sbjct: 1367 MFELTKQLVGIYKHENMTKSAALVNEDLVGRA 1398

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1145 bits (2963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/1426 (46%), Positives = 928/1426 (65%), Gaps = 62/1426 (4%)

Query: 7    IPSPKRQKV--LESHTPXXXX--XXXXXXXXSPLRFEHQQSAVSLSPPAISKSHTPRKLI 62
            +P  K+QKV  +ES++P              SPL+       V+  P    KS+TP K+I
Sbjct: 4    LPDAKKQKVKDIESNSPLNNDIPKIAQSRNDSPLQ-------VANDP---LKSYTPMKVI 53

Query: 63   LHQSDNRYAFSQPT-VSASSLQVPSLQPPETXXXXXRGRRDIKVYXXXX----XXXXXXX 117
            +  + +      P+ + +SS Q PSLQ P +     RGR  +K Y               
Sbjct: 54   ISNNHSNSISPLPSQLMSSSTQPPSLQHPSSSS---RGRA-VKAYSQSPPRSPDRSPVRS 109

Query: 118  XXXKLELIQLSPVKNNRIRKLQELYNS--QIKKERLFINKLVLNNFKSYAGEQVIGPFNT 175
               KLELIQLSP+KN+R  +LQ++Y+S  + K ER+ +NKLVL+NFKSYAG Q IGPF++
Sbjct: 110  PTRKLELIQLSPIKNSR-SELQKIYSSKQEEKIERICLNKLVLHNFKSYAGTQTIGPFHS 168

Query: 176  NFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQY 235
            +FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSE +P+L SC+VDV F+Y
Sbjct: 169  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEY 228

Query: 236  VVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRF 295
            ++D  + ++KI+ +K  LIITR+AFKN++SKY++NGKES+Y  +T LLKEEGIDLDH RF
Sbjct: 229  LIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRF 288

Query: 296  LILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKE 355
            LILQGEVENIAQMKPKAE+EGDDGLLEYLEDIIGT  YK  I+K  IE++ LN+ICIE+E
Sbjct: 289  LILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERE 348

Query: 356  NRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQ 415
            NRF+I++REK SLES K +ALE++ KE+   + KSKL+QY I + + KL++TL+K++ L+
Sbjct: 349  NRFDIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITKLE 408

Query: 416  EEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIK 475
            +EY  E  K    + + ++L   + +   ++ ++ +D K   + KR L +   S  E++K
Sbjct: 409  DEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLK 468

Query: 476  SYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDXXXXXXXXXXXXXXXXXXXXXXXXXXX 535
            +  +K +K +K I +  K + +    ++  + +                           
Sbjct: 469  NIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKL 528

Query: 536  SLKDKTTDISNEIAQHERXXXXXXXXXXXXXXXXXVAESQISLLQENQSKLKDEIEKLKN 595
             LKDKT  +S EI + E+                 + ES+ +L +E+++KLK  IE L+ 
Sbjct: 529  DLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEK 588

Query: 596  DLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMD 655
            D+  + +  +++ +++ +L  +   +S E   G +E   A  K+ +MQ +L   RQK  D
Sbjct: 589  DVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKAND 648

Query: 656  ARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVV 715
            AR+ L+ VEN+SKVL AL KLQKSGRI+GF+GRLG+LGVID +YD+AISTA  RL+DIVV
Sbjct: 649  ARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVV 708

Query: 716  DSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPA 775
            DSVECGQ CIEYLRKN LG+ARFILL+KL    +++I TP NV RLFDL+K + + F+PA
Sbjct: 709  DSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPA 768

Query: 776  FYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKK 835
            FYSVLRNTLVA DLK+AN VAYG TR+RVVT+ G LIDISGT++GGG Q ++G M+L   
Sbjct: 769  FYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLSNS 828

Query: 836  GQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLM 895
              +    YS++++ +IEKEL  RE N++ A +T  EME  L+ LK+ +P++ELEISK   
Sbjct: 829  TSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNF 888

Query: 896  DTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXXXDSTKNISEK 955
            + D    E    + QL +    +        ++ E+++                K+  ++
Sbjct: 889  EIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDR 948

Query: 956  IDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSG 1015
            I +L+ +IM+IGGI LQMQNSKV+S+ +   I+  KQK   + + KIE+++R+  K L  
Sbjct: 949  IKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESDVRKLSKKLKE 1008

Query: 1016 AELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECC-----NLKEK-- 1068
            +E D    +++  +   E++++E  L          +NEN+   + C       L+EK  
Sbjct: 1009 SESDNTKLNEKKIALENELKNIEELLA---------QNENN---MNCIQDKKFTLREKSE 1056

Query: 1069 --INE-AEIEG--TKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIF 1123
              +NE  E+EG  ++FK+ E++ K + EKL +LL  IK+++K  +E   +L +R      
Sbjct: 1057 ITMNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAY-- 1114

Query: 1124 GDEGDNNSINGVDRTSHGGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADEFSPGIP 1183
                D + +N  ++ +      L    +  + N++ N+      EM I+D  +E + GIP
Sbjct: 1115 ----DLDLLNIKEQEAQKIKTELYADFEQNQSNDVIND------EMIIEDNNNEIAKGIP 1164

Query: 1184 RISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVXXX 1243
               ++   Q D+ +LEAE+ QL++Y  I  V++D+LEEY RR+ +Y  RK DLNQ+V   
Sbjct: 1165 SYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQR 1224

Query: 1244 XXXXXXXXXXXXXXYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFS 1303
                          ++EFM+ F IISMTLKEMYQ+ITMGGNAELEL+DSLDPFSEGVTFS
Sbjct: 1225 DKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFS 1284

Query: 1304 VMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1363
            VMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI
Sbjct: 1285 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344

Query: 1364 KERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409
            KERTKNAQFIVISLRNNMFELA+QL+GIYK  N+TKSA ++N D L
Sbjct: 1345 KERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDIL 1390

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  169 bits (428), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 192/751 (25%), Positives = 333/751 (44%), Gaps = 93/751 (12%)

Query: 684  GFYGRLGDLGVIDNE-YDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILL 741
            G  G + DL     E Y +A+ST   +  D ++V+++   Q CI +L+K + G A FI L
Sbjct: 528  GVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPL 587

Query: 742  EKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFY---------SVLRNTL-VAKDLKQ 791
            + +    L  +  P++   +  +   D   + P +          S++ NTL +AKDLK 
Sbjct: 588  DTIETE-LPTLSLPDSQDYILSINAID---YEPEYEKAMQYVCGDSIICNTLNIAKDLKW 643

Query: 792  ANRVAYGATRFRVVTMDGKLIDISGTITGG---------GKQTAQGLMKLRKKGQENIDI 842
               +     R ++VT++G LI  +G +TGG          K+  Q LM L+ K    ID 
Sbjct: 644  KKGI-----RGKLVTIEGALIHKAGLMTGGISGDANNRWDKEEYQSLMSLKDKLLIQIDE 698

Query: 843  YSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDISSK 902
             SN       +   E EN+    N     +   + + K    E  LEI       D+  K
Sbjct: 699  LSNGQRSNSIRAR-EVENSVSLLNSDIANLRTQVTQQKRSLDENRLEIK---YHNDLIEK 754

Query: 903  ELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXXXDSTKNISEKIDKLKKR 962
            E++    +LK+K+   E     KD +V+                +  K  + KI    K 
Sbjct: 755  EIQPKITELKKKLDDLE---NTKDNLVK---------EKEALQNNIFKEFTSKIGFTIKE 802

Query: 963  IMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAELDFKT 1022
                 G  ++ Q+ ++  + + I  +++K +     +   +   RR EKA    + D + 
Sbjct: 803  YENHSGELMRQQSKELQQLQKQILTVENKLQFETDRLSTTQ---RRYEKA----QKDLEN 855

Query: 1023 CSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEGTKFKSY 1082
               EM S  ++  ++E  +GSI+    + +N   EL+ +    + ++N +E         
Sbjct: 856  AQVEMKSLEEQEYAIEMKIGSIESKLEEHKNHLDELQKKFVTKQSELNSSE--------- 906

Query: 1083 EIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNNSINGVDRTSHGG 1142
                 D LE +N+ L+ +KR      E +   +L   T +      N  I+ ++      
Sbjct: 907  -----DILEDMNSNLQVLKRERDGIKEDIEKFDLERVTAL-----KNCKISNIN------ 950

Query: 1143 GVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADEFSPGIPRISKAKLLQIDVQALEAEI 1202
             +P+  +  +   +++       EA + I +  D    G+P+  K        + LE +I
Sbjct: 951  -IPISSETTI---DDLPISSTDNEA-ITISNSIDINYKGLPKKYKENNTDSARKELEQKI 1005

Query: 1203 GQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVXXXXXXXXXXXXXXXXXYDEFM 1262
             ++EE +     N   LE Y      +     +  Q                    + F 
Sbjct: 1006 HEVEEILNELQPNARALERYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFE 1065

Query: 1263 QGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSWRN 1313
            + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ +   PP K +++
Sbjct: 1066 KTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKD 1125

Query: 1314 IANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQF 1372
            +  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + QF
Sbjct: 1126 MEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQF 1185

Query: 1373 IVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            IVISL+N MFE +  L+G+Y++  +  S  I
Sbjct: 1186 IVISLKNTMFEKSDALVGVYRQQQENSSKII 1216

 Score =  102 bits (255), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 92/162 (56%), Gaps = 13/162 (8%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L+NFKSY G   +G   +NF++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 216 HK-------SESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYF 268
           ++       S+ + N  + S + +  YV       +K+ +      + R   +N  + Y 
Sbjct: 67  YRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKLVE------LMRIISRNGDTSYK 120

Query: 269 INGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP 310
           I+GK  SY + +  L+ E I +  K FL+ QG+VE IA   P
Sbjct: 121 IDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSP 162

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  138 bits (348), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 64/157 (40%), Positives = 103/157 (65%), Gaps = 12/157 (7%)

Query: 1259 DEFMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKK 1309
            D F   F  +S  + ++Y+ +T          GGNA L L D  +P+  G+ +   PP K
Sbjct: 1065 DAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPYLAGIRYHATPPTK 1124

Query: 1310 SWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-K 1368
             ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  +A YI++R   
Sbjct: 1125 RFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNVERIATYIRQRALS 1184

Query: 1369 NAQFIVISLRNNMFELAQQLIGIYK--RDNKTKSAAI 1403
            N QFIVISL+N MFE +Q L+G+++  RDN +++  +
Sbjct: 1185 NLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALTL 1221

 Score = 95.1 bits (235), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 94/188 (50%), Gaps = 24/188 (12%)

Query: 158 LNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHK 217
           L NFKSY G+  IG   +NF++V+GPNGSGKSN++D++ FV G ++  +R   L+DLI++
Sbjct: 9   LYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLIYR 68

Query: 218 SESFPNLPSCSVDVEFQYVVDKSNGSSKI-----------DDNKPKLIITRKAFKNNSSK 266
                 L     D  +    D  N  S             +++  +L  TR    +  S 
Sbjct: 69  G----TLQDGDADSGYSETHDNENNPSSAYVKAFYSPSGQENDVAEL--TRTITLSQEST 122

Query: 267 YFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLED 326
           Y +NG+  S+ +    L+ E I +  + FL+ QG+VE +A  KP+        L    E 
Sbjct: 123 YKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE-------LTTLFEQ 175

Query: 327 IIGTADYK 334
           + G+  YK
Sbjct: 176 VSGSIQYK 183

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  135 bits (341), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 101/153 (66%), Gaps = 10/153 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F + F  +S ++ E+Y+ +T          GGNA L L D  +P+  G+ +   PP K +
Sbjct: 1064 FEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDEDEPYLAGIRYHATPPAKRF 1123

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KNA 1370
            +++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  VA+YI+ +   + 
Sbjct: 1124 KDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISNVERVASYIRRKAGADL 1183

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            QFIVISL+N MFE +Q L+G++++     S A+
Sbjct: 1184 QFIVISLKNTMFEKSQALVGVFRQQQNNTSKAL 1216

 Score =  105 bits (263), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 104/185 (56%), Gaps = 17/185 (9%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L LNNFKSY G+  IG  ++NF++++GPNGSGKSN++D++ FV G ++  +R   L+DLI
Sbjct: 7   LELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLI 66

Query: 216 HKSESFPNLPSCSVDVEFQ------YVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFI 269
           ++  +     + S D E +      YV    + S+  DD    + ++R   ++  S Y I
Sbjct: 67  YRG-TLSEEEASSADFESENHPNSAYVKAFYSPSNNEDD---VVELSRTVTRSQESTYRI 122

Query: 270 NGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIG 329
           +GK   Y + ++ L+ E I +  + FL+ QG+VE +A  KP+        L +  E + G
Sbjct: 123 DGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQE-------LTDLFEQVSG 175

Query: 330 TADYK 334
           +  YK
Sbjct: 176 SLQYK 180

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  133 bits (335), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 98/153 (64%), Gaps = 10/153 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ +   PP K +
Sbjct: 1069 FEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRF 1128

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNA 1370
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + 
Sbjct: 1129 KDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDL 1188

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            QFIVISL+N MFE +  L+G+Y++  +  S  I
Sbjct: 1189 QFIVISLKNTMFEKSDALVGVYRQQQENSSKTI 1221

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 102/369 (27%), Positives = 159/369 (43%), Gaps = 82/369 (22%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L+NFKSY G   +G   +NF++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 216 HKS-------------------ESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLI-I 255
           ++                     +  N  S  V   +Q    K N          KL+ +
Sbjct: 67  YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQ----KGN----------KLVEL 112

Query: 256 TRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAERE 315
            R   +N  + Y I+GK  SY + +  L+ E I +  K FL+ QG+VE IA   P     
Sbjct: 113 MRIISRNGDTSYKIDGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSPIE--- 169

Query: 316 GDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAA 375
               L +  E++ G+  YK        E D L E                  +E    +A
Sbjct: 170 ----LSKMFEEVSGSIQYKK-------EYDELKE-----------------KIEKLGKSA 201

Query: 376 LEFVKKERRLTLSKSKLLQYNILKEHEKLAST-----LQKLSVLQEEYQNESTKFENTQR 430
            E +K  RR+   + K  +  I K  E +        LQ+   L + Y  E  K E    
Sbjct: 202 TESIKNRRRIH-GELKTYKEGINKNEEYIKQVDKKNELQRFQALWQLYHLEQQKEE---- 256

Query: 431 ETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQ 490
               L D     N ++ S+KE + N     + LQ  K+S  ++    +++K K    +  
Sbjct: 257 ----LMDKLSASNSEVSSLKEKINNEM---KSLQRSKSSFVKEGTIISKQKSKLEYIVKD 309

Query: 491 SKKLLKNYR 499
            +KL+ + R
Sbjct: 310 KEKLVSDLR 318

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  133 bits (334), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 96/153 (62%), Gaps = 10/153 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F   F  +S  L  +Y+ +T          GGNA L L D  +PF+ GV +   PP K +
Sbjct: 1070 FENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRYHATPPLKRF 1129

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1370
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+     N 
Sbjct: 1130 KDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPNL 1189

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            QFIVISL+N MFE +  L+G++++  +  S  +
Sbjct: 1190 QFIVISLKNTMFEKSDALVGVFRQQQENSSKIV 1222

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 111/209 (53%), Gaps = 16/209 (7%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 212
           ++ L LNNFKSY G   +G  ++NF++++GPNGSGKSN++D++ FV G R++ +R + + 
Sbjct: 4   LSGLELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVK 63

Query: 213 DLIHK--------SESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNS 264
           DLI++        +     + S  V   ++        +   DD +P + + R    N  
Sbjct: 64  DLIYRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDERP-VELMRAISTNGD 122

Query: 265 SKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYL 324
           + Y INGK  +Y E ++ L+ E I +  K FL+ QG+VE IA   P         L +  
Sbjct: 123 TTYKINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSPM-------DLSKLF 175

Query: 325 EDIIGTADYKSSIEKNTIEVDTLNEICIE 353
           E++ G+  YK   ++   +++ LN+   E
Sbjct: 176 EEVSGSIQYKKEYDELKEQIEKLNQSAAE 204

 Score = 55.8 bits (133), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 76/164 (46%), Gaps = 39/164 (23%)

Query: 697 NEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRN--------- 746
           ++Y +A+ST   +  D I+VD++   Q CI + +K + G A FI L+ + +         
Sbjct: 548 DKYGLAVSTILGKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPLDTISSEQPTLNLPS 607

Query: 747 -----LILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTL-VAKDLKQANRVAYGAT 800
                L +  I+     +R    V  D         S++ N+L +A+DLK    V     
Sbjct: 608 SQDYILTINAIEYDPEYERAMQYVCSD---------SIICNSLDIARDLKWNKGV----- 653

Query: 801 RFRVVTMDGKLIDISGTITGG---------GKQTAQGLMKLRKK 835
           R ++VT++G LI  +G +TGG          K+  Q LM L+ K
Sbjct: 654 RSKLVTIEGALIHKAGLMTGGISKDSNNRWDKEEYQSLMTLKDK 697

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  133 bits (334), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 98/153 (64%), Gaps = 10/153 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ +   PP K +
Sbjct: 1067 FEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRF 1126

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNA 1370
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + 
Sbjct: 1127 KDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDL 1186

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            QFIVISL+N MFE +  L+G+Y++  +  S  I
Sbjct: 1187 QFIVISLKNTMFEKSDALVGVYRQQQENSSKII 1219

 Score = 95.9 bits (237), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 100/353 (28%), Positives = 158/353 (44%), Gaps = 52/353 (14%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L+NFKSY G   +G   +NF++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 216 HKSESFPNLPSCSVDVEFQYVVDKSNGSSKID---DNKPKLI-ITRKAFKNNSSKYFING 271
           ++     +      D     V   +  S+ +        K++ + R   +N  + Y I+ 
Sbjct: 67  YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMRIISRNGDTSYKIDE 126

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
           K  SY + +  L+ E I +  K FL+ QG+VE IA   P         L    E++ G+ 
Sbjct: 127 KTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSRMFEEVSGSI 179

Query: 332 DYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSK 391
            YK        E D L E                  +E    +A E +K  RR+   + K
Sbjct: 180 QYKK-------EYDELKE-----------------KIEKLSKSATESIKNRRRIH-GELK 214

Query: 392 LLQYNILKEHE-----KLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKI 446
             +  I K  E     +  S LQK   L + Y  E  K E        L D     N +I
Sbjct: 215 TYKEGINKNEEYRKQVEKKSELQKFQALWQLYHLEQQKEE--------LTDKLSASNSEI 266

Query: 447 VSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYR 499
            S+KE + +     + LQ  K+S  ++    +++K K +  I   +KL+ + R
Sbjct: 267 SSLKEKINHEM---KSLQRSKSSFVKESAVISKQKSKLNYIIKDKEKLVSDLR 316

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  133 bits (334), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 98/153 (64%), Gaps = 10/153 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ +   PP K +
Sbjct: 1103 FEKTFDYVSDHLDAIYRELTKNPNSTVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRF 1162

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNA 1370
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + 
Sbjct: 1163 KDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDL 1222

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            QFIVISL+N MFE +  L+G+Y++  +  S  +
Sbjct: 1223 QFIVISLKNTMFEKSDALVGVYRQQQENSSKTV 1255

 Score =  105 bits (261), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 106/374 (28%), Positives = 166/374 (44%), Gaps = 94/374 (25%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L+NFKSY G   +G   +NF++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 43  LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 102

Query: 216 HKSESFPNLPSCSVDVEFQYVVDKSNG---SSKIDDNK----P-------------KLI- 254
           ++                  V+D  N     S  DDN     P             KL+ 
Sbjct: 103 YRG-----------------VLDDGNDENIDSGADDNAITSNPNSAYVKAFYQKGNKLVE 145

Query: 255 ITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAER 314
           +TR   +N  + Y I+GK  +Y + +  L+ E I +  K FL+ QG+VE IA   P    
Sbjct: 146 LTRLISRNGDTTYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPT--- 202

Query: 315 EGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNA 374
                L    E++ G+  YK        E D L E                  +E    +
Sbjct: 203 ----DLSRMFEEVSGSIQYKK-------EYDELKE-----------------KIEKLSKS 234

Query: 375 ALEFVKKERRL---------TLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKF 425
           A E +K  RR+          ++K++  +  + K++E     LQK   L + Y  E  K 
Sbjct: 235 ATESIKNRRRIHGELKTYKEGINKNEEYRKQVDKKNE-----LQKFQALWKLYHLEQKKE 289

Query: 426 ENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRKKEKAS 485
           E        L D     N +I+S+KE + N T   + LQ  K+S  ++    +++K K  
Sbjct: 290 E--------LTDKLSASNSEIMSLKERINNET---KSLQRSKSSFVKESTVISKQKSKLD 338

Query: 486 KSIAQSKKLLKNYR 499
             +   +KL+ + R
Sbjct: 339 YIVKDKEKLMSDLR 352

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  132 bits (333), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 101/153 (66%), Gaps = 10/153 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F + F  +S  ++ +Y+ +T          GGNA L L D  +PF  G+ +   PP K +
Sbjct: 1058 FEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAGIKYHATPPLKRF 1117

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KNA 1370
            +++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +ANYI++ +  + 
Sbjct: 1118 KDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERIANYIRKHSNSDI 1177

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            QFIVISL+N+MFE +  L+GI+++  +  S  +
Sbjct: 1178 QFIVISLKNSMFEKSDALVGIHRQQQENSSRVV 1210

 Score = 89.4 bits (220), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 83/156 (53%), Gaps = 5/156 (3%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L NFKSY G   +G   +NF++++GPNGSGKSN++D++ FV GF+++ +R   L DL+
Sbjct: 7   LELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSSTLKDLV 66

Query: 216 HKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESS 275
           ++  +  +      D E    V      +  + +   + + R       S Y I+ K ++
Sbjct: 67  YRDIASADENEFGEDGERSAYV-----KAFYEKDGTVVELMRAITAGRDSVYKIDNKTTT 121

Query: 276 YTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPK 311
           Y   +  L  E I +  + FL+ QG+VE IA   P+
Sbjct: 122 YKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPR 157

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  132 bits (332), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 103/163 (63%), Gaps = 11/163 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F + F  +S  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K +
Sbjct: 1065 FDRAFDYVSTHIDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKYHATPPLKRF 1124

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNA 1370
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A YI K    + 
Sbjct: 1125 KDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAYIRKHGNPSL 1184

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFLKEAD 1413
            QFIVISL+N+MFE +  L+G+Y+R  +  S  +   D  K AD
Sbjct: 1185 QFIVISLKNSMFEKSDALVGVYRRQQENSSRLV-TLDLGKYAD 1226

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 96/186 (51%), Gaps = 21/186 (11%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L NFKSY G   +G   +NF++++GPNGSGKSN++D++ FV G R++ +R   ++DLI
Sbjct: 7   LELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRSSAVADLI 66

Query: 216 HKS----ESFPNLPSCSVDVEFQYV---VDKSNGSSKIDDNKPKLIITRKAFKNNSSKYF 268
           ++     E          D    YV     K    S ++       + R   KN  S Y 
Sbjct: 67  YRGVVPEEEDDGEGEGDGDAHRAYVSAFYSKGPQESTVE-------LKRTISKNGDSTYQ 119

Query: 269 INGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDII 328
           I+ ++ +Y + ++ L+ + I +  K FL+ QG+VE +A   P         L +  E++ 
Sbjct: 120 IDRRQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSPLQ-------LTKLFEEVS 172

Query: 329 GTADYK 334
           G+A YK
Sbjct: 173 GSAQYK 178

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 72/153 (47%), Gaps = 17/153 (11%)

Query: 697 NEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTP 755
           ++Y ++++T   +  D ++VDS+   Q CI YL+K + G   FI L+ + + +      P
Sbjct: 542 DKYSVSVATVLGKNFDSVIVDSLSVAQECIAYLKKQRAGVISFIPLDTVDSAV---ATLP 598

Query: 756 ENVKRLFDLVKPDKDI---FIPAFYSVLRNTLVAKDLKQANRVAYG-ATRFRVVTMDGKL 811
               + + L K   +    +  A   V  + ++   L  A ++ +    + +++ +DG L
Sbjct: 599 SVNIQGYLLAKNAMEYESQYERAINYVCGDAIICDTLDLAKKLKWDHGFKNKLIALDGSL 658

Query: 812 IDISGTITGG---------GKQTAQGLMKLRKK 835
           I  +G +TGG          K+  Q LM L+ K
Sbjct: 659 IHRAGLMTGGISKDGNNRWDKEEYQSLMTLKDK 691

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  132 bits (332), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 97/153 (63%), Gaps = 10/153 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMITM---------GGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F   F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ +  MPP K +
Sbjct: 1062 FENAFDFVNEHLDPIYRELTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYHAMPPLKRF 1121

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1370
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+     + 
Sbjct: 1122 KDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPDL 1181

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            QFIVISL+N MFE +  L+G+Y++  +  S  +
Sbjct: 1182 QFIVISLKNTMFEKSDALVGVYRQQQENSSKIV 1214

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/185 (34%), Positives = 96/185 (51%), Gaps = 20/185 (10%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L+NFKSY G   IG  ++NF++++GPNGSGKSN++D++ FV G R++ +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 216 HK------SESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFI 269
           ++      SE  P       D E Q+       +    D K  + + R    N  + Y I
Sbjct: 67  YRGVIRDFSEEDPE------DGEEQHPTSAYVKAFYEMDGKV-VELMRTININGDTTYKI 119

Query: 270 NGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIG 329
           + K  SY +    L++E I +  K FL+ QG+VE IA             L +  E+I G
Sbjct: 120 DNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSAL-------DLSKLFEEISG 172

Query: 330 TADYK 334
           +  YK
Sbjct: 173 SIQYK 177

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  132 bits (331), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 98/153 (64%), Gaps = 10/153 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMITM---------GGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F + F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ +   PP K +
Sbjct: 1062 FEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYHATPPLKRF 1121

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1370
            +++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI+     N 
Sbjct: 1122 KDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYIRRHGNPNL 1181

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            QFIVISL+N MFE +  L+G+Y++  +  S  +
Sbjct: 1182 QFIVISLKNTMFEKSDALVGVYRQQQENSSKIV 1214

 Score = 99.8 bits (247), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 104/355 (29%), Positives = 164/355 (46%), Gaps = 71/355 (20%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L NFKSY G   +G   +NF++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 216 HK-------SES----FPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNS 264
           ++       SES      N PS +    F    +K N +         + + R   +N  
Sbjct: 67  YRGVITGEDSESDEDGSVNNPSTAYVKAF---YEKENKT---------IELMRTISRNGD 114

Query: 265 SKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYL 324
           + Y I GK  SY + +  L+ E I +  K FL+ QG+VE IA   P         L    
Sbjct: 115 TNYKIGGKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIASQSPM-------DLSRLF 167

Query: 325 EDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERR 384
           E++ G+  YK        E D L E                  +E    AA E +K  RR
Sbjct: 168 EEVSGSIQYKK-------EYDQLKE-----------------KMEQLSKAATESIKNRRR 203

Query: 385 LTLSKSKLLQYNILKEHE---KLAST--LQKLSVLQEEYQNESTKFENTQRETNKLEDNF 439
           +   + K  +  I K+ E   K+A    LQ + VL + Y  E       Q++ N ++ N 
Sbjct: 204 IH-GELKTYKEGINKDEEYKSKVAKKKELQTILVLWQLYHLE-------QKKINIMK-NM 254

Query: 440 KQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKL 494
                K+  +K+ + N   ++R LQ  K S+ +++   T+KK+K    + + +K+
Sbjct: 255 ADTKSKMSVLKDKIHN---EERNLQRAKTSIAKEMSIITKKKDKIDYKLKEKEKI 306

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 74/151 (49%), Gaps = 13/151 (8%)

Query: 697 NEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILK-RIQT 754
           ++Y +A+ST   R  D ++VD+    Q CI YL+K + G A FI LE + + I    +  
Sbjct: 540 DKYSLAVSTCLGRNFDSVIVDNASVAQECIAYLKKQRAGSASFIPLETIDSEIPTLSVSN 599

Query: 755 PENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAY-GATRFRVVTMDGKLID 813
            +      + ++ D   +  A   V  +T++   L  A R+ +    + ++VT++G LI 
Sbjct: 600 SQGCILAINAIEYDPR-YERAMQYVCSDTIICDTLVIAKRLKWVEGVKAKLVTLEGALIH 658

Query: 814 ISGTITGG---------GKQTAQGLMKLRKK 835
            +G +TGG          K+  Q LM L+ K
Sbjct: 659 KAGLMTGGVSKDSNNRWDKEEYQSLMNLKDK 689

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  131 bits (329), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 101/153 (66%), Gaps = 10/153 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F + +  +S  + ++Y+ +T          GG+A L L D  +P+  G+ +   PP K +
Sbjct: 1067 FEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLEDEDEPYLAGIKYHATPPMKRF 1126

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1370
            +++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YIK   + N 
Sbjct: 1127 KDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDNTNVEKIATYIKRHASPNF 1186

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            QFIVISL+N+MFE +Q L+G++++  +  S  I
Sbjct: 1187 QFIVISLKNSMFEKSQALVGVFRQQQENTSKVI 1219

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 98/189 (51%), Gaps = 14/189 (7%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L+NFKSY G   +G  + NF++++GPNGSGKSN++D++ FV G R++ +R   L DL+
Sbjct: 7   LELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSHLLMDLV 66

Query: 216 HKSESFPNLPSCSVDVEFQYVVDKSNGSS------KIDDNKPKLIITRKAFKNNSSKYFI 269
           ++     +      +      +  +  +       K  +  P +   R   ++  S Y +
Sbjct: 67  YRGRRTGDEEESMEEEPSSSKISSTRSAYVKAFYLKEGEESP-IEFMRTISRSGESAYKV 125

Query: 270 NGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIG 329
           NGK   Y + T +L++E I +  + FL+ QG+VE IA     ++  G+  L +  E I G
Sbjct: 126 NGKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIA-----SQSAGE--LTKLFEQISG 178

Query: 330 TADYKSSIE 338
           +  YK   E
Sbjct: 179 SVQYKREYE 187

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 78/155 (50%), Gaps = 21/155 (13%)

Query: 697 NEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILK-RIQT 754
           ++Y +A+ST   +  D ++VD+    Q CI YL++ + G A FI L+ +  +     +  
Sbjct: 546 DKYAVAVSTVLGKNFDSVIVDNFSVAQECISYLKRQRSGVASFIPLDTIDAITANLPVSN 605

Query: 755 PENVKRLFDLVKPDKDIFIPAFY----SVLRNTL-VAKDLKQANRVAYGATRFRVVTMDG 809
            +      D +  D ++     Y    S++ ++L +AKDLK  NR      R ++VT++G
Sbjct: 606 TKGCILAIDSISYDSELEKAMQYVCSDSIICDSLDLAKDLKW-NR----GIRSKLVTLEG 660

Query: 810 KLIDISGTITGGG---------KQTAQGLMKLRKK 835
            LI  +G +TGG          K+  QGL+ L+ +
Sbjct: 661 ALIHKAGLMTGGASREGNNRWDKEEYQGLLALKNR 695

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  129 bits (325), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 99/154 (64%), Gaps = 12/154 (7%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F + F  ++  +  +Y+ +T          GGNA L L D  +P++ GV +   PP K +
Sbjct: 1060 FEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLEDEDEPYNGGVKYHATPPLKRF 1119

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA- 1370
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD  NV  +A YI +R  N  
Sbjct: 1120 KDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDITNVERIATYI-QRHGNPE 1178

Query: 1371 -QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
             QFIVISL+N+MFE ++ L+GIY+   +  S  I
Sbjct: 1179 LQFIVISLKNSMFEKSEALVGIYRHQKENSSRII 1212

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 88/155 (56%), Gaps = 11/155 (7%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L LNNFKSY G   +G   +NF++++GPNGSGKSN++D++ FV G +++ +R + L DLI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 216 HKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNS----SKYFING 271
           ++          S D E     D +  S+ +     K  +T +  ++ S    S Y IN 
Sbjct: 67  YRG-------FLSGDDEDNNNEDVNPNSAYVKAFYQKEDVTHELMRSISNSGDSTYKINN 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIA 306
           K  SY + T  L++E I +  K FL+ QG+VE IA
Sbjct: 120 KTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA 154

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 126/281 (44%), Gaps = 48/281 (17%)

Query: 573 ESQISLLQENQSKLKDEIEKLKNDLKCQFENKKNQEEKLID---LKVQFSAISTEFDRGE 629
           +++ISLL  ++ +  DE+   KN  + +    K  ++ ++    L+++ S +++  +   
Sbjct: 400 DTKISLLNNDKQETSDEVAMFKN--RIELAKSKIADDLVLQGERLELEISELTSSLNEKN 457

Query: 630 SECANAKSKIKDMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGR-------- 681
           S  +   S++K +Q  +++   K  D   +L     K   LSA  +   + R        
Sbjct: 458 SLHSQKVSELKTLQGEIESTSNKEYDLNYKLRETLVKLDDLSASQRESTNERKLRENVSM 517

Query: 682 ----ISGFYGRLGDLGVIDNE-YDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGY 735
                 G  G + DL     E Y +A+ST   +  D I+ D++   Q CI YL+K + G 
Sbjct: 518 LRRLFPGVRGLVSDLCQPKKEKYALAVSTILGKNFDSIITDNISVAQECIAYLKKQRAGV 577

Query: 736 ARFILLEKLRN--------------LILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLR 781
           A FI LE + +              L +  I+     +R    V  D         S++ 
Sbjct: 578 ASFIPLESIESEVPTLPFSDGQGCILTINAIEYEPEYERAMQYVCSD---------SIIC 628

Query: 782 NTL-VAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGG 821
           +TL +AKDLK  + V     + ++VT++G LI  +G +TGG
Sbjct: 629 DTLTIAKDLKWKHNV-----KSKLVTLEGALIHKAGLMTGG 664

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  127 bits (319), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 99/155 (63%), Gaps = 12/155 (7%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F   F  +   + ++Y+ +T          GGNA L + +  +P+  G+ +   PP K +
Sbjct: 1081 FEACFKHVDKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYFATPPLKRF 1140

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK-NA 1370
            +++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+YIK     NA
Sbjct: 1141 KDMEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNA 1200

Query: 1371 QFIVISLRNNMFELAQQLIGIYK--RDNKTKSAAI 1403
            QFIVISL+N MFE +Q L+GI++   DN ++  ++
Sbjct: 1201 QFIVISLKNAMFEKSQSLVGIFREQEDNSSRMVSL 1235

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 102/207 (49%), Gaps = 34/207 (16%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L+NFKSY     +G   + F++++GPNGSGKSN++D++ FV G R+N++R   L DLI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 216 HK----------------------SESFP-NLPSCSVDVEFQYVVDKSNGSSKIDDNKPK 252
           ++                      SE+ P N      +    YV   S    K D ++P 
Sbjct: 67  YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYV---SCVYQKDDLDEPT 123

Query: 253 LIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKA 312
              TR    +  S Y IN +  SY +  + L+ E I +  K FL+ QG+VE IA   P++
Sbjct: 124 KF-TRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIASQGPES 182

Query: 313 EREGDDGLLEYLEDIIGTADYKSSIEK 339
                  L   LE + G+ +YK+  EK
Sbjct: 183 -------LTLLLEQVSGSINYKNDYEK 202

 Score = 59.7 bits (143), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 119/267 (44%), Gaps = 64/267 (23%)

Query: 684 GFYGRLGDLGVIDNE-YDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILL 741
           G  G + DL     E Y IA+ST   +  D I+VDS+     CI YL+K + G A FI L
Sbjct: 546 GVKGLVHDLCHPKKEKYAIAVSTILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPL 605

Query: 742 EKLR----NLILKRIQTPENVKRLFDLVKPDKDIFI-PAFYSVLRNTLVAKDLKQANRVA 796
           + +     +L +  +Q       L  +   + + ++  A   V  ++++  +L  A  + 
Sbjct: 606 DTIDVNPPSLPVSNVQGC-----LLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELK 660

Query: 797 YGA-TRFRVVTMDGKLIDISGTITGGGKQT---------AQGLMKLRKKGQENIDIYSND 846
           +    + ++VT++G LI  +G +TGG  Q           QGLM L+             
Sbjct: 661 WSRNVKAKLVTLNGALIHKAGQMTGGTAQKNQNRWNKDEYQGLMVLK------------- 707

Query: 847 DIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDISSKELES 906
             ++I +EL    + F+  N            +K R  ELE EIS  L++ +ISS     
Sbjct: 708 --DQITEELTALSDKFRADN------------MKSR--ELENEIS--LLNNEISS----- 744

Query: 907 TQDQLKQKITFYERHTQNKDEVVEIEH 933
               L+ +IT  ER    K+  VEI+H
Sbjct: 745 ----LRTQITQLERTLSGKN--VEIKH 765

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  127 bits (318), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 98/153 (64%), Gaps = 10/153 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMITM---------GGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F   F  ++  ++ +Y+ +T          GG A L L D  +PF+ GV +   PP K +
Sbjct: 1071 FESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTLEDEDEPFNGGVKYHATPPLKRF 1130

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNA 1370
            +++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI K   K+ 
Sbjct: 1131 KDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDHTNVERIAAYIRKHGNKDL 1190

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            QFI+ISL+N MFE +  L+G++++  +  S A+
Sbjct: 1191 QFIIISLKNTMFEKSDALVGVFRQQTENSSKAL 1223

 Score =  100 bits (250), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 88/155 (56%), Gaps = 14/155 (9%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L+NFKSY G   IG  ++NF++++GPNGSGKSN++D++ FV G R+N +R   + DLI
Sbjct: 7   LELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLI 66

Query: 216 HK----SESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
           H+    S+S  + P+ +    F  V D S  +           + R    +  + Y ING
Sbjct: 67  HRSVRDSQSSNDDPTSAYVKAFYKVTDASEITE----------LMRIVNLSGETIYKING 116

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIA 306
           K +S+   +  L +E I +  K FL+ QG+VE IA
Sbjct: 117 KTTSFKNYSDWLAKENILIKAKNFLVFQGDVETIA 151

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 64/142 (45%), Gaps = 13/142 (9%)

Query: 697 NEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILK----- 750
           ++Y +AI T   +  + ++VDS+   Q CI YL+K + G   FI L+ +   I       
Sbjct: 536 DKYALAILTILGKNFNSVIVDSLSVAQECISYLKKQRAGIISFIPLDTIEAQIPSLPTII 595

Query: 751 ----RIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAY--GATRFRV 804
               +     N     + ++ + + F  A   +  N+++  +L  A  + +       + 
Sbjct: 596 QNNPKYNNDSNCILTINAIEYEPE-FERAMQYICSNSIICDNLDIAKDLKWNQNVKNVKF 654

Query: 805 VTMDGKLIDISGTITGGGKQTA 826
           VT+DG +I  S  +TGG  + +
Sbjct: 655 VTLDGSIIHKSNLMTGGASKNS 676

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
           Subunit of the multiprotein cohesin complex essential
           protein involved in chromosome segregation and in
           double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1217

 Score =  126 bits (316), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 177/734 (24%), Positives = 309/734 (42%), Gaps = 111/734 (15%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L NFKSY G   +G  ++NF +++GPNGSGKSN++D++ FV G +++ +R   L DLI
Sbjct: 7   LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 216 HKS----ESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
           ++     E   +    +  V+  Y+  KS+ + +         ++R   +N  ++Y +NG
Sbjct: 67  YRGVEGEEDEEDGEGRTAYVKAFYL--KSDSTVE---------LSRSISRNGDTQYKMNG 115

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
           K   Y +  + L+EE I +  + FL+ QG+V  IA        +    L +  E+I G+ 
Sbjct: 116 KNCGYKQYAEFLEEENILIKAQNFLVFQGDVVQIAS-------QSATDLTKLFEEISGSI 168

Query: 332 DYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSK 391
            YK   +    +VD+LN+                        +A E +K  RR+     +
Sbjct: 169 QYKKEYDSLKGKVDSLNQ------------------------SAAESIKNRRRI---HGE 201

Query: 392 LLQYN-ILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIK 450
           L  Y   + ++++    ++K   LQ  Y         TQR  ++LED    +   I +I+
Sbjct: 202 LKSYREGIDKNQEFYHQVEKRKELQRHYALWQLYHLETQR--HELEDKLANLKNSIKTIR 259

Query: 451 EDMKNNTSKKRELQNKKASL----------EEKIKSYTRKKEKASKSIA-------QSKK 493
                 TS+++ LQ  +AS             K++S +R+KEK ++ +         + K
Sbjct: 260 ---GKETSQEQILQRSRASFARESASILKQRSKMESKSREKEKINQQLLPIKLSQRSAAK 316

Query: 494 LLKNYRNEIETLNVDXXXXXXXXXXXXXXXXXXXXXXXXXXXSLKDKTTDISNEIAQHER 553
            + N +  I +L  D                            +K+ + D        + 
Sbjct: 317 RIANVQKRISSLQRDIDRQREYVERFENQLNVVTKAKSDFEKEIKESSKDHDKYKLNEDD 376

Query: 554 XXXXXXXXXXXXXXXXXVAESQISLLQENQSKLKDEIEKLK--NDLKCQFENKKNQEEKL 611
                              ESQ  L   ++ +L DE+E LK  ND+     ++   E  +
Sbjct: 377 TKLYASLNEKYLNQGGFSLESQKQLTLNDKQELMDEMETLKKRNDIS---RSRVTDELSV 433

Query: 612 I--DLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDARSRLATVENKSKV 669
           I   L+ Q S IS+  +   S  ++   +++ +   +++   K  D   +L  V  K + 
Sbjct: 434 IAEKLESQLSEISSTLNERNSTHSDKVKELQKLHSQIESSSNKEYDLNYKLREVLVKIEE 493

Query: 670 LSALHKLQKSGR------------ISGFYGRLGDLGVI-DNEYDIAISTASAR-LDDIVV 715
           LSA  +     R              G  G + DL     ++Y +AIST   +  D ++V
Sbjct: 494 LSASQRETVKERKLRENIATLKRFFPGVRGLVCDLCQPKKDKYALAISTILGKNFDSVIV 553

Query: 716 DSVECGQHCIEYLRKNKLGYARFILLE----KLRNLILKRIQTPENVKRLFDLVKPDKDI 771
           D+V   Q CI YL+K + G A FI L+    ++  L L   Q         D  +     
Sbjct: 554 DNVMVAQECIAYLKKQRAGIASFIPLDTIDVEIPTLTLSDSQGCTLAINAIDYEQE---- 609

Query: 772 FIPAFYSVLRNTLVAKDLKQANRVAYG-ATRFRVVTMDGKLIDISGTITGG--------- 821
           +  A   V  ++++  D+  A  + +    R ++VT++G LI  +G +TGG         
Sbjct: 610 YERALQYVCSDSIICDDMNIAKDLKWNKGVRSKLVTLEGALIHKAGLMTGGISKNTSNRW 669

Query: 822 GKQTAQGLMKLRKK 835
            K+  Q LM L+ K
Sbjct: 670 DKEEYQSLMTLKDK 683

 Score =  123 bits (308), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 96/153 (62%), Gaps = 10/153 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F + F   S  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K +
Sbjct: 1056 FERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRYHATPPFKRF 1115

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNA 1370
            +++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A YI +   ++ 
Sbjct: 1116 KDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAYISRHGNRDL 1175

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            QFIVISL+N MFE +  L+G+Y++  +  S  +
Sbjct: 1176 QFIVISLKNTMFEKSDALVGVYRQQQENSSKIV 1208

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  125 bits (314), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 93/144 (64%), Gaps = 10/144 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F + F  ++  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K +
Sbjct: 1061 FEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYHATPPLKRF 1120

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1370
            +++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI+     + 
Sbjct: 1121 KDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYIRRHGNPDL 1180

Query: 1371 QFIVISLRNNMFELAQQLIGIYKR 1394
            QFIVISL+N MFE +  L+G+Y++
Sbjct: 1181 QFIVISLKNTMFEKSDALVGVYRQ 1204

 Score = 95.5 bits (236), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 60/189 (31%), Positives = 93/189 (49%), Gaps = 29/189 (15%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L+NFKSY G   +G  ++NF++++GPNGSGKSN++D++ FV G R+  +R + L DLI
Sbjct: 7   LELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRSNVLKDLI 66

Query: 216 HKS----------ESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSS 265
           ++               N P+ +    F      S G S I+       ++R   K   +
Sbjct: 67  YRGVASEEEGDGESDVVNNPTTAYVKAFY-----SKGDSTIE-------LSRSISKGGDT 114

Query: 266 KYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLE 325
            Y +NGK   Y      L++E I +  K FL+ QG+V  IA             L ++ E
Sbjct: 115 TYRMNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIASQSAME-------LTQFFE 167

Query: 326 DIIGTADYK 334
           +  G+  YK
Sbjct: 168 EFSGSIQYK 176

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 123/284 (43%), Gaps = 57/284 (20%)

Query: 584 SKLKDEIEKLKNDLKCQFE------NKKNQEEKLIDLKVQFSAISTEFDRGESECANAKS 637
           S++ DE+   K  L+ Q        N+KNQ           S  ++E  + +SE  ++ +
Sbjct: 430 SRISDELLVTKQSLELQMSDLSSSLNEKNQAH---------SEQASELKKLQSEIESSNN 480

Query: 638 KIKDMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDN 697
           K  D+ + L+    K+ D  +       + K+   +  L+K     G  G + DL     
Sbjct: 481 KEYDLNYKLREALIKIDDLSASQRETNKERKLRENVSTLKKF--FPGIRGLVSDLCQPKK 538

Query: 698 E-YDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRN--------- 746
           E Y +A+ST   R  D I+VD++   Q CI YL+K + G A FI L+ +           
Sbjct: 539 ERYALAVSTILGRNFDSIIVDNLAVAQECIAYLKKQRAGIASFIPLDTIEVETSTLPASE 598

Query: 747 -----LILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTL-VAKDLKQANRVAYGAT 800
                L +  I+     +R    V  D         S++ NTL +A+D+K    V     
Sbjct: 599 SSGCILAINAIEYDPEYERAMRYVCSD---------SIICNTLEIARDMKWKRNV----- 644

Query: 801 RFRVVTMDGKLIDISGTITGG---------GKQTAQGLMKLRKK 835
           R ++VT++G LI  +G +TGG          K+  Q LM L+ K
Sbjct: 645 RSKLVTLEGTLIHRAGLMTGGISKDSSNRWDKEEYQSLMTLKDK 688

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  122 bits (306), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 94/153 (61%), Gaps = 10/153 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMITM---------GGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F   F  I+  L  +Y  +T          GG+A + + D  +PF+ G+ +   PP K +
Sbjct: 1062 FENAFEKINEHLDAIYSELTRNVNSTSILGGGSASMTIEDEDEPFNAGIRYHATPPMKRF 1121

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1370
            +++  LSGGEKT+++LAL+FA++ Y P+P +++DE+DAALD  NV  +A YI+     + 
Sbjct: 1122 KDMEYLSGGEKTVAALALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDL 1181

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            QFIVISL+N MFE +  L+G++++  +  S  +
Sbjct: 1182 QFIVISLKNTMFEKSDALVGVFRQQQENSSKIV 1214

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 104/197 (52%), Gaps = 13/197 (6%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L L NFKSY G   +   ++NF++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 216 HKS-ESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKES 274
           ++   S  N P+ + + E            + D    +L+  R   +   + Y ++G   
Sbjct: 67  YRDIISRENTPTGADNDENGNRTAYVKAFYEYDGKVVELM--RLISRLGDTSYKLDGNTV 124

Query: 275 SYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYK 334
           +Y E ++ L+ + I +  K FL+ QG+VE IA   P        GL + +E++ G+  YK
Sbjct: 125 TYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL-------GLTKLIEEVSGSMQYK 177

Query: 335 SSIEKNTIEVDTLNEIC 351
              E+     D  ++IC
Sbjct: 178 KEYEELK---DQYDKIC 191

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 69/128 (53%), Gaps = 4/128 (3%)

Query: 697 NEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTP 755
           ++Y +A+ST   +  D ++VDS+   Q CI +L+K + G   FI L+ + +    R+  P
Sbjct: 540 DKYKLAVSTVLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLDTI-DAATPRMPVP 598

Query: 756 ENVKRLFDLVKPD-KDIFIPAFYSVLRNTLVAKDLKQANRVAYGA-TRFRVVTMDGKLID 813
           E+      +   + KD  + A Y V  +T++  +L  A  + +      ++VT+DG LI+
Sbjct: 599 ESETYTLAINTVEYKDDLVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALIN 658

Query: 814 ISGTITGG 821
            +G +TGG
Sbjct: 659 KTGLMTGG 666

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  121 bits (303), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 101/165 (61%), Gaps = 11/165 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F+  F  ++  +  +Y+ +T          GG+A L L D  +P+  G+ +   PP K +
Sbjct: 1059 FLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLAGIRYHATPPMKRF 1118

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1370
            +++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YIK   +   
Sbjct: 1119 KDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYIKRHASPKF 1178

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFLKEADIV 1415
            QFIVISL++N+F  +Q + G++ R+ +  S+ +   D  +  D V
Sbjct: 1179 QFIVISLKSNLFGKSQSMAGVF-RNQQANSSMVITTDLTQYVDDV 1222

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/190 (32%), Positives = 93/190 (48%), Gaps = 20/190 (10%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L LNNFKSY G   +G  N +F ++VGPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 216 H------KSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFI 269
           +      +S+     P  +    F    D     +KI+         R       S Y I
Sbjct: 67  YRGRMDDRSDEHVASPKSAYVKAFYLKDDNGEQGTKIE-------FMRIIQNTGDSVYRI 119

Query: 270 NGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIG 329
           +GK  S+    + L+ E I +  + FL+ QG+VE IA        +    L +  E + G
Sbjct: 120 DGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIAS-------QSGIELTKLFEQVSG 172

Query: 330 TADYKSSIEK 339
           +  Y+   E+
Sbjct: 173 SVQYQREYER 182

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 73/138 (52%), Gaps = 24/138 (17%)

Query: 697 NEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTP 755
           ++Y +A+S+   +  D IVVDSV   Q CI YL+K++ G A FI L+ +       I TP
Sbjct: 538 DKYALAVSSMLGKNFDSIVVDSVSVAQQCISYLKKHRSGAASFIPLDTI------DINTP 591

Query: 756 ----ENVKRLF---DLVKPDKDIFIPAFY----SVLRNTL-VAKDLKQANRVAYGATRFR 803
                N+K      + ++ D ++     Y    S++ +TL +AK+LK    +     + +
Sbjct: 592 TLPVRNLKGCILTVNAIEYDSELEKAMQYVCSDSIICDTLDIAKNLKWDRGI-----KSK 646

Query: 804 VVTMDGKLIDISGTITGG 821
           +VT+ G LI  +G +TGG
Sbjct: 647 LVTIQGALIHRAGLMTGG 664

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  119 bits (298), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 99/163 (60%), Gaps = 11/163 (6%)

Query: 1261 FMQGFGIISMTLKEMYQMIT---------MGGNAELELIDSLDPFSEGVTFSVMPPKKSW 1311
            F+  F  +   +  +Y+ +T          GG+A L L D  +P+  G+ +   PP K +
Sbjct: 1059 FLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRYHATPPMKRF 1118

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1370
            +++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI+   +   
Sbjct: 1119 KDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYIRRHASPKM 1178

Query: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFLKEAD 1413
            QFIVISL++N+F  ++ + G+++  ++  S  I   D  + AD
Sbjct: 1179 QFIVISLKSNLFSKSESMAGVFRNQHENSSMVI-TTDLTQYAD 1220

 Score = 97.4 bits (241), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/190 (32%), Positives = 97/190 (51%), Gaps = 20/190 (10%)

Query: 156 LVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 215
           L + NFKSY G   +G    NF ++VGPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLI 66

Query: 216 HK------SESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFI 269
           ++        +  N P  +    F YV   ++G+ +      ++  TR       S Y +
Sbjct: 67  YRGRMEEGGSAHENNPKSAYVTAF-YVKQDASGAER------RMEFTRVIHNTGDSTYKL 119

Query: 270 NGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIG 329
           +GK   Y E   +L+ E I +  + FL+ QG+VE IA       + G D L +  E + G
Sbjct: 120 DGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIAS------QSGVD-LTKLFEQVSG 172

Query: 330 TADYKSSIEK 339
           +  Y+   E+
Sbjct: 173 SVQYQREYER 182

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  110 bits (275), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 99/362 (27%), Positives = 174/362 (48%), Gaps = 33/362 (9%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKI--DDNKPKLIITRKAFKNNSSKYFI 269
            DLI+K      +   SV + F    D S+ SS     +  PK+ +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVIKASVTIVF----DNSDPSSSPFGFETYPKISVTRQIILGGTSKYLI 117

Query: 270 NGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIG 329
           NG  +    V  L +   +++++  FLI+QG++  +  MKP       D +L  +E+  G
Sbjct: 118 NGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEAAG 170

Query: 330 T---ADYKSSIEKNTIEVDT-LNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRL 385
           T    D +   EK   + +T L EI   +    E +E + N L + K A LEF + +  L
Sbjct: 171 TRMFEDRREKAEKTMAKKETKLQEI---RALLLEEIEPKLNRLRNEKRAFLEFQQTQTDL 227

Query: 386 TLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKK 445
             +   +  Y+         + +QK S +QE  Q++  + ++ +    K  D    + + 
Sbjct: 228 EKTSRIVNTYD-------YQTLVQKRSSMQERLQSDQKRIKDLEFSVEKYRDEISTLTED 280

Query: 446 IVSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETL 505
             SI+   +    K   LQ    +LE K  S + +  + + ++  ++  L + +  +  L
Sbjct: 281 FESIRRQKEKQLQKDTTLQ----TLEAKENSLSTELSRVTAALGITRDDLADEQRNLSAL 336

Query: 506 NV 507
           N+
Sbjct: 337 NL 338

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMF 1382
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 99/435 (22%), Positives = 185/435 (42%), Gaps = 84/435 (19%)

Query: 706  ASARLDDIVVDSVECGQHCIEY--LRK-------NKLGYARFI---LLEKLRNLILKRIQ 753
            A  RL +++VD+ +     +E   LRK       NK+  AR I    L K ++L      
Sbjct: 548  AGGRLFNVIVDNEKTASQLLERGRLRKRVTIIPLNKIS-ARVINTDALNKAKSL------ 600

Query: 754  TPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGA-TRFRVVTMDGKLI 812
             P  V+   +L+  + ++   A   +   +L+ +D   A +V +    R R +T+DG + 
Sbjct: 601  APGAVELALNLIGYEAEV-ARAMEFIFGGSLICRDAATAKKVTFHPQVRARSITLDGDIY 659

Query: 813  DISGTITGGGKQTAQGLMKLRKKGQENIDIYSNDDIEK----IEKELVERENNFKFANDT 868
            D  GT++GG +     L+         IDI   ++  K    +EKEL + + N       
Sbjct: 660  DPEGTLSGGSRSHTSSLL---------IDIQKYNEAAKQMMVLEKELYQVQANIS----- 705

Query: 869  YFEMEQALQRLKDRKPELELEISKC-----LMDTDISS----------KELESTQDQLKQ 913
              E E A +  K  + EL L   KC      +D++ ++          +E+E++++   Q
Sbjct: 706  --EHENASRMTKSLQNELNLAKHKCQLAENALDSNPAAQIIKRNGEIHREIEASENDRDQ 763

Query: 914  KITFYERHTQNKDEVVEIEHXXXXXXXXXXXXXDSTKNISEKIDKLKKRIMEIGGIDLQM 973
            + T   R    + E++ I+              +   +   K+D+LK  I      DL+ 
Sbjct: 764  QTT---RVNALQMEILRIQRDMD----------EFNTDKGSKLDQLKAEIR-----DLKR 805

Query: 974  QNSKVNSII-------QNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAELDFKTCSKE 1026
              S+   +I       QN+ +   + +  + +MK+   E+   E+ L   E       ++
Sbjct: 806  SLSENEEVIEKKYDLYQNLQMETEQLQNDVVTMKQ---ELVEKEQLLQSLEERITKLERD 862

Query: 1027 MDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEGTKFKSYEIDV 1086
            +   S ++ESV+R L       L+++ E  EL     +  +K++E+E+E  K  +     
Sbjct: 863  VLLRSNDLESVQRDLNEERNKLLRIDEEIEELTSLIRDKSKKMSESELEYQKLTAEANKS 922

Query: 1087 KDRLEKLNNLLKHIK 1101
            K   EK+   +K +K
Sbjct: 923  KYNAEKIEEEIKALK 937

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score =  106 bits (265), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/179 (35%), Positives = 97/179 (54%), Gaps = 11/179 (6%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           I +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  A   +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRASSL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV V F    DKSN       N  K+ +TR+     SSKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTVVFDN-SDKSNSPIGF-TNSAKISVTRQVMLGGSSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGT 330
             +    V +L +   +++++  FLI+QG++  +  MKPK        +L  +E+  GT
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAGT 171

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1297 SEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1357 SIVANYIKERTKNAQFIVISLRNNMF 1382
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 100/238 (42%), Gaps = 32/238 (13%)

Query: 682 ISGFYGRLGDLGVIDNEYDIAIS---TASARLDDIVVDSVECGQHCIEYLRKNKLGYARF 738
           + G   +L  L   ++ YD A +    A  RL ++VVD+       +E  R  K      
Sbjct: 523 VKGVAAQLFTLA--EDNYDSATALQVCAGGRLYNVVVDNERTASQLLEKGRLRK--RVTI 578

Query: 739 ILLEKL-------RNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQ 791
           I L ++       + L L +   P  V+   +LV  ++++   A   +  N+L+ KD + 
Sbjct: 579 IPLNRIAARALNSQTLQLAQKTAPGKVELALNLVGYEEEVS-RAMEFIFGNSLICKDAET 637

Query: 792 ANRVAYGA-TRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQENIDIYSNDDIEK 850
           A ++ +    R R +T+ G + D  GT++GG +     L+         ID+   +   K
Sbjct: 638 AKKITFHPQIRTRSITLQGDVYDPEGTLSGGSRNNTSSLL---------IDVQKYN---K 685

Query: 851 IEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDISSKELESTQ 908
             K + E E   K       E E  LQ+ +  + +L L   K  +    + + LES Q
Sbjct: 686 TAKRIEELELKLKSITRDLEEQESKLQKTRSVRNDLNLATHKLTL----AQRSLESNQ 739

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  106 bits (264), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 97/315 (30%), Positives = 152/315 (48%), Gaps = 54/315 (17%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKID-DNKPKLIITRKAFKNNSSKYFIN 270
            DLI+K      +   SV + F    DKS  SS I  ++ PK+ +TR+     +SKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDN-TDKS--SSPIGFESYPKISVTRQIILGGTSKYLIN 118

Query: 271 GKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGT 330
           G  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 331 ADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKS 390
             +                     E+R E  E+                KKE +L   ++
Sbjct: 172 RMF---------------------EDRREKAEK-------------TMAKKETKLQEIRT 197

Query: 391 KLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIK 450
            LL+  I  + EKL +  QK + L  E+Q   T  E T R  N  E  +  M  K  +IK
Sbjct: 198 -LLEEEIEPKLEKLRN--QKRAFL--EFQETQTDLEKTLRILNAYE--YYDMATKNSTIK 250

Query: 451 EDMKNNTSKKRELQN 465
           E ++N+T++  EL N
Sbjct: 251 ETLQNSTARVEELNN 265

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMF 1382
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score =  105 bits (261), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 97/347 (27%), Positives = 175/347 (50%), Gaps = 32/347 (9%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    DKSN      +  PK+ +TR+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDN-TDKSNTPIGFSE-YPKISVTRQIVLGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V +L +   +++++  FLI+QG++  I  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEAAGTK 172

Query: 332 DYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSK 391
            ++   EK             +KE +    +  +  L+   +  LE ++ E+RL L + +
Sbjct: 173 MFEDRKEK-------AERTMQKKETKL---QENRTLLKEEIDPQLEKLRNEKRLFL-EFQ 221

Query: 392 LLQYNI-LKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIK 450
            +Q ++   E   +A+  QK+   ++  +   T  E +  + ++L+     +N++I ++ 
Sbjct: 222 TIQADLETTEKVVIATDYQKMLNSRDSIK---TVLETSNSKMDELQKKIDLVNREISNLN 278

Query: 451 EDMKNNT-SKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLK 496
           ED++     KK+EL+N     +  IK+   K++K    IA+ K  LK
Sbjct: 279 EDLQQTMKQKKKELEN-----DTNIKAMESKEDKLLSEIAKLKANLK 320

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMF 1382
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/188 (32%), Positives = 101/188 (53%), Gaps = 11/188 (5%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           I +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV V F    D+ N       N PK+ +TR+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVFDN-SDRDNSPIGF-TNSPKISVTRQVVLGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 332 DYKSSIEK 339
            ++   EK
Sbjct: 173 MFEDRREK 180

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMF 1382
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 93/218 (42%), Gaps = 35/218 (16%)

Query: 687 GRLGDLGVIDNE-YDIAIS---TASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLE 742
           G    L  +D + +D AI+    A  RL +I+VD+       +E  R  K      I L 
Sbjct: 525 GVAAQLFTVDQQQFDNAIALQVCAGGRLYNIIVDNEITASQLLERGRLKK--RVTIIPLS 582

Query: 743 KL-------RNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRV 795
           K+         L L +   P  V+   +L+  D ++   A   +  N LV KD   A +V
Sbjct: 583 KIATRTLNKNTLALAKELAPGKVELALNLIGYDDEVS-KAMEFIFGNGLVCKDADTAKKV 641

Query: 796 AYGAT-RFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQENIDI----YSNDDIEK 850
            +    R R +T  G + D  GT++GG + T + L+         +DI    ++   + +
Sbjct: 642 TFHPNIRTRSITQQGDVYDPEGTLSGGSRNTTRSLL---------VDIQKYNHAVAKVNE 692

Query: 851 IEKELVERENNFKFANDTYFEMEQALQRLKDRKPELEL 888
           +E +L+E +   K       E E+  Q+ K  + EL L
Sbjct: 693 LELKLIEMQKKLK-------EQEETSQKTKSLQNELNL 723

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 95/374 (25%), Positives = 181/374 (48%), Gaps = 52/374 (13%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   +
Sbjct: 3   VEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNM 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    DKSN     +D+  K+ +TR+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDN-SDKSNSPIGFNDS-LKISVTRQIVLGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V +L +   +++++  FLI+QG++  +  M+P         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRPSE-------ILSLIEEAAGTK 172

Query: 332 DYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSK 391
            ++   EK             +KE + E         E+    A E   K  +L   K  
Sbjct: 173 MFEDRREK-------AERTMSKKETKLE---------ENRTLLAEEIEPKLNKLRGEKRI 216

Query: 392 LLQYNILKEHEKLASTLQKLS--VLQEEYQNEST-------KFENTQRETNKLEDNFKQM 442
            L++ + +      + L+K+S  V   +Y N ST       K  + +R   +L+    + 
Sbjct: 217 FLEFQVTQ------TDLEKISRVVTAFDYHNMSTRRDSARDKVSSNERRMEELKTLISKT 270

Query: 443 NKKIVSIKEDMKNNTSKKRE----------LQNKKASLEEKIKSYTRKKEKASKSIAQSK 492
             +I+S+KED++   ++K++          L+ ++     +I      K+  S+++ ++K
Sbjct: 271 TDEIISLKEDLEQIKTQKKDELDKNGVLPKLEKQEGDFLNQISRINATKQICSQNLEENK 330

Query: 493 KLLKNYRNEIETLN 506
           K ++  +N +E+L+
Sbjct: 331 KKIQKLQNTLESLS 344

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMF 1382
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 63/133 (47%), Gaps = 11/133 (8%)

Query: 706 ASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLR------NLI-LKRIQTPENV 758
           A  RL ++VVD+       +E  R  K   A  I L K+       N++ + +   P  V
Sbjct: 548 AGGRLFNVVVDNENTAAQLLERGRLRK--RATIIPLNKIAARTLNDNIVNMAKSVAPGRV 605

Query: 759 KRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGA-TRFRVVTMDGKLIDISGT 817
           +   +L+  ++++   A   +  ++LV KD + A  V +    R R +T+DG + D  GT
Sbjct: 606 ELALNLIGYEEEVR-RAMEFIFGSSLVCKDAEAAKMVTFNPKIRTRSITLDGDVYDPEGT 664

Query: 818 ITGGGKQTAQGLM 830
           ++GG +     L+
Sbjct: 665 LSGGSRNNTSSLL 677

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 81/267 (30%), Positives = 134/267 (50%), Gaps = 25/267 (9%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    DKSN       N P++ +TR+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDN-TDKSNSPIGF-TNSPQISVTRQVVLGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 332 DYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAA---LEF------VKKE 382
            ++   EK   E     +    +ENR  + E  +  LE  +N     LEF      ++K 
Sbjct: 173 MFEDRREK--AERTMSKKETKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLEKT 230

Query: 383 RRLTLSKSKLLQYNILKEHEKLASTLQ 409
            R+ +S      YNI  +H  +  TL+
Sbjct: 231 ERIVVSYE---YYNIKHKHTSIRETLE 254

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMF 1382
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score =  103 bits (258), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 102/188 (54%), Gaps = 11/188 (5%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    DK+N      +N  K+ +TR+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGITKASVTIVFDN-TDKTNSPIGF-NNSAKISVTRQVVLGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V +L +   +++++  FLI+QG++  +  MKPK        +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAGTK 172

Query: 332 DYKSSIEK 339
            ++   EK
Sbjct: 173 MFEDRREK 180

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1370 AQFIVISLRNNMFELAQQL 1388
            +QFIV+SL+  MF  A ++
Sbjct: 1138 SQFIVVSLKEGMFSNANRV 1156

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  103 bits (258), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 101/188 (53%), Gaps = 11/188 (5%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    DKSN       N P++ +TR+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDN-TDKSNSPIGF-TNSPQISVTRQVVLGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 332 DYKSSIEK 339
            ++   EK
Sbjct: 173 MFEDRREK 180

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1311 WRN-IANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMF 1382
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 15/157 (9%)

Query: 686 YGRLGDLGVIDNE---YDIAIST-ASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILL 741
           YG +G L  +D++   Y  A+ T A  RL ++VV   +     +E  R  K      I L
Sbjct: 524 YGVVGQLFELDDDKIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RVTIIPL 581

Query: 742 EKLRN-------LILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANR 794
            K+         L L +   P  V+   +L+K DK +   A   +  N+L+ +D + A +
Sbjct: 582 NKISTRPISPQVLELAKKIAPGKVELAINLIKFDKSV-TKAMEFIFGNSLICEDPETAKK 640

Query: 795 VAYGA-TRFRVVTMDGKLIDISGTITGGGKQTAQGLM 830
           + +    R R +T+ G + D  GT++GG + T+  L+
Sbjct: 641 ITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSDSLL 677

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 99/180 (55%), Gaps = 13/180 (7%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           I +L+++ FKSYA   VI  ++  F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKID-DNKPKLIITRKAFKNNSSKYFIN 270
            DLI+K      +   SV + F  +  K    S I  +N PKL +TR+     +SKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFSNLDPK---CSPIGFENSPKLSVTRQIILGGTSKYLIN 118

Query: 271 GKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGT 330
           G  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

 Score = 82.0 bits (201), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMFELAQQLI 1389
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFSNANRVF 1156

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 73/162 (45%), Gaps = 20/162 (12%)

Query: 682 ISGFYGRLGDLGVIDNEYDIAIS---TASARLDDIVVDSVECGQHCIEY--LRK------ 730
           + G   +L  L   +N YD A++    A  RL +++VD        +E   LRK      
Sbjct: 523 VKGVAAQLFTLS--ENNYDSALALQVCAGGRLFNVIVDDQNTASQLLERGKLRKRVTIIP 580

Query: 731 -NKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDL 789
            NK+   R I  E L+   L +   P  V+   +LV  ++++   A   +  N+LV  D 
Sbjct: 581 LNKIA-TRVINSESLK---LAKQLAPGKVQLALNLVGYEEEVS-KAMEYIFGNSLVCNDA 635

Query: 790 KQANRVAYGA-TRFRVVTMDGKLIDISGTITGGGKQTAQGLM 830
           + A R+ +    R R +T  G + D  GT++GG +     L+
Sbjct: 636 ETAKRLTFHPQIRTRSITQQGDVYDPEGTLSGGSRNNKSTLL 677

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 102/188 (54%), Gaps = 11/188 (5%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    DKSN       N P++ +TR+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDN-TDKSNSPIGF-ANSPQISVTRQVVLGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 332 DYKSSIEK 339
            ++   EK
Sbjct: 173 MFEDRKEK 180

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMFELAQQLI 1389
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFSNANRVF 1156

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 96/413 (23%), Positives = 181/413 (43%), Gaps = 54/413 (13%)

Query: 683  SGFYGRLGDLGVIDNE---YDIAIST-ASARLDDIVVDSVECGQHCIEYLRKNKLGYARF 738
            S  YG +G L  +DN+   Y  A+ T A  RL ++VV   +     +E  R  K      
Sbjct: 521  SSVYGVVGRLFQLDNDNIRYSSALQTCAGGRLFNVVVRDSQTATQLLEGGRLRK--RVTI 578

Query: 739  ILLEKLRN-------LILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQ 791
            I L+K+         L L +   P  V+   +L++ DK +   A   +  N+L+  D + 
Sbjct: 579  IPLDKIYTRPITPQVLELAKSIAPGKVELAINLIRFDKPV-TKAMEFIFGNSLICDDPET 637

Query: 792  ANRVAYGA-TRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQENIDIYSNDDIEK 850
            A ++ +    R R +T+ G + D  GT++GG + T+Q L+         +DI   + I++
Sbjct: 638  AKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSQSLL---------VDIQKYNQIQE 688

Query: 851  ----IEKEL--VERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDISSKEL 904
                I+ +L  V  E   ++A     +  Q    L   K    L+++K  ++ + SS+ +
Sbjct: 689  KIGTIQADLNQVAEELRKQYATSQKTKTIQNDLNLSQHK----LDLAKRNLEVNPSSQIM 744

Query: 905  ESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXXXDSTKNISEKIDKLKKRIM 964
               ++ L+  I   E   +NK  +++                DS K    K+++LKK  +
Sbjct: 745  VRNEEILRD-IGDCENEIKNKQMILQRWQEEISTIEKDMKEYDSDK--GSKLNELKKE-L 800

Query: 965  EIGGIDLQMQNSKVNS---IIQNIDIIKSKQKRGISSMKKIENEIRRSEKAL----SGAE 1017
            ++   DL+ Q S+      + QN+++   + +  + S K +     +S ++L    S  E
Sbjct: 801  KLFAKDLEKQESEAECKYDLFQNLELETEQTRSELDSNKALLQSYLKSIESLKLENSELE 860

Query: 1018 LDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLEN---------ENSELEIE 1061
               +T    + +   E+   +R L  ID+   +LE          +N+ELE++
Sbjct: 861  GKIQTMEDHLVTIQTELNEEKRRLIDIDDELTELETLKKKKQEDRKNAELELQ 913

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score =  103 bits (256), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 89/327 (27%), Positives = 162/327 (49%), Gaps = 40/327 (12%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    DK+N      ++ PK+ +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFAN-SDKNNSPIGF-ESYPKISVTRQIVLGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 332 DYKSSIEKNTIEVDTLNEICIEKENRF--------EIVEREKNSLESSKNAALEFVKKER 383
            ++   EK      T+N    +KE +         E VE + N L + K A L+F + + 
Sbjct: 173 MFEDRREKAE---RTMN----KKETKLQEIRSLLQEEVEPKLNKLRNEKRAFLDFQETQS 225

Query: 384 RLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMN 443
            L  + SK++   +              S L ++ +N    F+N++   ++L  + +Q  
Sbjct: 226 DLE-NTSKIVNAFV-------------FSSLVQKRKNIENAFQNSESRISELTASVQQTK 271

Query: 444 KKIVSIKEDMKNNTSKKRELQNKKASL 470
            ++ +++ED+    ++KR    K  +L
Sbjct: 272 VELTNLEEDLDTIRTQKRNEMRKDGAL 298

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            +QFIV+SL+  MF  A ++     +D  +  ++I
Sbjct: 1137 SQFIVVSLKEGMFTNANRVFRTRFQDGTSVVSSI 1170

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 38/71 (53%), Gaps = 2/71 (2%)

Query: 754 TPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGA-TRFRVVTMDGKLI 812
            P++V+   +L+  + ++   A   +   +L+ +D + A +V +    R R +T+ G + 
Sbjct: 601 APDSVELALNLIGYEDEV-AKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGDIY 659

Query: 813 DISGTITGGGK 823
           D  GT++GG +
Sbjct: 660 DPEGTLSGGSR 670

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score =  103 bits (256), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 88/307 (28%), Positives = 152/307 (49%), Gaps = 33/307 (10%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSN-GSSKID-DNKPKLIITRKAFKNNSSKYFI 269
            DLI+K      +   SV + F    D S+  SS I  +  PK+ +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVIKASVTIVF----DNSDIKSSPIGFERYPKISVTRQIALGGTSKYLI 117

Query: 270 NGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIG 329
           NG  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEAAG 170

Query: 330 T---ADYKSSIEKNTIEVDT-LNEI--CIEKENRFEIVEREKNSLESSKNAALEFVKKER 383
           T    D +   EK   + +T L EI   +++E     +E + +   S K A LEF + + 
Sbjct: 171 TRMFEDRREKAEKTMAKKETKLQEIRALLQEE-----IEPKLDKFRSEKRAFLEFQETQT 225

Query: 384 RLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMN 443
            L ++        I+  H+   + + K + +QE  QN   + +  +    K ++    +N
Sbjct: 226 DLEMT------LRIVNTHD-YHNLVTKQNSIQETVQNSEQRVQELESSIKKYQNELSSLN 278

Query: 444 KKIVSIK 450
           +   +IK
Sbjct: 279 EDFTAIK 285

 Score = 68.9 bits (167), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            +QFIV+SL+  MF  A ++     +D  +  + I
Sbjct: 1137 SQFIVVSLKEGMFNNANRVFKTRFQDGTSAVSVI 1170

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 17/137 (12%)

Query: 706 ASARLDDIVVDSVECGQHCIE--YLRKNKLGYARFILLEKLRNLIL--------KRIQTP 755
           A  RL +I+VD+ +     +E   LRK        I L K+   +L        K+I  P
Sbjct: 548 AGGRLFNIIVDNEKTASQLLEKGMLRKR----VTIIPLNKISTRVLSDESLALAKKI-AP 602

Query: 756 ENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGA-TRFRVVTMDGKLIDI 814
             V+   +L+  ++D+   A   +   +L+  D + A ++ +    R R +T+DG + D 
Sbjct: 603 GKVELALNLIGYEEDVS-KAMQYIFGGSLICADAETAKKITFHPQIRARSITLDGDIYDP 661

Query: 815 SGTITGGGKQTAQGLMK 831
            GT++GG       L+K
Sbjct: 662 EGTLSGGSSNNTNSLLK 678

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  101 bits (252), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 87/317 (27%), Positives = 147/317 (46%), Gaps = 52/317 (16%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    DK N       N P++ +TR+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFNN-TDKLNSPIGF-TNSPQISVTRQVVLGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 332 DYKSSIEKNTIEVDTLNEICIEKENRF--------EIVEREKNSLESSKNAALEF----- 378
            ++   EK             +KE +         E +E +   L + K   LEF     
Sbjct: 173 MFEDRREK-------AERTMSKKETKLQESRTLLTEEIEPKLEKLRNEKRMFLEFQSTQT 225

Query: 379 -VKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLED 437
            ++K  R+  S      YNI  +H  +  TL                 EN +    KL D
Sbjct: 226 DLEKTERIVASYD---YYNIKHKHTSIRETL-----------------ENGEAHMKKLND 265

Query: 438 NFKQMNKKIVSIKEDMK 454
             ++ +++I S+ ED++
Sbjct: 266 FIRKTSEEIESLNEDIR 282

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1311 WRN-IANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMFELAQQLI 1389
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFSNANRVF 1156

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 79/164 (48%), Gaps = 16/164 (9%)

Query: 678 KSGRISGFYGRLGDLGVIDNEYDIAIST-ASARLDDIVVDSVECGQHCIEY--LRK---- 730
           K+  + G  G+L  L   +  Y  A+ T A  RL ++VV   +     +E   LRK    
Sbjct: 519 KANFVHGVVGQLFQLDYDNIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRKRVTI 578

Query: 731 ---NKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAK 787
              +K+ YAR I  + L    L +   P  V+   +L+K DK +   A   +  N+L+ +
Sbjct: 579 IPLDKI-YARTINPQVLE---LAKTVAPGKVELAINLIKFDKTV-TKAMEFIFGNSLICE 633

Query: 788 DLKQANRVAYGA-TRFRVVTMDGKLIDISGTITGGGKQTAQGLM 830
           D + A ++ +    R R +T+ G + D  GT++GG K T+  L+
Sbjct: 634 DPETAKKITFHPKIRIRSITLQGDVYDPEGTLSGGSKNTSDSLL 677

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score =  101 bits (252), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 103/188 (54%), Gaps = 11/188 (5%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    DK+N      +N  K+ +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDN-SDKTNSPIGF-NNSSKISVTRQIILGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V +L +   +++++  FLI+QG++  +  MKP       + +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAGTK 172

Query: 332 DYKSSIEK 339
            +++  EK
Sbjct: 173 MFENRREK 180

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1311 WRN-IANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMFELAQQLI 1389
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFSNANRVF 1156

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 98/225 (43%), Gaps = 34/225 (15%)

Query: 706 ASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKL-------RNLILKRIQTPENV 758
           A  RL ++VVD+ +     +E  R  K      I L K+       R L + +   P  V
Sbjct: 548 AGGRLYNVVVDNEKTASLLLEKGRLRK--RVTIIPLNKIAARTLNARTLQMAKDIAPGKV 605

Query: 759 KRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGA-TRFRVVTMDGKLIDISGT 817
           +   +L+  D ++   A   +   +LV +D   A +V +    R R +T+DG + D  GT
Sbjct: 606 ELALNLIGYDDEVS-RAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSITLDGDVYDPEGT 664

Query: 818 ITGGGK--------------QTAQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFK 863
           ++GG +              ++ Q L KLR +  + + +    +    + +L+  +NN  
Sbjct: 665 LSGGSRNNTNNLLINIQTYNESCQTLKKLRYELDDIVSLLRAQEATSQKTKLL--QNNLN 722

Query: 864 FANDTYFEMEQALQ-----RLKDRKPELELEISKCLMDTDISSKE 903
            A       ++AL+     ++  R  EL  EI  C   +DI+S++
Sbjct: 723 LAQHKLHLAQRALEDNSATQIIRRNEELHKEIETC--HSDITSQQ 765

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 120/234 (51%), Gaps = 24/234 (10%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    DK+N      ++ PK+ +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFTN-DDKANSPIGF-ESYPKISVTRQIVLGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 332 DYKS-------SIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEF 378
            ++        ++ K   ++  +  + IE+      +E + N L + K A LEF
Sbjct: 173 MFEDRREKAERTMNKKETKLQEIRTLLIEE------IEPKLNKLRNEKRAFLEF 220

 Score = 68.9 bits (167), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAI 1403
            +QFIV+SL+  MF  A ++     +D  +  +A+
Sbjct: 1137 SQFIVVSLKEGMFTNANRVFKTRFQDGTSVVSAM 1170

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 100/188 (53%), Gaps = 11/188 (5%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    DKSN     + + P + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDN-SDKSNAPIGFESS-PTISVTRQVALGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 332 DYKSSIEK 339
            ++   EK
Sbjct: 173 MFEDRREK 180

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1370 AQFIVISLRNNMF 1382
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 74/160 (46%), Gaps = 16/160 (10%)

Query: 682 ISGFYGRLGDLGVIDNEYDIAIS---TASARLDDIVVDSVECGQHCIEYLRKNKLGYARF 738
           + G   RL  L   +N Y  A +    A  RL ++VVD+ +     ++  R  K      
Sbjct: 523 VKGVAARLFHLN--ENNYSSATALQVCAGGRLYNVVVDNEKTASQLLQRGRLRK--RVTI 578

Query: 739 ILLEKL-------RNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQ 791
           I L K+       + L + +  +P NV+   +L+  ++D+   A   +  ++L+ KD + 
Sbjct: 579 IPLNKIMARKLNDKTLNIAKEISPGNVELALNLIGYEEDV-AKAMEFIFGSSLICKDAET 637

Query: 792 ANRVAYGA-TRFRVVTMDGKLIDISGTITGGGKQTAQGLM 830
           A +V +    R R +T+ G + D  GT++GG +     L+
Sbjct: 638 AKKVTFHPQVRTRSITLQGDVYDPEGTLSGGSRNMNSSLL 677

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 101/188 (53%), Gaps = 11/188 (5%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    DKSN     + + P++ +TR+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDN-TDKSNSPIGFNTS-PRISVTRQIVIGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKSTE-------ILSLIEEAAGTK 172

Query: 332 DYKSSIEK 339
            ++   EK
Sbjct: 173 MFEDRKEK 180

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1311 WR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1369
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1370 AQFIVISLRNNMFELAQQL 1388
            AQFIV+SL+  MF  A ++
Sbjct: 1141 AQFIVVSLKEGMFTNANRV 1159

 Score = 36.2 bits (82), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 64/148 (43%), Gaps = 22/148 (14%)

Query: 700 DIAISTASA-------RLDDIVVDSVECGQHCIE--YLRK-------NKLGYARFILLEK 743
           D AI +ASA       RL ++VVD+       +E   LRK       NK+   R  L E 
Sbjct: 539 DNAIESASALQVCAGGRLYNVVVDNETTASQLLEKGRLRKRVTIIPLNKIASRR--LNEN 596

Query: 744 LRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGAT-RF 802
             N    +   P  V    +L+    D    A   +   +L+ KD + A +V +    R 
Sbjct: 597 TVNF--AKQLAPGKVDLALNLIGYS-DELSRAMEFIFGTSLICKDSETAKKVTFHQNIRQ 653

Query: 803 RVVTMDGKLIDISGTITGGGKQTAQGLM 830
           R +T++G + D  GT++GG +     L+
Sbjct: 654 RSITLEGDVYDPEGTLSGGSRNNKNSLL 681

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 100/188 (53%), Gaps = 11/188 (5%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    D SN     + +  K+ ITR+      SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFNN-SDTSNSPIGFESH-AKISITRQIILGGVSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V +L +   +++++  FLI+QG++  +  MKP+        +L  +E+  GT 
Sbjct: 120 HRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAAGTR 172

Query: 332 DYKSSIEK 339
            ++   EK
Sbjct: 173 MFEDRREK 180

 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 58/86 (67%)

Query: 1297 SEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356
            +EG+   V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEVKVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHT 1123

Query: 1357 SIVANYIKERTKNAQFIVISLRNNMF 1382
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 32.7 bits (73), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 66/150 (44%), Gaps = 17/150 (11%)

Query: 682 ISGFYGRLGDLGVIDNEYDIAISTA-----SARLDDIVVDSVECGQHCIEYLRKNKLGYA 736
           +S   G +G L  +D E +I  S A       RL ++VVD+       +E+ R  K    
Sbjct: 520 VSSVKGVVGQLFTLD-EANIDSSAALQVCAGGRLFNVVVDNERTASQLLEHGRLRK--RV 576

Query: 737 RFILLEKLRN-------LILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDL 789
             I L K+ +       L L +   P  V+   +L+  ++++   A   +   + + +D 
Sbjct: 577 TIIPLNKISSRRINESILHLAKELAPGKVELAINLIGFEEEV-TRAMEFIFGTSFICRDA 635

Query: 790 KQANRVAYGA-TRFRVVTMDGKLIDISGTI 818
           + A ++ +    R R +T+ G + D  GT+
Sbjct: 636 ETAKQITFNPRIRSRSITLQGDVYDPEGTL 665

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 58/188 (30%), Positives = 99/188 (52%), Gaps = 11/188 (5%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 211
           + +L+++ FKSYA   VI  ++  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
            DLI+K      +   SV + F    DKS      + +   + +TR+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDN-SDKSKAPIGFETSLT-ISVTRQIVLGGTSKYLING 119

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEEAAGTK 172

Query: 332 DYKSSIEK 339
            ++   EK
Sbjct: 173 MFEDRREK 180

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 58/82 (70%), Gaps = 1/82 (1%)

Query: 1309 KSWR-NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1367
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1368 KNAQFIVISLRNNMFELAQQLI 1389
            K +QFIV+SL+  MF  A ++ 
Sbjct: 1135 KGSQFIVVSLKEGMFNNANRVF 1156

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 111/238 (46%), Gaps = 28/238 (11%)

Query: 687 GRLGDLGVIDNE-YDIAIS---TASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLE 742
           G    L  ID + YD A +    A  RL ++VVD+       +E  R  K      I L 
Sbjct: 525 GVAARLFTIDKQNYDSATALQVCAGGRLYNVVVDNETTASKLLEKGRLRK--RVTIIPLN 582

Query: 743 KL-------RNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRV 795
           K+         L   +   P  V+   +L+  + ++   A   +  ++L+  D + A ++
Sbjct: 583 KISARTIDNNTLNYAKQLAPGKVELALNLIGYEDEV-AKALQFIFGSSLICNDAETAKKI 641

Query: 796 AYGA-TRFRVVTMDGKLIDISGTITGGGK-QTAQGLMKLRK--KGQENIDIYSNDDIEKI 851
            +    R R +T+DG + D  GT++GG +  T+  L+ ++K  +  E I+ Y N +++ I
Sbjct: 642 TFNPKIRTRSITLDGDVYDPEGTLSGGSRTNTSSILVDIQKYNESTEKINNYQN-ELKSI 700

Query: 852 EKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDISSKELESTQD 909
            K+L E+E+ +K       E++  L  L  +     LEISK    ++ +S+ L+  +D
Sbjct: 701 RKKLSEQEDIYKQTK----ELQNQLSLLNHK-----LEISKRNFGSNPASQVLKRNKD 749

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 66/109 (60%), Gaps = 3/109 (2%)

Query: 1295 PFSEGVTFSVMPPKKS--WRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1352
            P   GV+ SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1353 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSA 1401
             +  + VAN +KE +KNAQFI  + R +M ++A +   + K +NK  S 
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISSV 1206

 Score = 72.0 bits (175), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 96/188 (51%), Gaps = 14/188 (7%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I ++++  FK+Y  E +I  F+ + + ++G NGSGKSN+  ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 211 LSDLIHKSES-FPNLPSCSVDVEFQ----YVVDKSNGSSKIDDNKPKLIITRKAFKNNSS 265
              LIH+  S   ++ SCSV++ F      ++  SN S     N    I  R+       
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFHDPDNRMILASNASIVPRPNNEVFI--RRTVGLKKD 118

Query: 266 KYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLE 325
            Y IN +  + +++ ++L+  G  + +   ++ QG++  +   K K ER      L+ LE
Sbjct: 119 DYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDK-ER------LQLLE 171

Query: 326 DIIGTADY 333
           D++G   +
Sbjct: 172 DVVGAKSF 179

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 62/144 (43%), Gaps = 14/144 (9%)

Query: 686 YGRLGDLGVIDNEYDIAISTASA-RLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKL 744
           +G +G+L     +Y   +      +L  I+VD+ E     ++ L + K G   FI L K+
Sbjct: 542 FGTVGELIKASEKYKNCVEIIGGNQLFHIIVDTEETASLLMQELYRMKGGRVTFIPLNKI 601

Query: 745 RNLILKRIQTPENVKRLFDLVKPDK--DIFIPAFYSVLRNTLVAKDLKQANRVAYG---A 799
            N         +       L+K  K    F  A   +   T+V KDL      +YG   A
Sbjct: 602 YNDPNITYPPADQYSSFTPLIKKLKYESKFEGAMKHIFGKTIVVKDL------SYGLKLA 655

Query: 800 TRFRV--VTMDGKLIDISGTITGG 821
            +F++  +T+DG   D  G +TGG
Sbjct: 656 KKFKLNAITLDGDRADKRGVLTGG 679

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 1292 SLDPFSEGVTFSVM--PPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1349
            S++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1350 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNK 1397
            ALD +  + VA+ IKE ++NAQFI  + R++M E+A +   + K +NK
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKFYRV-KYENK 1202

 Score = 65.9 bits (159), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 88/183 (48%), Gaps = 9/183 (4%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I ++V+  FK+Y  E +I  F+ + + V+G NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFIN 270
              LIH+     ++ S SV++ F     +    S I   +   +  R+        Y +N
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPSHRIILPSGIPPRENDEVFVRRTVGLKKDDYQLN 118

Query: 271 GKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGT 330
            +  + ++V ++L+  G  + +   ++ QG +  +   K + ER      L  LE+++G 
Sbjct: 119 DRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAKDR-ER------LHLLEEVVGA 171

Query: 331 ADY 333
             +
Sbjct: 172 KSF 174

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 127/283 (44%), Gaps = 47/283 (16%)

Query: 580 QENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFD------RG----- 628
           +E  S ++ EI+ L+N L    E K+N E +  +++ + +AI  + D      +G     
Sbjct: 396 EERDSWVEQEIKDLRNKLDNLKEVKQNVELERSEIRNKLAAIDEQIDELTDSIQGPGALA 455

Query: 629 -----ESECANAK----SKIKDMQHVLQTQR--QKVMDA------RSRLATVENKSKVLS 671
                ++E  N K     KI + + + +T++  Q +++A      RS     E  S+ L+
Sbjct: 456 ELNDLDTELNNTKHLYGQKIDERKELWRTEQRLQSLLEATTNDVKRSEGEVTETMSRDLA 515

Query: 672 ----ALHKLQKSGRI--SGFYGRLGDLGVIDNEY-DIAISTASARLDDIVVDSVECGQHC 724
               ++ ++ +  ++     +G LG+L  ++++Y   A       L  IVVD+ E     
Sbjct: 516 NGIKSVKEIAEKLKLPDGCVFGTLGELIKVNDKYKKCAEVVGGNSLFHIVVDTDETASLI 575

Query: 725 IEYLRKNKLGYARFILLEKLRNLILKRIQTPEN----VKRLFDLVKPDKDIFIPAFYSVL 780
           I+ L + K G   F+ L ++ +     I  P N       L   ++ D   F  A   V 
Sbjct: 576 IQELYRMKGGRVTFLPLNRVYS--DPNITYPPNEQASCTPLIKKIRYDAR-FEKAVKQVF 632

Query: 781 RNTLVAKDLKQANRVAYGATRFRV--VTMDGKLIDISGTITGG 821
             T+V +DL    R+   A RFR+  +T+DG   D  G +TGG
Sbjct: 633 GKTIVVRDLSTGARL---AKRFRLNAITLDGDRADKKGALTGG 672

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 60/97 (61%), Gaps = 2/97 (2%)

Query: 1291 DSLDPFSEGVTFSVMPPKKSWRN--IANLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1348
            D+LD    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1115 DTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1174

Query: 1349 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1385
            AALD +  + VAN IKE + +AQFI  + R +M ++A
Sbjct: 1175 AALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVA 1211

 Score = 75.9 bits (185), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 80/369 (21%), Positives = 172/369 (46%), Gaps = 40/369 (10%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I  +++  FK+Y     +  F+ +F+ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFIN 270
              LIH+     ++ S  V++ F    D+   +S I   +  ++  R+       +Y +N
Sbjct: 85  RQGLIHQGTG--SIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVN 142

Query: 271 GKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGT 330
           GK    ++++++ +  G    +   ++ QG +  +   K K ER      L  LED++G 
Sbjct: 143 GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDK-ER------LLLLEDVVGA 195

Query: 331 ADYKSSIEKNTIEVDTLN--------EICIEKENRFEIVEREKNSLESSKNAALEFVKKE 382
             ++  + +++ +++  N        E+  E + R E ++ E+  LE  +      ++++
Sbjct: 196 RSFEIKLRESSKKMEATNRDRAKITSELS-ELKARLEELDEERQELEKYQE-----LERD 249

Query: 383 RRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQM 442
           RR       + Q+ +L + E L     ++  L++EY N     E   +E  K E     +
Sbjct: 250 RR-------IFQF-VLYDRE-LNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANL 300

Query: 443 NKKIVSIKEDMK--------NNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKL 494
            K I +++ ++K         + S+ +E+  +KA LE + +   R++++     A  +K 
Sbjct: 301 TKNISNVEAELKLKESTDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKN 360

Query: 495 LKNYRNEIE 503
           L     EI+
Sbjct: 361 LATVEEEIQ 369

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 66/145 (45%), Gaps = 13/145 (8%)

Query: 684 GFYGRLGDLGVIDNEY-DIAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLE 742
             +G LG+L  ++ +Y   A +     L  +VVD+ E     +  L   K G   FI L 
Sbjct: 558 AVHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLN 617

Query: 743 KL--RNLILKRIQTPENVKR----LFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVA 796
           ++  RN +      PEN +     L   +K DK +F  A   V   T+V +DL   +++A
Sbjct: 618 RISDRNAV----TFPENAQAECTPLLWKIKYDK-VFEKAVRHVFGRTIVVRDLGNGSKLA 672

Query: 797 YGATRFRVVTMDGKLIDISGTITGG 821
             +     VT+DG   D  G ITGG
Sbjct: 673 R-SYNLDAVTLDGDRADNRGVITGG 696

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]
           {ON} Anc_1.295 YJL074C
          Length = 1229

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 153/708 (21%), Positives = 301/708 (42%), Gaps = 72/708 (10%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I ++V+  FK+Y  E +I  F+ + + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFIN 270
              LIH+  S   + S SV++ F     K    S +   +   +  R+        Y +N
Sbjct: 61  RQGLIHQG-SGGAVMSASVEIVFHDPNHKIILPSGVVPRENDEVYIRRTVGLKKDDYQLN 119

Query: 271 GKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGT 330
            +  +  +V ++L+  G  +++   ++ QG++  +   K K ER      L  LED++G 
Sbjct: 120 DRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDK-ER------LNLLEDVVGA 172

Query: 331 ADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRL----- 385
             ++  ++ +  ++D       E E +   ++ E N L    N+ L+ + +ER+      
Sbjct: 173 KSFELKLKASLKKMD-------ETEQKRNQIDMEMNEL----NSKLKEMNQERKELEKFN 221

Query: 386 TLSKS-KLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNK 444
           +L K+ K+ Q+ +     +L   + ++  L  +Y +     E   +E +K E+   ++ K
Sbjct: 222 SLDKNRKVFQFTLY--DRELNDIITQIENLDGDYNSTVDSSEKYIKELDKRENIISELTK 279

Query: 445 KIVSIKEDMKNNTSK--------KRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLK 496
           K+  I   +K  T+           E+ N   +L+ +IK    + E  ++     K  L+
Sbjct: 280 KLTEIDSSLKIKTTNDLQIAKANNSEILNNLTNLDVQIKDLKLQLETQNEQTNSDKSNLE 339

Query: 497 NYRNEIETLNVDXXXXXXXXXXXXXXXXXXXXXXXXXXXSLKDKTTDISNEIAQHERXXX 556
               EIE+  +                            +LK++  D+  +  ++ R   
Sbjct: 340 LINKEIESRRL----KLSKISPRFQQLTNEESRFKLQSNTLKERQRDLLLKKGRYSRFHT 395

Query: 557 XXXXXXXXXXXXXXVAESQISLLQENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKV 616
                         + + Q SL   N +K K++IEK   D   +  N  ++E + ++  +
Sbjct: 396 AQERNEWIENEIKELNQLQQSL---NDTKTKNKIEK---DEVAERINTIDEEIQELNDSI 449

Query: 617 QFSAISTEFDRGESECANAKSKI--------------KDMQHVLQTQRQKVMDARSRLAT 662
           Q  +I+ E +  ES   + K +               + ++ VLQT    V D+   +  
Sbjct: 450 QGPSINAELEDLESNIDDIKQQYNSSIDQRKELWRNEQKLETVLQTILDNVKDSERAVGE 509

Query: 663 VENKSKV--LSALHKLQKSGRI--SGFYGRLGDLGVIDNEYDIAISTASAR-LDDIVVDS 717
             ++S    L ++ ++ +  ++     +G LG+L  ++++Y           L  ++VD+
Sbjct: 510 TMDRSLANGLKSVKEIAEKLKLPEDSVFGTLGELVSVNSKYKTCAEVIGGNSLFHVIVDT 569

Query: 718 VECGQHCIEYLRKNKLGYARFILLEKLR--NLILKRIQTPENVKRLFDLVKPDK--DIFI 773
            E     ++ L + K G   FI L K+   N I      PE+      L+K  K  + F 
Sbjct: 570 EETASKIMKELYRMKGGRVTFIPLNKVYFDNSI---TFPPEDQSSYTPLIKKIKYDEKFD 626

Query: 774 PAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGG 821
            A   V   T+V KDL    ++A    +   +T+DG   D  G +TGG
Sbjct: 627 KAVKHVFGKTIVVKDLSTGLKLA-KKYKLSAITLDGDRADKRGVLTGG 673

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 63/107 (58%), Gaps = 3/107 (2%)

Query: 1293 LDPFSEGVTFSVMPPKKS--WRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1350
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1351 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNK 1397
            LD +  + VA  I++ + NAQFI  + R +M E+A     + K +NK
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRV-KYENK 1204

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 75/123 (60%), Gaps = 4/123 (3%)

Query: 1291 DSLDPFSEGVTFSVMPPKKSWRN--IANLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1348
            DS++    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1092 DSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1151

Query: 1349 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNK-TKSAAIRNKD 1407
            AALD +  + VAN IKE + +AQFI  + R++M ++A     + + DNK ++ +A+  +D
Sbjct: 1152 AALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVADSFYRV-RFDNKISEISAVSQQD 1210

Query: 1408 FLK 1410
             ++
Sbjct: 1211 AIR 1213

 Score = 66.2 bits (160), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 77/369 (20%), Positives = 166/369 (44%), Gaps = 40/369 (10%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I  +V+  FK+Y     +   +  F+ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFIN 270
              LIH+     ++ S  V++ F     +   +S I   +  ++  R+       +Y +N
Sbjct: 61  RQGLIHQGTG--SVMSAYVEIIFHDPSGQMMITSGIPMTEEHIVRVRRTIGLKKDEYSVN 118

Query: 271 GKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGT 330
           GK    ++++++ +  G    +   ++ QG +  +   K + ER      L  LE+++G 
Sbjct: 119 GKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAKDR-ER------LALLEEVVGA 171

Query: 331 ADYKSSIEKNTIEVDTLN--------EICIEKENRFEIVEREKNSLESSKNAALEFVKKE 382
             ++  + ++  +++  N        E+  E   R + +  E+  LE  +      ++++
Sbjct: 172 KSFEIKLRESAKKMEATNRDRTRIDSELA-ELRTRLDELNEERQELEKYQK-----LERD 225

Query: 383 RRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQM 442
           RR       + Q+ +L + E L     ++  L++EY +     E   +E  K E+  + +
Sbjct: 226 RR-------IFQF-VLYDRE-LNEVTSQIESLEDEYNHVLQSSEEFLQELYKREELIENV 276

Query: 443 NKKIVSIKE--------DMKNNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKL 494
            K I +I+         D++   S+ +E+  +KA LE  ++   R+ E   K  +  +  
Sbjct: 277 TKNISNIETELRVKESMDLQQEKSRLQEISKRKADLEVHLEEAKRQAEAHKKQTSVDQNN 336

Query: 495 LKNYRNEIE 503
           LK    EIE
Sbjct: 337 LKTVEEEIE 345

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 65/141 (46%), Gaps = 9/141 (6%)

Query: 686 YGRLGDLGVIDNEYD-IAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKL 744
           +G LG+L  ++ +Y   A +     L  +VVD+ E     +E L   K G   FI L ++
Sbjct: 536 HGPLGELIKVNEKYKACAEAVGGNALLHVVVDTDETASILMEELYNTKAGRVTFIPLNRI 595

Query: 745 RNLILKRIQTPENVKR----LFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGAT 800
            +     +  P+N +     L   +K +K  F  A   V   T+V +D+   +++A  + 
Sbjct: 596 ADS--NPVTFPDNSQAECTPLIWKMKYEKR-FEKAVRHVFGRTIVVRDIGTGSKLA-KSF 651

Query: 801 RFRVVTMDGKLIDISGTITGG 821
               VT+DG   D  G ITGG
Sbjct: 652 NLDAVTLDGDRTDKRGLITGG 672

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 64/106 (60%), Gaps = 3/106 (2%)

Query: 1299 GVTFSVM--PPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356
            GV+ SV     +    ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAALD +  
Sbjct: 1103 GVSISVSFNSRQDEQLHVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAALDKQYR 1162

Query: 1357 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAA 1402
            + VAN IKE + NAQFI  + R++M  +A     + K +NK  + A
Sbjct: 1163 TSVANTIKELSANAQFICTTFRSDMLRVADVFYRV-KYENKISTVA 1207

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 100/213 (46%), Gaps = 22/213 (10%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I ++ +  FK+Y    +I  F+ + + V+G NGSGKSN   ++ FV     N ++++ 
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYVVDKSNG---SSKIDDNKPKLIITRKAFKNNSSKY 267
              LIH+     ++ S  V++ F    D S+G   ++    + P  ++ R+       +Y
Sbjct: 61  RQGLIHQGSG--SVMSAYVEIVF----DNSDGRLLNAAASPSSPDEVVIRRTIGLKKDEY 114

Query: 268 FINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDI 327
            +N K  S  E+  LL+  G    +  +++ QG +  +   K       D   L+ L+++
Sbjct: 115 SLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQLLKEV 167

Query: 328 IGTADYKSSIEKNTIEVDTLNEICIEKENRFEI 360
            G   ++  +       D+LN++     NR +I
Sbjct: 168 TGANSFEKKLR------DSLNKMDATNRNRKKI 194

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 107/254 (42%), Gaps = 24/254 (9%)

Query: 589 EIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAK----SKIKDMQH 644
           E+ + ++DL+ Q      Q ++L D  +Q   I+ E +   SE +  K    +KI + + 
Sbjct: 421 ELSQERSDLQEQLAELDEQAKELND-SIQGPGITAELEDLNSEISQLKQLYTTKIDERKE 479

Query: 645 V------LQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRIS--------GFYGRLG 690
           +      LQT  + +MD   R     N++   S  + L+    IS          YG LG
Sbjct: 480 LWRSEQKLQTILETLMDDVKRSERSVNETMDRSLANGLKAVREISERLKLPENAVYGPLG 539

Query: 691 DLGVIDNEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLR--NL 747
           +L  ++ +Y     T     L  +VVD+ +     ++ L   K G   F+ L +L   N 
Sbjct: 540 ELIKVNEKYKTCAETVGGNSLFHVVVDTEDTAGLLMQELYNVKGGRVTFMPLNRLHADNN 599

Query: 748 ILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTM 807
           +        N   L   +K D+  F  A   V   T+V +DL    ++A    +   +T+
Sbjct: 600 VTYPSNEQSNCTALIKKIKYDEK-FERAVKHVFGKTIVVRDLTLGTKLAR-QYKLNAITL 657

Query: 808 DGKLIDISGTITGG 821
           DG   D  G +TGG
Sbjct: 658 DGDRADKRGVLTGG 671

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 69/116 (59%), Gaps = 3/116 (2%)

Query: 1288 ELIDSLDPFSEGVTFSVMPPKKS--WRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMD 1345
            E+I++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1346 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSA 1401
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   + K +NK  + 
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV-KYENKISTV 1206

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 78/346 (22%), Positives = 167/346 (48%), Gaps = 48/346 (13%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I ++V+  FK+Y  + VI  F+ + + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEF---QYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKY 267
              LIH+  S  ++ S SV++ F   ++ +   +G    ++N    I  R+        Y
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDE--ICIRRTVGLKKDDY 117

Query: 268 FINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDI 327
            +N +  +  +V ++L+  G  + +   ++ QG++ ++   K K ER      L+ LED+
Sbjct: 118 QLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDK-ER------LQLLEDV 170

Query: 328 IGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTL 387
           +G   ++  ++ +  +++       E E +   + +E + L    N+ L+ +++ER+   
Sbjct: 171 VGAKSFEVKLKASLKKME-------ETEQKRARIAKEMDEL----NSKLKEMEQERK--- 216

Query: 388 SKSKLLQYNILKEHEK----------LASTLQKLSVLQEEYQNESTKFENTQRETNKLED 437
              +L +YN L+++ K          L   + ++  L ++Y   +   E   +E +K E+
Sbjct: 217 ---ELEKYNALEKNRKVFQFTLYDRELNDIINQVERLDDDYNVTANSSEQYIKELDKREE 273

Query: 438 NFKQMNKKIVSIKEDMKNNT--------SKKRELQNKKASLEEKIK 475
               ++K +  I   +K  T        S+  EL N+  +L+ +IK
Sbjct: 274 IISNISKNLSEIDSTLKIKTTTDLPQAKSRHSELTNQLTNLQVQIK 319

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 79.0 bits (193), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1293 LDPFSEGVTFSVM--PPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1350
            L+    GV+ SV     K     +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1351 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1385
            LD +  + VAN IK+ +KNAQFI  + R +M  +A
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVA 1189

 Score = 67.0 bits (162), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 91/187 (48%), Gaps = 9/187 (4%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I ++V+  FK+Y  E +I  F+ + + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFIN 270
              LIH+     ++ S SV++ F     +   SS +       +  R+        Y IN
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPDHRIILSSGVIPRPNDEVFVRRTVGLKKDDYQIN 118

Query: 271 GKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGT 330
            +  + +++ ++L+  G  +     ++ QG +  +   K K ER      L  LED+IG 
Sbjct: 119 DRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDK-ER------LLLLEDVIGA 171

Query: 331 ADYKSSI 337
             +++ +
Sbjct: 172 KSFETKL 178

 Score = 35.8 bits (81), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 56/142 (39%), Gaps = 6/142 (4%)

Query: 684 GFYGRLGDLGVIDNEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLE 742
             +G LG+L  +  +Y           L  +VVD+ +     +  L K K G   F+ L 
Sbjct: 534 AVFGTLGELLKVSEKYKTCAEVVGGNSLFHVVVDTDKTASLLMRELYKMKGGRVTFMPLN 593

Query: 743 KLR---NLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGA 799
           +L     +             L   +K D   F  A   V   T+V +DL    ++A  +
Sbjct: 594 RLHEDSGVTFPPQDQSAACTPLLKKIKYDAK-FEKAVKHVFGKTIVVRDLTTGVKMA-KS 651

Query: 800 TRFRVVTMDGKLIDISGTITGG 821
            +   +T+DG   D  G +TGG
Sbjct: 652 YQLNAITLDGDRADNRGVLTGG 673

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 1299 GVTFSVMPPKKSWR--NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356
            GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1099 GVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQYR 1158

Query: 1357 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNK 1397
            + VA  IK  + NAQFI  + R +M ++A +   + K +NK
Sbjct: 1159 TAVAGIIKALSANAQFICTTFRTDMLQVADKFFRV-KYENK 1198

 Score = 69.3 bits (168), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 94/187 (50%), Gaps = 17/187 (9%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I ++++  FK+Y  E VI  F+ + + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEF----QYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSK 266
              LIH+     ++ S SV++ F      ++  S  + + +D     ++ R+        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPDHRIILPSGVAPRSNDE----VLVRRTVGLKKDD 114

Query: 267 YFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLED 326
           Y +N +  +  +V ++L+  G  +++   ++ QG +  +   K K ER      L+ LED
Sbjct: 115 YQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDK-ER------LQLLED 167

Query: 327 IIGTADY 333
           ++G   +
Sbjct: 168 VVGAKSF 174

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 71/148 (47%), Gaps = 14/148 (9%)

Query: 680 GRISGFYGRLGDLGVIDNEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARF 738
           GR+   +G LG+L  ++ +Y +         L  IVVD+ E     I+ L + + G   F
Sbjct: 533 GRV---FGTLGELIKVNEKYKMCAEVVGGNSLFHIVVDTDETASLMIQELYRMRGGRVTF 589

Query: 739 ILLEKLRNLILKRIQTPENVKR-LFDLVKPDKDIFIPAFYSVLRN----TLVAKDLKQAN 793
           + L ++ N     I  P N +     L+K  K  F   F SV++N    T+V +DL   +
Sbjct: 590 MPLNRIYND--PNITYPPNAQSSCTPLIKKIK--FDAQFESVVKNVFGKTIVVRDLAAGS 645

Query: 794 RVAYGATRFRVVTMDGKLIDISGTITGG 821
           ++A    +   +T+DG   D SG +TGG
Sbjct: 646 KIA-KHYKLDAITLDGDRADKSGLLTGG 672

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 3/111 (2%)

Query: 1299 GVTFSVM--PPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356
            GV+ SV     +    ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  
Sbjct: 1092 GVSISVSFNSKRDEQLHVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYR 1151

Query: 1357 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKD 1407
            + VA+ IK  + NAQFI  + R +M ++A +   + K +NK  +    N+D
Sbjct: 1152 TAVADVIKSLSSNAQFICTTFRTDMLQVADKFFRV-KYENKISTVVEINRD 1201

 Score = 72.8 bits (177), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 96/190 (50%), Gaps = 15/190 (7%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I K+++  FK+Y  E +I  F+ +++ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYVVDKSNG---SSKIDDNKPKLIITRKAFKNNSSKY 267
              LIH+     ++ S SV+++F    D  N     S +  N    +  R+        Y
Sbjct: 61  RQGLIHQGSG--SVMSASVEIQF---YDPGNSMILPSGVAVNPDSTVSIRRTVGLKKDDY 115

Query: 268 FINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDI 327
            IN +  + +++ ++++  G  + +   ++ QG +  +   K K ER      L+ LED+
Sbjct: 116 QINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDK-ER------LQILEDV 168

Query: 328 IGTADYKSSI 337
           +G   +++ +
Sbjct: 169 VGAKSFEAKL 178

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 67/140 (47%), Gaps = 9/140 (6%)

Query: 687 GRLGDLGVIDNEYD-IAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLR 745
           G LG+L  +  +Y   A       L +IVVD+ E     ++ L + K G   F+ L ++R
Sbjct: 537 GTLGELIKVSEKYKRCAEVIGGNSLFNIVVDTDETASLIMDELYRMKGGRVTFMPLNRIR 596

Query: 746 NLILKRIQTPENVKRLFDLVKPDK-DI-FIPAFYSVLRNTLVAKDLKQANRVAYGATRFR 803
            +       P +      L+K  K D+ +  A   V   T+V KDL + +++A    RF+
Sbjct: 597 -MDSNFTYPPNDQASCTPLIKKIKFDVRYEKAVMHVFGKTIVVKDLGEGSKLA---KRFK 652

Query: 804 V--VTMDGKLIDISGTITGG 821
           +  +T+DG   D  G +TGG
Sbjct: 653 MNAITLDGDRADKRGELTGG 672

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 65/114 (57%), Gaps = 3/114 (2%)

Query: 1291 DSLDPFSEGVTFSVM--PPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1348
            +S +    G++ SV     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1079 NSTESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1138

Query: 1349 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAA 1402
            AALD +  + VA+ IK  + NAQFI  + R +M ++A +   + K +NK  +  
Sbjct: 1139 AALDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVADKFFRV-KYENKISTVV 1191

 Score = 75.9 bits (185), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 96/187 (51%), Gaps = 9/187 (4%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I+++V+  FK+Y  E VI  F+ N++ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFIN 270
              LIH+     ++ S SV++ F+    +    S +   +   I  R+        Y +N
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFRDPGHRMILPSGVVPRENDEIFIRRTVGLKKDDYQVN 118

Query: 271 GKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGT 330
            +  + ++V ++L+  G  + +   ++ QG +  +   K K ER      L+ LED++G 
Sbjct: 119 DRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDK-ER------LQLLEDVVGA 171

Query: 331 ADYKSSI 337
             ++S +
Sbjct: 172 KSFESKL 178

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 119/273 (43%), Gaps = 29/273 (10%)

Query: 574 SQISLLQENQSKL---KDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGES 630
           S+I  LQE  + L   K  + + +N+++ + +  + Q ++L+D  VQ   +S E +  +S
Sbjct: 404 SEIEDLQEELTNLETTKITLAERRNEIQEELKTYEEQIDELLD-SVQGPGVSAELEDLKS 462

Query: 631 ECANAKSKIKD----------MQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSG 680
           E  + KS   D           +  LQT  + + D+  R     N+S   S  + +    
Sbjct: 463 EIESLKSSYADKFDERKELWRTEQKLQTVLENMADSVKRSERAVNESMSRSLANGIASVK 522

Query: 681 RIS--------GFYGRLGDLGVIDNEYD-IAISTASARLDDIVVDSVECGQHCIEYLRKN 731
            I+          +G LG+L  +  +Y   A       L ++VVD+ E     +  L   
Sbjct: 523 EITEKLNLPDDAVFGTLGELIKVSEKYKRCAEVIGGNSLFNVVVDTEETATIIMNELYHM 582

Query: 732 KLGYARFILLEKLRNLILKRIQTPENVK-RLFDLVKPDK-DI-FIPAFYSVLRNTLVAKD 788
           K G   F+ L ++   +   I  P N +     L+K  K D+ +  A   +   T+V KD
Sbjct: 583 KGGRVTFMPLNRIH--VDNNITYPPNEQASCTPLIKKIKYDVRYEKAVKHIFGRTIVVKD 640

Query: 789 LKQANRVAYGATRFRVVTMDGKLIDISGTITGG 821
           L + +++A    +   VT+DG   D  G +TGG
Sbjct: 641 LLEGSKIA-KKLKLNAVTLDGDRADKMGVLTGG 672

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 77.0 bits (188), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 63/110 (57%), Gaps = 3/110 (2%)

Query: 1294 DPFSEGVTFSVMPPKKS--WRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1351
            D    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAAL
Sbjct: 1100 DIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAAL 1159

Query: 1352 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSA 1401
            D +  + VA  IKE +KNAQFI  + R +M ++A +   + K +NK  + 
Sbjct: 1160 DKQYRTAVATLIKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISTV 1208

 Score = 72.8 bits (177), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 153/322 (47%), Gaps = 51/322 (15%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I ++++  FK+Y  E +I  F+ + + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEF----QYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSK 266
              LIH+  S  ++ S SV++ F      ++  S   S+ DD     +  R+        
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 267 YFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLED 326
           Y +N +  +  ++ ++L+  G  +++   ++ QG++  +   K K ER      L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDK-ER------LQLLED 168

Query: 327 IIGTADY----KSSIEKN----------TIEVDTLNEICIEKENRFEIVEREKNSLESSK 372
           ++G   +    K+S++K             E+D LN    E       +E+E+  LE   
Sbjct: 169 VVGAKSFEVKLKASLKKMEETEQKKFQINKEMDELNSKLTE-------MEQERKELE--- 218

Query: 373 NAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRET 432
               ++ + ER     K K+ QY +     +L   + ++  L  +Y N     E   +E 
Sbjct: 219 ----KYNELER-----KRKIYQYTLY--DRELNDVINQMERLDGDYNNTVYSSEQYIQEL 267

Query: 433 NKLEDNFKQMNKKIVSIKEDMK 454
           +K ED  +Q++KK+ +I+  +K
Sbjct: 268 DKREDMIEQVSKKLSNIEASLK 289

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 113/282 (40%), Gaps = 43/282 (15%)

Query: 580 QENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDR--GESECANAKS 637
           +E  + +  EIE+LK+ ++   E     + +   LK Q+S I  E +         + K 
Sbjct: 397 EERDAWIYSEIEELKSSVQNLNEQGNKLQTERASLKEQYSKIDGEIEELIDSVNGPDIKG 456

Query: 638 KIKDMQHVLQTQRQKV---MDARSRLATVENK-----SKVLSALHKLQK----------- 678
           +++D    L   +QK+   +D R  L   E K       +LS +++ Q+           
Sbjct: 457 QLEDFDSELINLKQKLNGSLDTRKELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLA 516

Query: 679 SGRIS-------------GFYGRLGDLGVIDNEYDIAISTASAR-LDDIVVDSVECGQHC 724
           +G I+               +G LG+L  ++++Y           L  +VVD+ E     
Sbjct: 517 NGIINVKEITEKLKISPESVFGTLGELIKVNDKYKACAEVIGGNSLFHVVVDTEETATLI 576

Query: 725 IEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDI-----FIPAFYSV 779
           +  L + K G   FI L +L   +   ++ P N           K I     F  A   V
Sbjct: 577 MNELYRMKGGRVTFIPLNRLS--LDSDVKFPSNTTTQIQFTPLIKKIKYQPRFEKAVKHV 634

Query: 780 LRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGG 821
              T+V KDL Q  ++A    +   +T+DG   D  G +TGG
Sbjct: 635 FGRTIVVKDLGQGLKLA-KKHKLNAITLDGDRADKRGVLTGG 675

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 75.5 bits (184), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 77/145 (53%), Gaps = 5/145 (3%)

Query: 1265 FGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKS--WRNIANLSGGEK 1322
            F  +S    ++++ +   G  EL +      +S GV+  V    K+     I  LSGG+K
Sbjct: 967  FNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSKNDEQLQIEQLSGGQK 1025

Query: 1323 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA-QFIVISLRNNM 1381
            T+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  ++N  QFI+ + R++M
Sbjct: 1026 TVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLSQNGTQFILTTFRSDM 1085

Query: 1382 FELAQQLIGIYKRDNKTKSAAIRNK 1406
             E+A  +I + K  NK  S    NK
Sbjct: 1086 IEIA-DMIYMVKYHNKVSSVYETNK 1109

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 120/285 (42%), Gaps = 41/285 (14%)

Query: 574 SQISLLQENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECA 633
           SQ + ++E    +++EI  L  +L       K  E++ +DL  +F  I+ +     +   
Sbjct: 318 SQFANIEERNEWIQEEINNLNLNLTTLNNTCKGLEDEEMDLTREFDEINQKIQDLNTSIN 377

Query: 634 NAKSKIKDMQHV---LQTQRQKVMDARSRLATVENKSKV-----LSALHKLQKS------ 679
            +   I +++H    L     K +D R  L   ENK        L +++++++S      
Sbjct: 378 ESTITIDEIEHEIKDLNEMYTKEIDKRKELWREENKLDTVLETNLDSINRIERSINENID 437

Query: 680 --------------GRI----SGFYGRLGDLGVIDNEYDIAIS-TASARLDDIVVDSVEC 720
                          ++    +  YG LG+L  +  +Y   +   A   L +I+VD+ E 
Sbjct: 438 YSLSQGISNVKEIVNKLNIPETSIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDET 497

Query: 721 GQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTP----ENVKRLFDLVKPDKDIFIPAF 776
               +  L + + G   FI L ++ N +   I  P     N   L   +K DK  F    
Sbjct: 498 ASQIMNELIRMQNGRVTFIPLNRIENGV--NINYPSNEESNCTALIKKIKYDKK-FEKVI 554

Query: 777 YSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGG 821
            +V   T+V KDL+  NR+     + + +T+DG  ID  G ++GG
Sbjct: 555 RNVFGKTIVVKDLQLGNRLC-KEFKLQAITLDGDRIDSKGVVSGG 598

 Score = 36.6 bits (83), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 115/239 (48%), Gaps = 31/239 (12%)

Query: 267 YFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLED 326
           Y IN +  +  ++ ++L+  G  + +   ++ QG++  +   K K ER      L  LE+
Sbjct: 43  YQINDRNITRGDMIRMLESVGFSMSNPYNIVPQGKIIALTNAKDK-ER------LLLLEE 95

Query: 327 IIGTADYKSSIEKNTIEVD-------TLNEICIEKENRFEIVEREKNSLESSKNAALEFV 379
           ++G   +++ ++ + +++D        +N+   E EN+   +E+EK  LE   N      
Sbjct: 96  VVGAKSFENKLQASLLKMDETEQKRFQINKEMKELENKLNEMEQEKIELEKYNNLE---- 151

Query: 380 KKERRLTLSKSKLLQYNIL-KEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDN 438
                      K++Q+N+  +E   + + ++KL +   EY +     E   +E +K E  
Sbjct: 152 --------KNKKVIQFNLYDRELNDIINQIEKLDI---EYNSILISSEKYLQELDKRELI 200

Query: 439 FKQMNKKIVSIKEDMK-NNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLK 496
            +Q+  K+  I++++K  N S+  EL N K ++ +KI +Y  K ++    I  +K  LK
Sbjct: 201 IEQLKMKLNHIEDELKIKNQSEFEELNNTKDAISQKITNYQIKIKEFENKIKTNKSQLK 259

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 75.5 bits (184), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 3/105 (2%)

Query: 1299 GVTFSVMPPKKS--WRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1357 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSA 1401
            + VA  +KE +KNAQFI  + R +M ++A +   + K +NK  + 
Sbjct: 1166 TAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISTV 1209

 Score = 72.4 bits (176), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 79/317 (24%), Positives = 154/317 (48%), Gaps = 41/317 (12%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I ++++  FK+Y  E +I  F+ + + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEF----QYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSK 266
              LIH+  S  ++ S SV++ F      ++  S   S+ DD     +  R+        
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 267 YFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLED 326
           Y +N +  +  ++ ++L+  G  +++   ++ QG++  +   K K ER      L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDK-ER------LQLLED 168

Query: 327 IIGTADY----KSSIEKNTIEVDTLNEICIEKE-----NRFEIVEREKNSLESSKNAALE 377
           ++G   +    K+S++K  +E     +I I KE     ++   +E+E+  LE  K   LE
Sbjct: 169 VVGAKSFEVKLKASLKK--MEETEQKKIQINKEMGELNSKLSEMEQERKELE--KYNELE 224

Query: 378 FVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLED 437
             +K  + TL       Y+      +L   + ++  L  +Y N     E   +E +K ED
Sbjct: 225 RNRKIYQFTL-------YD-----RELNEVINQMERLDGDYNNTVYSSEQYIQELDKRED 272

Query: 438 NFKQMNKKIVSIKEDMK 454
              Q++KK+ SI+  +K
Sbjct: 273 MIDQVSKKLSSIEASLK 289

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 60/142 (42%), Gaps = 9/142 (6%)

Query: 686 YGRLGDLGVIDNEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKL 744
           +G LG+L  ++++Y           L  IVVD+ E     +  L + K G   FI L +L
Sbjct: 537 FGTLGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRL 596

Query: 745 RNLILKRIQTPENVKRLFDLVKPDKDI-----FIPAFYSVLRNTLVAKDLKQANRVAYGA 799
              +   ++ P N           K I     F  A   V   T+V KDL Q  ++A   
Sbjct: 597 S--LDSDVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLA-KK 653

Query: 800 TRFRVVTMDGKLIDISGTITGG 821
            +   +T+DG   D  G +TGG
Sbjct: 654 HKLNAITLDGDRADKRGVLTGG 675

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 63/109 (57%), Gaps = 4/109 (3%)

Query: 1295 PFSEGVTFSVMPPKKS--WRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1352
            P+ EGV+ SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150

Query: 1353 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSA 1401
             +    VA  I + + NAQFI  + R++M + A +   + K +NK  S 
Sbjct: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRV-KYENKQSSV 1198

 Score = 69.7 bits (169), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 74/333 (22%), Positives = 163/333 (48%), Gaps = 34/333 (10%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I ++++  FK+Y  E +IG F+ + + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEF----QYVVD----KSNGSSKIDDNKPKLIITRKAFKN 262
              LIH+  +  ++ S SV++ F      ++      SNGSS  D+     +  R+    
Sbjct: 61  RQGLIHQG-AGASVMSASVEIVFHDPEHSIIAPTGINSNGSS--DE-----VRIRRTVGL 112

Query: 263 NSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLE 322
               Y +N +  +  ++ ++L+  G  + +   ++ QG + ++   K K ER      L+
Sbjct: 113 KKDDYQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDK-ER------LQ 165

Query: 323 YLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKE 382
            LE+++G   ++  ++ +  ++D   +   +     E +E + N +E  +    ++   E
Sbjct: 166 LLEEVVGAKSFEVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLE 225

Query: 383 RRLTLSKSKLLQYNILKEHEK-LASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQ 441
           R       K+L+Y +   H++ L   + ++  L  +Y +     +    E  K E+  K+
Sbjct: 226 R-----DRKVLRYTL---HDRELQDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKE 277

Query: 442 MNKKIVSIKEDMKNNTSKKRELQNKKASLEEKI 474
           +N++I ++++ +K   +   +L+  KA LEE +
Sbjct: 278 VNEEIKNLQKSLKLKAT--VDLEQAKAILEESL 308

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 62/109 (56%), Gaps = 3/109 (2%)

Query: 1291 DSLDPFSEGVTFSVM--PPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1348
            D+ D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1349 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNK 1397
            AALD +  + VA  IKE +  AQFI  + R++M  +A +   + K +NK
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKFYRV-KYENK 1200

 Score = 67.4 bits (163), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 100/203 (49%), Gaps = 26/203 (12%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I K++++ FK+Y  +  I  F+ + + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYV-------VDKSNGSSKIDDNKPKLIITRKAFKNN 263
              LI++  S  ++ S  V++ F          +  SNG+ +I          R+     
Sbjct: 61  RRSLIYQGTS--SVMSGYVEIVFHDAENRTLLGIPDSNGAIRI----------RRTVGLK 108

Query: 264 SSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEY 323
             +Y IN K SS ++V +LL+  G    +   ++ QG + ++   K + ER      L+ 
Sbjct: 109 KDEYMINNKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAKDR-ER------LQL 161

Query: 324 LEDIIGTADYKSSIEKNTIEVDT 346
           LE+++G   ++  ++++   +D 
Sbjct: 162 LEEVVGAKSFERKLKESLQRMDA 184

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 60/141 (42%), Gaps = 9/141 (6%)

Query: 686 YGRLGDLGVIDNEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKL 744
           +G LG+L  +  +Y           L  +VVD+       ++ L  +K G   F+ L ++
Sbjct: 533 FGPLGELIKVSEKYKTCAEVVGGNSLFHVVVDTENTASLIMQELYNSKGGRVTFMPLNRI 592

Query: 745 RNLILKRIQTPEN----VKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGAT 800
              +   IQ P N       L   +K D   F  A   V   T+V KDL Q +++A    
Sbjct: 593 --YVDPNIQYPSNEEYNCTPLIKKIKFDGK-FEKAVKHVFGKTIVVKDLLQGSKLA-KQF 648

Query: 801 RFRVVTMDGKLIDISGTITGG 821
               VT+DG   D  G +TGG
Sbjct: 649 NLNSVTLDGDKADNKGVLTGG 669

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 3/105 (2%)

Query: 1299 GVTFSVMPPKKS--WRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1357 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSA 1401
            + VA  IKE + NAQFI  + R +M ++A +   + K +NK  + 
Sbjct: 1166 TAVATMIKELSTNAQFICTTFRTDMLQVADKFFRV-KYENKISTV 1209

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 101/197 (51%), Gaps = 20/197 (10%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I ++V+  FK+Y  E +I  F+ + + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEF----QYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSK 266
              LIH+  S  ++ S SV++ F      ++  S   S+ DD     +  R+        
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 267 YFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLED 326
           Y +N +  +  ++ ++L+  G  +++   ++ QG++  +   K K ER      L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDK-ER------LQLLED 168

Query: 327 IIGTADY----KSSIEK 339
           ++G   +    K+S++K
Sbjct: 169 VVGAKSFEVKLKASLKK 185

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 64/111 (57%), Gaps = 3/111 (2%)

Query: 1299 GVTFSVMPPKKS--WRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1357 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKD 1407
            + VA  IKE + +AQFI  + R +M ++A +   + K +NK  +    NK+
Sbjct: 1166 TAVATLIKELSNDAQFICTTFRTDMLQVADKFFRV-KYENKISTVIEVNKE 1215

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 100/197 (50%), Gaps = 20/197 (10%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I ++V+  FK+Y  E +I  F+ + + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEF----QYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSK 266
              LIH+  S  ++ S SV++ F      ++  S   S+ DD     +  R+        
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 267 YFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLED 326
           Y +N +  +  ++ ++L+  G  + +   ++ QG++  +   K K ER      L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDK-ER------LQLLED 168

Query: 327 IIGTADY----KSSIEK 339
           ++G   +    K+S++K
Sbjct: 169 VVGAKSFEVKLKASLKK 185

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 60/142 (42%), Gaps = 9/142 (6%)

Query: 686 YGRLGDLGVIDNEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKL 744
           +G LG+L  ++++Y           L  IVVD+ E     +  L + K G   FI L +L
Sbjct: 537 FGTLGELIKVNDKYKACAEVVGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRL 596

Query: 745 RNLILKRIQTPENVKRLFDLVKPDKDI-----FIPAFYSVLRNTLVAKDLKQANRVAYGA 799
              +   ++ P N           K I     F  A   V   T+V K+L Q  ++A   
Sbjct: 597 --FLDSDVKFPSNTTTQIQFTPLIKKIKYQPRFEKAVKHVFGKTIVVKELGQGLKLA-KK 653

Query: 800 TRFRVVTMDGKLIDISGTITGG 821
            +   +T+DG   D  G +TGG
Sbjct: 654 HKLNAITLDGDRADKRGLLTGG 675

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 72.4 bits (176), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 54/96 (56%), Gaps = 2/96 (2%)

Query: 1292 SLDPFSEGVTFSVM--PPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1349
            S D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1099 SQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1158

Query: 1350 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1385
            ALD +  + VA  +K+ +  AQFI  + R +M  +A
Sbjct: 1159 ALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVA 1194

 Score = 62.8 bits (151), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 99/196 (50%), Gaps = 13/196 (6%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           ++I K+++  FK+Y  +  I  F+ + + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFIN 270
              LI++  S  ++ S  V++ F      +   + +      +I  R+       +Y IN
Sbjct: 61  RRSLIYQGTS--SVMSGYVEIVFH----GAENRTLLGAQDGGVIHIRRTVGLKKDEYMIN 114

Query: 271 GKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGT 330
            K +S ++V +LL+  G    +   ++ QG + ++   + + ER      L+ LE++IG 
Sbjct: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNR-ER------LQLLEEVIGA 167

Query: 331 ADYKSSIEKNTIEVDT 346
             ++  ++++  +++T
Sbjct: 168 KSFERKLKESLQKMET 183

 Score = 40.4 bits (93), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 95/410 (23%), Positives = 170/410 (41%), Gaps = 73/410 (17%)

Query: 686  YGRLGDLGVIDNEYD-IAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKL 744
            +G LG+L  I  +Y   A       L  +VVD+       ++ L  +K G   FI L ++
Sbjct: 532  FGPLGELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRV 591

Query: 745  RNLILKRIQTPEN----VKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGAT 800
               +   I  P N       L   +K D   F  A   V   T+V KDL Q  ++A    
Sbjct: 592  H--VDSNIVYPSNDEHHCTPLIKKIKYDPK-FERAIKHVFGKTIVVKDLNQGTKLA-KQF 647

Query: 801  RFRVVTMDGKLIDISGTITGG----GKQ----TAQGLMKLRKKGQEN------------- 839
            R   +T+DG   D  G +TGG     KQ    + + L  L+K+ Q N             
Sbjct: 648  RLNAITLDGDKADSRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHS 707

Query: 840  IDIYSNDDIEKIEKELVEREN--------NFKF--ANDTYFEMEQALQRLKDRKPELELE 889
            ID   ++  +KI+K +  RE         N K   A    F +E+ + +L  ++ + ++ 
Sbjct: 708  IDQEIDELNDKIKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKIN 767

Query: 890  ISKCLMD-TDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXXXDS 948
              K L D  D+ +++L    D    ++T  ER     +E+ EI               D+
Sbjct: 768  -QKLLQDKLDMYTEDLSRDFDT---ELTLTER-----EELDEIAKKLPDLENLLNTTTDA 818

Query: 949  TKNISEKIDKLKKRI---MEIGGIDLQ------MQNSKVNSIIQNIDIIKSKQKRGISSM 999
              ++  KID LK  +   ++    +L+      M  + + ++ ++ID ++ ++K  +   
Sbjct: 819  LSSVVVKIDSLKAELDSKLKPQAKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERK 878

Query: 1000 KKIENEIRR--------------SEKALSGAELDFKTCSKEMDSFSQEME 1035
              ++NE+++               EK+L  A    +   K++D++ +E E
Sbjct: 879  STVDNEVQKISEIIDTLKSRQEEEEKSLEKANSQQRALLKKLDNYQKEAE 928

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%)

Query: 1314 IANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1373
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1374 VISLRNNMFELA 1385
              + R +M  +A
Sbjct: 1177 CTTFRTDMINVA 1188

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 86/187 (45%), Gaps = 12/187 (6%)

Query: 151 LFINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 210
           + I  ++++ FK+Y    V+  F+ + + VVG NGSGKSN   ++ FV     + ++++ 
Sbjct: 2   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 61

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFIN 270
               I++      + S  V++ F    D  N       N    +  R+       +Y IN
Sbjct: 62  RKGFIYQGAG--QVMSAFVEIIFD---DPENLMLAPLRNDTGEVRIRRTVGLKKDEYMIN 116

Query: 271 GKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGT 330
            K S+  +V ++L+  G    +   ++ QG + ++   K   ER      L  LED++G 
Sbjct: 117 DKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKD-LER------LHLLEDVVGA 169

Query: 331 ADYKSSI 337
             +++ +
Sbjct: 170 KSFENKL 176

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 98/236 (41%), Gaps = 26/236 (11%)

Query: 686 YGRLGDLGVIDNEYDIAISTASAR-LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKL 744
           +G +G+L  + ++Y I         L ++VVD+ E     I+ L   K G   FI L KL
Sbjct: 533 FGPVGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKL 592

Query: 745 RNLILKRIQTPENVKR--LFDLVKPDK-DI-FIPAFYSVLRNTLVAKDLKQANRVAYGAT 800
              +      P N+++     L+K  K D+ F      V   TLV K L     +A    
Sbjct: 593 H--VDTNFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLA-KEY 649

Query: 801 RFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQENIDIYSNDDIEKIEKELVEREN 860
           +   +T+DG   D  G ++GG                  +D Y ++ ++ + ++  + + 
Sbjct: 650 KLNAITLDGDRADSKGVLSGGY-----------------LDQYKSNRLDTL-RDFKQSKR 691

Query: 861 NFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDISSKELESTQDQLKQKIT 916
            +K       E++QALQ ++     L   +     + D     +E  + QLK K++
Sbjct: 692 EYKKIQVELQEIKQALQSIEQEIDGLNNVVKDAAAERDAYEAGIEKARSQLKAKLS 747

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 57.0 bits (136), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 130/275 (47%), Gaps = 39/275 (14%)

Query: 153 INKLVLNNFKSYAGEQVIGPFN--TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           I K+ L NF +Y     +  FN   + + ++GPNGSGKS  + ++      +   + R  
Sbjct: 38  IVKIKLQNFVTYR----LTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAK 93

Query: 210 RLSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKID-----DNKPKLIITRKAFKNNS 264
           R+ D I   E      +  +++  +   D +   S ++       K  L +TR   ++ +
Sbjct: 94  RVDDFIKNGED-----TSRIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGN 148

Query: 265 ---SKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEREG 316
              S YFIN K  +   +  L+K   I LD+    + Q  VE  A++K      +  R  
Sbjct: 149 KCKSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETVRSI 208

Query: 317 DDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAAL 376
           D  LL+ L+D+  + + ++++E         NE+ I K+ RF  +E ++N LE+S  +  
Sbjct: 209 DAQLLQILDDLKSSQNDETTLE---------NEVDI-KQKRFNELETDRNKLEASVRSLK 258

Query: 377 EFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKL 411
           EF   +  + + K KLL Y  +K+H++    LQ+L
Sbjct: 259 EFETMKEDIEIHK-KLLPYVKVKDHKE---NLQRL 289

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1374
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1375 IS 1376
            I+
Sbjct: 1050 IT 1051

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 56.2 bits (134), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/256 (26%), Positives = 117/256 (45%), Gaps = 26/256 (10%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 211
           I K+ L NF +YA  +     + + + ++GPNGSGKS  + ++      R   + R  R+
Sbjct: 48  IIKIRLKNFVTYALTEF--HLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSKRV 105

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNS-SKYFIN 270
            D I   E       C +++  +    K  G + +  +   + ITR   ++   S YFIN
Sbjct: 106 EDFIKNGED-----ECEIEITLKNN-SKIQGIANVLSSDDVIKITRVLIRHRKKSDYFIN 159

Query: 271 GKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEREGDDGLLEYLE 325
            + +S   V  ++ +  I LD+    + Q  VE  A++K      +  R  D  L+  LE
Sbjct: 160 DRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLKSDKLLFETIRSIDTDLITVLE 219

Query: 326 DIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRL 385
           ++      + + EK         E+   K+ R + +  EK  LE+S     EF +K+ +L
Sbjct: 220 ELKELQGEELAEEK---------EVSF-KQQRLQELTAEKERLETSVRVLEEFQRKKDQL 269

Query: 386 TLSKSKLLQYNILKEH 401
            + K KLL Y  +K+H
Sbjct: 270 EIHK-KLLPYVKIKDH 284

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1374
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1375 IS 1376
            I+
Sbjct: 1054 IT 1055

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 56.2 bits (134), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 124/257 (48%), Gaps = 36/257 (14%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 212
           + +L L+NF +Y+  +    F+ + + VVGPNGSGKS ++ ++      R   + + + S
Sbjct: 57  VVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRS 114

Query: 213 DLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNN--SSKYFIN 270
           D   K+ +     S  +DV   ++  +  G++        L ++R   +N+  +S Y+++
Sbjct: 115 DSFIKNGA----DSARIDV---WLAGEDPGTT--------LKVSRVLTRNHKKASLYYVD 159

Query: 271 GKESSYTEVTKLLK-EEGIDLDHKRFLILQGEVENIAQMKP-----KAEREGDDGLLEYL 324
           G E+S   V +L+  +  I LD+    + Q  V+  A+++P     +  R  D  LL+  
Sbjct: 160 GVETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRPDKLLLETVRACDRQLLDCW 219

Query: 325 EDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERR 384
             +       + +++  I +D   E+ +E+E       R +   E +  +AL   +  R+
Sbjct: 220 TQL-------AQLQREHISLD--KEVQLERETS-RTSPRSRQDSEGAV-SALRTYENTRK 268

Query: 385 LTLSKSKLLQYNILKEH 401
             ++ ++LL Y  +KEH
Sbjct: 269 QIMTHNQLLPYAQIKEH 285

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1359
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1003 SGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 96/369 (26%), Positives = 171/369 (46%), Gaps = 36/369 (9%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 211
           I K+ L NF +Y   +     + + + ++GPNGSGKS  + ++      +   + R  R+
Sbjct: 36  IVKMRLENFVTYTLTEF--DLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSKRV 93

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNS-SKYFIN 270
            D I   E        S+++  +    K  G   +D     + ITR+  K+ S S+Y IN
Sbjct: 94  EDFIKNGED-----RGSIEITLKNS-PKVEGMPGVDSEADTIKITRELIKSKSKSRYMIN 147

Query: 271 GKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMK-----PKAEREGDDGLLEYLE 325
            +  S  +V  L+ +  I LD+    + Q  VE  A++K      +  R  D  LL+ LE
Sbjct: 148 DRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLLDVLE 207

Query: 326 DIIGTADYKSSIEKNTIEVDTLNEICIEKENRFE-IVEREKNSLESSKNAALEFVKKERR 384
            +    D ++       E+ +  E+ + K+   E +V++EK S        LE  K E  
Sbjct: 208 LL---KDLQAK------EISSQRELDLNKQKYDELLVQKEKLSESVKAFKELESKKSELE 258

Query: 385 LTLSKSKLLQYNILKEH-EKLASTLQKLSVLQ---EEYQNESTKFENT-QRETNKLEDNF 439
           L L   +LL Y  LK+H EKLA   + L   +   +  + +   F N  Q    +LE   
Sbjct: 259 LHL---QLLPYAKLKDHKEKLADYKRDLDQAKANLKSLRKDKKPFSNAKQNLEERLEILS 315

Query: 440 KQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEK---IKSYTRKKEKASKSIAQSKKLLK 496
            + + K   +KED  +    ++EL++ +  +E+K   I+ Y  + +K  ++ A++++ L+
Sbjct: 316 NKRDLKDKQLKEDQASYRRVEQELESIREEIEKKEQQIEYYRNRTKKLEETAAKTREELE 375

Query: 497 NYRNEIETL 505
           N    +ET+
Sbjct: 376 NKYKLLETI 384

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1372
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1373 IVIS 1376
             +I+
Sbjct: 1039 FLIT 1042

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 129/289 (44%), Gaps = 42/289 (14%)

Query: 155 KLVLNNFKSYA-GEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLS 212
           KL L NF +YA  E  + P   + + ++GPNGSGKS  + ++      +   + R  ++ 
Sbjct: 62  KLKLTNFVTYALTEFHLSP---SLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKVE 118

Query: 213 DLIHKSE-------SFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSS 265
           + I           +  N  S  +  +F  +    N    +   K  L + +K      S
Sbjct: 119 EYIKNGTDEGVIEITLKN-SSALLHSDFNMI----NTDDDVVHVKRVLSMEKK-----KS 168

Query: 266 KYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEREGDDGL 320
           KY+IN K  +   V  +++   I LD+    + Q  VE  A++KP     +  R  + GL
Sbjct: 169 KYYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKPDTLLNETIRSIEAGL 228

Query: 321 LEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVK 380
           LE L ++          E N +++D        KEN+ + +   + +LES  +A   + +
Sbjct: 229 LEKLSELKSL-----QAEGNELQID-----LGAKENKLKELTSSRAALESQAHALELYEE 278

Query: 381 KERRLTLSKSKLLQYNILKEH-EKLASTLQKLSVLQEE---YQNESTKF 425
           K R L + + KLL Y  LKEH EK+     K + L+ E    +NES  F
Sbjct: 279 KARELDIHQ-KLLNYTYLKEHKEKIRGLKDKRNALRNEVKTMENESKPF 326

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 20/128 (15%)

Query: 1268 ISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANL--------SG 1319
            IS     ++  +   G  EL+  DS + +        +  K  +R+ + L        SG
Sbjct: 963  ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNPHVQSG 1015

Query: 1320 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYIKERTKNAQFIV 1374
            GE+ +S++  + AL ++  +P  V+DEI+  +D  N  IV      N   E T     I 
Sbjct: 1016 GERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFLIT 1075

Query: 1375 ISLRNNMF 1382
              L  N+F
Sbjct: 1076 PKLLTNLF 1083

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 52.8 bits (125), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 119/259 (45%), Gaps = 34/259 (13%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 211
           I  L L NF +YA  +     + + + ++GPNGSGKS  + ++      +   + R  ++
Sbjct: 47  IVTLRLENFVTYALTEF--HMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSTKI 104

Query: 212 SDLIHKSESFPNLPSC---SVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNN-SSKY 267
            D I   E    +        + E +YV   S+G++K+         TR   +N  +S+Y
Sbjct: 105 EDYIKNGEDRSVIEVTLKRDPEAEDRYVA--SDGTTKV---------TRVLHRNRKASEY 153

Query: 268 FINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEREGDDGLLE 322
           F+NG+  + + V +L+ E  I LD+    + Q  VE  A++K      +  R  D  ++ 
Sbjct: 154 FLNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLKSDKLLVETARSVDVNMVA 213

Query: 323 YLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKE 382
            LED+      +  +E   +E+         K +R   ++  ++ L +S  A   F KK+
Sbjct: 214 DLEDLKALQG-EELVEAKELEL---------KSSRVLELKATRDKLTASVRALENFKKKK 263

Query: 383 RRLTLSKSKLLQYNILKEH 401
             L + + KLL Y  +K+H
Sbjct: 264 EELGMHE-KLLPYVQVKDH 281

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1374
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1375 IS 1376
            ++
Sbjct: 1049 VT 1050

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 83/362 (22%), Positives = 155/362 (42%), Gaps = 45/362 (12%)

Query: 158 LNNFKSYA-GEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLI 215
           L NF +Y+  E  + P   + + ++GPNGSGKS  + ++      +   + R  R+ D I
Sbjct: 51  LTNFVTYSLAEFHMSP---SLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRVEDFI 107

Query: 216 HKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSK--YFINGKE 273
                     +    +E Q    ++     +   + + I  R        K  Y+ING+ 
Sbjct: 108 KNG-------TAESTIEIQLRNSRNVSGLPMISAEDEAINVRTVLMKARRKCAYYINGEP 160

Query: 274 SSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEREGDDGLLEYLEDII 328
            S  ++  L+    I LD+    + Q  VE  A++K      +  R  D  LL  LE + 
Sbjct: 161 VSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADKLLEQTVRSVDASLLGLLEQLK 220

Query: 329 GTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLS 388
            +   + S+ +   EV+         + + E +   K SLE+   A  E+ +K+  + + 
Sbjct: 221 TSQQEELSLNR---EVEL-------GQKKLEKLMTHKESLENQVRALEEYERKKEEIDIH 270

Query: 389 KSKLLQYNILKEHEK----LASTLQKLSVLQEEYQNESTKF-----------ENTQRETN 433
           K +LL Y  +K H++    L S  +++    +E+  +   F           EN+QR+  
Sbjct: 271 K-RLLPYVRVKNHKRQLKDLKSEYERVKQELKEFLKDKKPFKIASNALLSEVENSQRQKQ 329

Query: 434 KLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKK 493
             E  + Q+     S+ E++    ++  +L+ K      + ++  RK EKA + IA  ++
Sbjct: 330 GKESEYIQVKSTQRSLIEELGKQRTEVEDLKKKVTYYRTRRENIRRKVEKAEQDIASRQQ 389

Query: 494 LL 495
           LL
Sbjct: 390 LL 391

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 13/84 (15%)

Query: 1311 WRNIANL--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR-----NVS 1357
            +R++A L        SGGE+ +S++  + AL  +   P  V+DEI+  +D R     + +
Sbjct: 977  FRDVAELKKLDSHTQSGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKA 1036

Query: 1358 IVANYIKERTKNAQFIVISLRNNM 1381
            +V N   E T     I   L  N+
Sbjct: 1037 MVENACAENTSQYFLITPKLLTNL 1060

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 85/373 (22%), Positives = 161/373 (43%), Gaps = 47/373 (12%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 211
           I KL L NF +Y+  +     + + + ++GPNGSGKS  + ++      +   + R  R+
Sbjct: 69  IVKLRLENFVTYSLTEF--HLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGKRV 126

Query: 212 SDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFING 271
              I   E+        ++V  +    ++     +D       ++R  +    S+Y++N 
Sbjct: 127 DSFIKNGEN-----RGLIEVTLKRDPGRTGSFVAVDGTTK---VSRVLWVGKKSEYYLND 178

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
           +  S   V  L+ E  I LD+    + Q  VE  A++K       D  L+E +       
Sbjct: 179 EPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK------SDKLLMETVR------ 226

Query: 332 DYKSSIEKNTIE----VDTLNEICIEKENRFEI-------VEREKNSLESSKNAALEFVK 380
               S+  N +E    + TL E  I +    E+       +   ++ L SS  A   F +
Sbjct: 227 ----SVNVNLLESFKNLKTLQEEQITEAKELELKTSKLRDLNETRDKLVSSVQALEAFKR 282

Query: 381 KERRLTLSKSKLLQYNILKEHEKLASTLQK--------LSVLQEEYQNESTKFENTQRET 432
           K++ L +++ KLL Y  +K+H++  +  +K        L  L  + +      +    E 
Sbjct: 283 KKQELDINE-KLLPYVKIKDHKRKCAQYKKKYQEARDQLKALITDKEPMRQAQQAIDAEA 341

Query: 433 NKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSK 492
            + +D    +  K   ++ + K    K++EL+ K    + KIK Y ++  K  ++I+  K
Sbjct: 342 AEKQDIKSGLETKFQHLQSEFKVYPKKQQELEEKVREKQGKIKYYEQRTFKVKEAISGIK 401

Query: 493 KLLKNYRNEIETL 505
           + L N RN++ TL
Sbjct: 402 EQLSNERNKLTTL 414

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1374
            SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1375 IS 1376
            ++
Sbjct: 1072 VT 1073

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
           (REAL)
          Length = 1092

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 134/282 (47%), Gaps = 48/282 (17%)

Query: 153 INKLVLNNFKSYAGEQVIGPFN--TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           I K+ L +F +Y     +  FN   + + ++GPNGSGKS  + ++      +   + R  
Sbjct: 42  IIKIRLQDFVTYT----LTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSK 97

Query: 210 RLSDLIHKSE-------SFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKN 262
           ++ D I   +       +  N P    D+EF    D++   ++I        ITR   + 
Sbjct: 98  KVEDFIKNGQDTSRIEITLKNSPKIH-DIEFINTHDETIKVTRI--------ITRSKRR- 147

Query: 263 NSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEREGD 317
             S Y IN ++ S   V  L+ +  I LD+    + Q  VE  A++K      +  R  D
Sbjct: 148 --SDYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSID 205

Query: 318 DGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALE 377
             LL+ L++++     + S++K+ ++V  L  + + +E+     ++ + S+ES +    +
Sbjct: 206 ASLLDVLDELMELQANEQSLQKD-LDVKKLKVVHLRQES-----DKLRKSVESLR----D 255

Query: 378 FVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQ 419
           F KK+  + L  S+LL Y  +K+H+      +KL+  +EEY+
Sbjct: 256 FQKKKGEIELH-SQLLPYVKVKDHK------EKLNTYKEEYE 290

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1374
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1375 IS 1376
            I+
Sbjct: 1047 IT 1048

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 125/277 (45%), Gaps = 48/277 (17%)

Query: 158 LNNFKSYAGEQVIGPFN--TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDL 214
           L +F +Y     +  FN   + + ++GPNGSGKS  + ++      +   + R  R+ D 
Sbjct: 47  LQDFVTYT----LTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDF 102

Query: 215 IHKSE-------SFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKY 267
           I   +       +  N P          V D  N ++  +  K   IITR   +   S Y
Sbjct: 103 IKNGQDVSRIEITLKNSPK---------VNDIENVNAHDETIKITRIITRSKRR---SDY 150

Query: 268 FINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEREGDDGLLE 322
            IN  E S + V  L+ +  I LD+    + Q  VE  A++K      +  R  D  LL+
Sbjct: 151 LINDCEVSESVVKALVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDSSLLD 210

Query: 323 YLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKE 382
            L+++      +  ++K+ ++V         K+++   + +E + L  S  +  +F KK+
Sbjct: 211 VLDELRELQGNEQCLQKD-LDV---------KKSKILHLRQESDKLRKSVESLRDFQKKK 260

Query: 383 RRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQ 419
             + L  S+LL Y  +K+H+      +KL+V +EEY+
Sbjct: 261 GEIELH-SRLLPYVKVKDHK------EKLNVYKEEYE 290

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1374
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1375 IS 1376
            I+
Sbjct: 1047 IT 1048

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 1295 PFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1354
            P  + + +++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1355 NVSIVANYIKERTKN---AQFIVIS 1376
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}
           SMC5Component of the SMC5-SMC6 complex; this complex
           plays a key role in the removal of X-shaped DNA
           structures that arise between sister chromatids during
           DNA replication and repair; binds single-stranded DNA
           and has ATPase activity; S. pombe homolog forms a
           heterodimer with S. pombe Rad18p that is involved in DNA
           repair
          Length = 1093

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 86/365 (23%), Positives = 159/365 (43%), Gaps = 69/365 (18%)

Query: 153 INKLVLNNFKSYAGEQVIGPFN--TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           I K+ L +F +Y     +  FN   + + ++GPNGSGKS  + ++      +   + R  
Sbjct: 42  IIKIRLQDFVTYT----LTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSK 97

Query: 210 RLSDLIHKSE-------SFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKN 262
           ++ D I   +       +  N P+ + D+E+   +D  + + KI       IITR   + 
Sbjct: 98  KVEDFIKNGQDVSKIEITLKNSPNVT-DIEY---IDARDETIKI-----TRIITRSKRR- 147

Query: 263 NSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEREGD 317
             S Y IN  + S + V  L+ +  I LD+    + Q  VE  A++K      +  R  D
Sbjct: 148 --SDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSID 205

Query: 318 DGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALE 377
             LL+ L+++      + S++K+   +D        K+ +   + +E + L  S  +  +
Sbjct: 206 ASLLDVLDELRELQGNEQSLQKD---LDF-------KKAKIVHLRQESDKLRKSVESLRD 255

Query: 378 FVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLED 437
           F  K+  + L  S+LL Y  +K+H+      +KL++ +EEY+                  
Sbjct: 256 FQNKKGEIELH-SQLLPYVKVKDHK------EKLNIYKEEYERAKANLR----------- 297

Query: 438 NFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKN 497
                     +I +D K   + K+ L+N+   L EK    T +  KA + I +  + L  
Sbjct: 298 ----------AILKDKKPFANTKKTLENQVEELTEKCSLKTDEFLKAKEKINEIFEKLNT 347

Query: 498 YRNEI 502
            R+E+
Sbjct: 348 IRDEV 352

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1374
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1375 IS 1376
            I+
Sbjct: 1047 IT 1048

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1119

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 120/278 (43%), Gaps = 46/278 (16%)

Query: 153 INKLVLNNFKSYAGEQVIGPFN--TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           I K+ L NF +Y     +  FN   + + ++GPNGSGKS  + +       +   + R  
Sbjct: 52  IVKIKLENFVTYK----LTEFNLSPSLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSK 107

Query: 210 RLSDLIHKSESFPNLPSCSVDVEFQ-----------------YVVDKSNGSSKIDDNKPK 252
           R+ D I   E    +     +VE                     VD   G  ++D  K  
Sbjct: 108 RVDDYIKNGEDRSKIEIFLKNVESMDKLKNFNNNNNKNNNNGAQVDLKCG--QLDLIKFT 165

Query: 253 LIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-- 310
            II R   K   S Y+IN K  S   V  L+K   I LD+    + Q  VE  A++K   
Sbjct: 166 RIIHRDKKK---SDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVEEFARLKSDK 222

Query: 311 ---KAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVEREKNS 367
              +  R  D  LL+ LE++    + + ++E + +E+         K+ R+  +  E+  
Sbjct: 223 LLVETVRSIDPNLLDILEELKVLQNEEQTVE-DELEI---------KQKRYTELCNERTK 272

Query: 368 LESSKNAALEFVKKERRLTLSKSKLLQYNILKEH-EKL 404
           LE+S  +  EF  K+  +    +KLL Y ++K+H EKL
Sbjct: 273 LEASVQSLKEFENKKLEIEYH-NKLLPYVMIKDHREKL 309

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1374
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1375 IS 1376
            I+
Sbjct: 1074 IT 1075

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 83/183 (45%), Gaps = 27/183 (14%)

Query: 153 INKLVLNNFKSYAGEQVIGPFN--TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           I KL L N  +Y+    I  FN   + + +VGPNGSGKS  + ++      +   + R  
Sbjct: 37  IVKLRLQNVMTYS----ITEFNLSPSLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSK 92

Query: 210 RLSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFI 269
           ++ + I   E+     +  +D   +       G    +  K   I+TR   K   S+Y+I
Sbjct: 93  KIDNFIKNGEN-----TAQIDTFLR-------GHMPNEVIKITRIMTRNKKK---SEYYI 137

Query: 270 NGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEREGDDGLLEYL 324
           +   S+ T V KL  E  I LD+    + Q  VE+ A++K      +  R  +  LLE L
Sbjct: 138 DDSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINPSLLETL 197

Query: 325 EDI 327
           ED+
Sbjct: 198 EDL 200

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1374
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1375 IS 1376
            I+
Sbjct: 1035 IT 1036

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1302 FSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1361
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1362 YIKERTKN---AQFIVIS 1376
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

 Score = 39.3 bits (90), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 152 FINKLVLNNFKSYAG-EQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 209
           +I K+VL NF  +   E  +GP   NF  +VG NGSGKS ++ ++    G RA +  R +
Sbjct: 74  YIKKVVLWNFMCHEHFELELGP-RLNF--IVGNNGSGKSAILTAITVGLGARAMDTNRGN 130

Query: 210 RLSDLI 215
            L DLI
Sbjct: 131 SLKDLI 136

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1369
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1370 -AQFIVIS 1376
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 152 FINKLVLNNFKSYAG-EQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           +I K+ L NF  +   E  +GP   NF  +VG NGSGKS ++ ++    G +A+   R +
Sbjct: 63  YIKKVSLRNFMCHENFELELGP-KLNF--IVGSNGSGKSAILTAITIALGAKASDTNRGN 119

Query: 210 RLSDLI 215
            L +LI
Sbjct: 120 SLKELI 125

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1304 VMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1363
            + P    +R ++  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1364 KERTK---NAQFIVIS 1376
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

 Score = 40.4 bits (93), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 152 FINKLVLNNFKSYAGEQV-IGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           +I KL L+NF  +    V +GP   NF  +VG NGSGKS ++ ++    G +A++  R  
Sbjct: 79  YIKKLTLHNFMCHRNFDVELGP-GLNF--IVGKNGSGKSAILTAITIGLGAKASETNRGS 135

Query: 210 RLSDLI 215
            L DLI
Sbjct: 136 SLKDLI 141

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1369
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1370 -AQFIVIS 1376
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 37.0 bits (84), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 152 FINKLVLNNFKSYAG-EQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           +I K+ L NF  +   E   GP   NF  +VG NGSGKS V+ ++    G +A+   R +
Sbjct: 84  YIKKIKLRNFMCHENFEMEFGP-RLNF--IVGNNGSGKSAVLTAITIGLGAKASDTNRGN 140

Query: 210 RLSDLI 215
            L DLI
Sbjct: 141 SLKDLI 146

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034w SMC5
          Length = 1105

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 80/173 (46%), Gaps = 18/173 (10%)

Query: 153 INKLVLNNFKSYAGEQV-IGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 210
           I K+ L NF +Y   +  + P   + + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 38  IVKIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQ 94

Query: 211 LSDLIHKSESFPNLPSC-----SVDVEF---QYVVDKSNGSSK----IDDNKPKLI-ITR 257
           + D I   +    +        ++D+EF    +   ++NG+ K    I  N  K   I R
Sbjct: 95  VEDFIKNGQDTSKIEIVLKDDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNLEKRTKIGR 154

Query: 258 KAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP 310
              K  + +Y ING  ++ + V  L+ +  I LD+    + Q  VE  A+++P
Sbjct: 155 NLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRP 207

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD-----FRNVSIVANYIKERTKNAQF 1372
            SGGE+ +S++  + AL K+   P  V+DEI+  +D       + ++V N  +E T  +Q+
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQNACEEGT--SQY 1057

Query: 1373 IVIS 1376
             +I+
Sbjct: 1058 FLIT 1061

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 69/159 (43%), Gaps = 16/159 (10%)

Query: 153 INKLVLNNFKSYA-GEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 210
           I K+ L NF +Y+  E  + P   + + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 44  IIKIKLWNFVTYSLAEFTLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSK 100

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFIN 270
           L D I   E         V+V  + V +    +  I      LI T         +Y IN
Sbjct: 101 LEDYIKNGED-----QSVVEVTLKNVPESDFNTDTI------LIKTTINRGKKKPEYAIN 149

Query: 271 GKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMK 309
           G   + T +   +K+  I LD+    + Q  VE  A++K
Sbjct: 150 GSTVTETYIRAFVKKLNIQLDNLCQFLSQERVEEFARLK 188

 Score = 40.4 bits (93), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1374
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1375 IS 1376
            I+
Sbjct: 1044 IT 1045

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 3/67 (4%)

Query: 152 FINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 210
           +I K++L NF  +    V    N NF  +VG NGSGKS ++ +++   G +A++  R   
Sbjct: 72  YIRKVILRNFMCHENFSVELTPNLNF--IVGNNGSGKSAILTAIIVALGVKASETSRGSS 129

Query: 211 LSDLIHK 217
           L +LI K
Sbjct: 130 LKELIRK 136

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1358
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1369
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1370 -AQFIVIS 1376
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 35.8 bits (81), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 152 FINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 210
           +I K++L NF  +  E       +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 87  YIKKVILRNFMCH--EHFELELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 144

Query: 211 LSDLI 215
           L DLI
Sbjct: 145 LKDLI 149

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1369
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1370 -AQFIVIS 1376
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 36.2 bits (82), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 152 FINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 210
           +I K++L NF  +  E       +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCH--EHFELELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 211 LSDLI 215
           L DLI
Sbjct: 139 LKDLI 143

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1369
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1370 -AQFIVIS 1376
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 35.8 bits (81), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 152 FINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 210
           +I K++L NF  +  E       +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 82  YIKKVILRNFMCH--EHFELELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 139

Query: 211 LSDLI 215
           L DLI
Sbjct: 140 LKDLI 144

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1369
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1370 -AQFIVIS 1376
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 35.8 bits (81), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 152 FINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 210
           +I K++L NF  +  E       +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCH--EHFELELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 211 LSDLI 215
           L DLI
Sbjct: 139 LKDLI 143

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1369
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 1008 RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLL 1067

Query: 1370 -AQFIVIS 1376
              Q I+I+
Sbjct: 1068 RTQTIIIT 1075

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 5/66 (7%)

Query: 152 FINKLVLNNFKSYAGEQV-IGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           +I K++L NF  +   ++ +GP   NF  +VG NGSGKS V+ ++    G +A+   R +
Sbjct: 75  YIKKVILRNFMCHEHFELDLGP-RLNF--IVGNNGSGKSAVLTAITIGLGAKASDTNRGN 131

Query: 210 RLSDLI 215
            + DLI
Sbjct: 132 AMKDLI 137

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1374
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1375 IS 1376
            I+
Sbjct: 1047 IT 1048

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1369
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1370 -AQFIVIS 1376
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 152 FINKLVLNNFKSYAG-EQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           +I K+VL NF  +   E  +GP   NF  +VG NGSGKS ++ ++    G +A +  R +
Sbjct: 81  YIKKVVLKNFMCHEHFEMDLGP-KLNF--IVGNNGSGKSAILTAITVGLGAKAAETNRGN 137

Query: 210 RLSDLI 215
            L DLI
Sbjct: 138 SLKDLI 143

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1374
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q+I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQYIL 1054

Query: 1375 IS 1376
            ++
Sbjct: 1055 VT 1056

 Score = 36.6 bits (83), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 84/178 (47%), Gaps = 18/178 (10%)

Query: 153 INKLVLNNFKSYA-GEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDR 210
           I K+ + NF +Y   E  + P   +F+ ++GPNGSGKS V+ ++      + +   R D 
Sbjct: 51  IIKIKMKNFMTYGLVEYQLCP---SFNMIIGPNGSGKSTVVCALGLGLASKLDITGRGDI 107

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRK-AFKNNSSKYFI 269
           ++  I   ++     S  +++  +Y  D+      ++ N+  + I R+ +     S Y I
Sbjct: 108 VTQYIQNGKT-----SGKIEITLKY-SDRIKNVKGVNPNRETVTIKREISIDAKKSNYKI 161

Query: 270 NGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDI 327
           N    +  +V  ++ +  I LD+    + Q  +++ A++K      G+  LLE +  +
Sbjct: 162 NNTVVNEKDVRDIVSKLNIQLDNLCQYLPQERLKDFARLK------GEKLLLETIRAV 213

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1374
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1375 IS 1376
            I+
Sbjct: 1072 IT 1073

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 62/120 (51%), Gaps = 18/120 (15%)

Query: 1268 ISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANL--------SG 1319
            IS   ++++  + +G   E+ L+   D +SE      +  K  +R++A L        SG
Sbjct: 941  ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK----IEIKVKFRDVAELKKLDSHIQSG 993

Query: 1320 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER--TKN-AQFIVIS 1376
            GE+ +S++  + +L ++   P  V+DEI+  +D RN  IV   + E    KN +Q+ +I+
Sbjct: 994  GERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNERIVHKAMVENACAKNTSQYFLIT 1053

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 119/264 (45%), Gaps = 22/264 (8%)

Query: 153 INKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 211
           I KL L NF +Y+  +     + + + ++GPNGSGKS+ + ++      +   + R  ++
Sbjct: 46  IIKLRLVNFVTYSLTEF--HLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRAKKV 103

Query: 212 SDLIHKS--ESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFI 269
            D I     ES   L   +      Y +    GS ++ + K  ++  +K        Y+I
Sbjct: 104 EDFIKNGTEESVIELTVKNSKAVSGYSM--IGGSDEVINIKTVIMKAKK-----KCIYYI 156

Query: 270 NGKESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIG 329
           NG+     +V  L+    I LD+    + Q  VE  A++K       D  L E +  I  
Sbjct: 157 NGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLK------SDKLLEETIRSIDS 210

Query: 330 TADYKSSI--EKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTL 387
           T   K  +  +K   EV    ++ + K    +++ R K SLES   A  E+ +K+  + +
Sbjct: 211 TLVEKLDMLKDKQQEEVTIGRDVELNKSKLEKLIIR-KESLESQVRALEEYERKKNEIDI 269

Query: 388 SKSKLLQYNILKEHEKLASTLQKL 411
            K KLL Y  +K H+   + L+K+
Sbjct: 270 HK-KLLPYVRVKNHKLQLNNLKKV 292

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 1318 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1372
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1373 IVIS 1376
             +I+
Sbjct: 1056 FLIT 1059

 Score = 37.7 bits (86), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 89/380 (23%), Positives = 161/380 (42%), Gaps = 58/380 (15%)

Query: 155 KLVLNNFKSY-AGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLS 212
           KL + NF +Y   E  + P   + + ++GPNGSGKS  + ++      +   + R  +L 
Sbjct: 48  KLRMENFVTYKVAEFDLSP---SLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKLE 104

Query: 213 DLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKN-NSSKYFING 271
           D I   E         V+V  +   +  + S  +  +   + ITR   ++   S Y IN 
Sbjct: 105 DFIKNGEE-----KGLVEVTLKKPAEVEH-SPIVKSHDQVIKITRHLSRSKRDSDYQIND 158

Query: 272 KESSYTEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTA 331
            E   + V  ++ +  I LD+    + Q  V + A   P       + LLE         
Sbjct: 159 IEVPESLVKSIISQLNIQLDNLCQFLSQERVASFAGQSP-------EKLLE--------- 202

Query: 332 DYKSSIEKNTIEV-DTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKER-RLTLSK 389
           +   SI+    EV   L E+  E+ +    V   +  ++S KN        ER R+T+S 
Sbjct: 203 ETARSIDIKLCEVLSLLKELQDEERDHQNKVNSTQKRIDSLKNDC------ERLRITVST 256

Query: 390 SKLLQYNI--LKEHEKLASTLQ------KLSVLQEEYQNESTKFENTQRETNKL------ 435
            +  Q  +  + E++KL   +Q      KL   + EY+   T  +   +E  KL      
Sbjct: 257 FRAYQKKLKEIDEYKKLLPYVQLKGLEEKLRQYRAEYEQAKTNLKTLLQEKRKLFETQKK 316

Query: 436 -EDNFKQMNKKIVSIKEDM----KNNTSKKRELQNKKASLEEKIKSYTRKKEKAS---KS 487
            E   K+ N K+ SIK       +++T   ++L+  +  +  K +   R +EK      +
Sbjct: 317 FESTLKEANNKVHSIKAKFEKLSRDSTRLTKDLKTMRTDIASKKQDIQRYREKIGGLRNN 376

Query: 488 IAQSKKLLKNYRNEIETLNV 507
           +A+ KK L++ R ++ ++ +
Sbjct: 377 VAEKKKELEDKRVQLTSIEI 396

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 39.7 bits (91), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1366
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1367 TKNAQFIVIS 1376
              + Q I+I+
Sbjct: 1057 KSDTQTIIIT 1066

 Score = 36.6 bits (83), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 152 FINKLVLNNFKSYAGEQV-IGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           FI ++ L NF  ++   + +GP   NF  +VG NGSGKS ++ ++    G +A    R  
Sbjct: 63  FIKEIKLTNFMCHSNFSLRLGP-RLNF--IVGNNGSGKSAILTAITIGLGAKATTTNRGT 119

Query: 210 RLSDLI 215
            L DLI
Sbjct: 120 SLKDLI 125

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 39.7 bits (91), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 152 FINKLVLNNFKSYAG-EQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRAN 204
           +I ++ L NF  +   E   GP   NF  +VG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YIKRITLKNFMCHEHFELEFGPM-LNF--IVGSNGSGKSAILTAITIVFGAKAS 111

 Score = 34.7 bits (78), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1369
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I ++  +  
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMIMKKLSSNI 1060

Query: 1370 -AQFIVIS 1376
              Q I+I+
Sbjct: 1061 RTQTIIIT 1068

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 39.3 bits (90), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1309 KSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1368
            K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K
Sbjct: 995  KEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLK 1054

Query: 1369 N---AQFIVIS 1376
            +    Q I+I+
Sbjct: 1055 DDSRTQTIIIT 1065

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 152 FINKLVLNNFKSYAG-EQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           +I K+ L NF  +   E  +GP   NF  +VG NGSGKS ++ ++    G +AN   R +
Sbjct: 70  YIKKIKLVNFMCHEHFELTLGP-RLNF--IVGNNGSGKSAILTAITIGLGAKANSTNRGN 126

Query: 210 RLSDLI 215
            L DLI
Sbjct: 127 SLKDLI 132

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 37/61 (60%), Gaps = 5/61 (8%)

Query: 1317 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1376
            LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  IS
Sbjct: 602  LSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTTIS 656

Query: 1377 L 1377
            +
Sbjct: 657  I 657

>CAGL0K05489g Chr11 (538801..539823) [1023 bp, 340 aa] {ON} similar to
            uniprot|P41834 Saccharomyces cerevisiae YOR075w syntaxin
            of the ER
          Length = 340

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 60/121 (49%), Gaps = 15/121 (12%)

Query: 887  ELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXXX 946
            E+++++ +  T   S+ +E  QD++KQ      + TQ + +V+E EH             
Sbjct: 199  EVDLTESISLTVSQSQPVEHIQDEIKQYEETISQLTQEQLQVLETEHEELINQKNEQL-- 256

Query: 947  DSTKNISEKIDKLKKRIMEIGGID------LQMQNSKVNSIIQNIDIIKSKQKRGISSMK 1000
                   +K+  + K IMEI G+       LQ+Q+  +NS++ N DII++   +G   +K
Sbjct: 257  -------KKVGLINKTIMEIVGVQSELAAHLQVQSQNINSMLDNQDIIETNITKGNKELK 309

Query: 1001 K 1001
            K
Sbjct: 310  K 310

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 152 FINKLVLNNFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRAN 204
           ++ ++ L NF  +  E     F    + +VG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YMKRITLKNFMCH--EHFELEFGPRLNFIVGSNGSGKSAILTAITVVFGAKAS 111

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1363
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 1340 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLIG 1390
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1391 IYKRDNKTKSA 1401
              K+ +  KS 
Sbjct: 999  FIKKVDSCKSC 1009

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12749 Saccharomyces cerevisiae
           YLR383W RHC18 Protein involved in structural maintenance
           of chromosomes required for interchromosomal and sister
           chromatid recombination
          Length = 1111

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 152 FINKLVLNNFKSYAG-EQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           +I K++L NF  +   E  +GP   NF  +VG NGSGKS V+ ++    G +A    R  
Sbjct: 74  YIKKVILKNFMCHEHFELELGP-RLNF--IVGNNGSGKSAVLTAITIGLGAKATDTNRGS 130

Query: 210 RLSDLI 215
            L DLI
Sbjct: 131 SLKDLI 136

 Score = 37.7 bits (86), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1363
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I    I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTIGTKLI 1061

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1296 FSEG-VTFSVMPPKKSW-RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1353
            FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1354 RN----VSIVANYIKERTKNAQFIV 1374
             N      ++ N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

 Score = 37.4 bits (85), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 152 FINKLVLNNFKSYAG-EQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 209
           FI K+ L NF  +   E  +GP   NF  +VG NGSGKS V+ ++    G +A    R  
Sbjct: 69  FIKKVQLRNFMCHEHFELELGP-RLNF--IVGNNGSGKSAVLTAITIGLGAKATDTNRGS 125

Query: 210 RLSDLI 215
            L DLI
Sbjct: 126 SLKDLI 131

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]
           {ON} Anc_4.237 YLR383W
          Length = 1102

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 58/124 (46%), Gaps = 13/124 (10%)

Query: 153 INKLVLNNFKSYAG-EQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 210
           + K++L NF  +   E  +GP   NF  +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 72  LKKVILRNFMCHENFEMELGP-RLNF--IVGNNGSGKSAILTAIAVGLGVKASETNRGVS 128

Query: 211 LSDLIHKSESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFIN 270
           L DLI +        S S  +   Y+ +   GS K D     +II R   ++    + + 
Sbjct: 129 LKDLIREG-------SYSAKITL-YLDNSRIGSYKSDVYGDTIIIERTLKRDGPPSFSLK 180

Query: 271 GKES 274
            KE 
Sbjct: 181 TKEG 184

 Score = 36.6 bits (83), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1312 RNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1369
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1370 -AQFIVIS 1376
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

>Ecym_4041 Chr4 complement(90697..91689) [993 bp, 330 aa] {ON} similar
            to Ashbya gossypii ADR220W
          Length = 330

 Score = 35.4 bits (80), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 56/117 (47%), Gaps = 15/117 (12%)

Query: 901  SKELESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXXXDSTKNISEKIDKLK 960
            S  +E+TQD++KQ      + TQ + +V+E EH                    E++ KL 
Sbjct: 203  SPTIETTQDEIKQYKETMSKLTQEQIQVLETEHEELLNQKSQEL---------ERVQKLS 253

Query: 961  KRIMEIGGID------LQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEK 1011
            K +ME+  +       LQ+Q   +N+++ N D ++   ++G   ++K ++   +S K
Sbjct: 254  KAVMEVASLQNELSTHLQIQTQNINTLLDNNDDVELDIQQGNRQLRKAQDRGGKSAK 310

>NDAI0F01180 Chr6 complement(284217..286136) [1920 bp, 639 aa] {ON}
           Anc_6.289 YMR198W
          Length = 639

 Score = 35.8 bits (81), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 80/184 (43%), Gaps = 52/184 (28%)

Query: 294 RFLILQGEVENIAQMKPKAE-----REGDDGLLEYLEDIIGTA--------DYKSSIEKN 340
           R ++LQ E+  + +MKPK E        D+ L++  + IIG           Y S+++KN
Sbjct: 156 RSMVLQLELNQLEKMKPKEELLKEIAHLDEKLIQLQDQIIGLTMENENKCNQYNSTLQKN 215

Query: 341 TIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKE 400
                          N+F++   E NS++       + + K+R LT  KS LL       
Sbjct: 216 F--------------NKFKL---ENNSID-------DIMVKQRNLTAQKSTLLN------ 245

Query: 401 HEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKK 460
           HE         S L  E Q   T+    + +   +ED+ K++N+K   +K+ + N  S  
Sbjct: 246 HE---------SKLLNEIQLNETEINQYKLQIMVIEDDLKRINEKSKPLKDSLNNKLSYL 296

Query: 461 RELQ 464
            ELQ
Sbjct: 297 HELQ 300

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 35.8 bits (81), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 10/78 (12%)

Query: 1296 FSEGVTFSV----------MPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMD 1345
            FS G+ F+            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +D
Sbjct: 976  FSGGLNFNFSKETLNMLVKTPNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALD 1035

Query: 1346 EIDAALDFRNVSIVANYI 1363
            E D  +D  N  I    I
Sbjct: 1036 EFDVFMDQVNRQIGTKLI 1053

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 152 FINKLVLNNFKSYAG-EQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFR-ANKMRQD 209
           FI ++ L NF  +   E  +GP   NF  +VG NGSGKS V+ ++    G + A+  R  
Sbjct: 68  FIKRVQLRNFMCHEHFELELGP-RLNF--IVGNNGSGKSAVLTAITIGLGAKAADTNRGS 124

Query: 210 RLSDLI 215
            L DLI
Sbjct: 125 SLKDLI 130

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 10/72 (13%)

Query: 1296 FSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1355
            F EGV  +++ P+ +      LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVN-TLVGPRGT-----QLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1356 VSIVANYIKERT 1367
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
            (REAL)
          Length = 1782

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 55/269 (20%), Positives = 118/269 (43%), Gaps = 26/269 (9%)

Query: 849  EKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDISSKELESTQ 908
            E+I KELVE ++ F+  ++   ++ + L+ L +   +L+ +    +   +++  E ++  
Sbjct: 935  EQISKELVEYKSRFQSHDNLVAKLTEKLKSLANNYRDLQAKHESLMQSIEVTKSENDTQL 994

Query: 909  DQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXXXDSTKNISEKIDKLKKRIMEIGG 968
              L+ K     R  ++     E EH             D  K + E I +L+ +  E   
Sbjct: 995  SNLQDKFDSLSREKESFQ--TEKEHLT-----------DDIKELKETISRLEHKNEETTS 1041

Query: 969  IDLQMQN---SKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAELDFKTCSK 1025
                 ++   S++N + + ++   + Q   +  + ++   IR         E+  +TC  
Sbjct: 1042 RYTSAKDDYESQINQLKEQLETATTTQDDNMDKISELSKNIR-------NLEMLLETCKS 1094

Query: 1026 EMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEGTKFKSYEID 1085
                   ++E+ E++L  + E   +L+ E ++LE E  N K++++        F+S E +
Sbjct: 1095 SKHDLQTKLEASEKTLAEMHENEERLKEEKAQLEKEVVNTKKELSTLR---ENFESLEKE 1151

Query: 1086 VKDRLEKLNNLLKHIKRVIKEYDEQLRAL 1114
             KD + ++    K I    KEY+E +  L
Sbjct: 1152 HKDSVTQVGEYEKQITDKAKEYNENISKL 1180

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 5/72 (6%)

Query: 1315 ANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1374
            A LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +      
Sbjct: 588  AQLSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRG-LTT 642

Query: 1375 ISLRNNMFELAQ 1386
            IS+ + +  +A 
Sbjct: 643  ISIAHRISTIAH 654

>NCAS0G02830 Chr7 complement(520473..521126) [654 bp, 217 aa] {ON}
           Anc_2.215 YIL138C
          Length = 217

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 44/81 (54%)

Query: 402 EKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKR 461
           EKL S L++   L EE  N  +  EN  ++ ++LE+  ++ N K+   KE + N   K  
Sbjct: 114 EKLESELEECKRLNEEDSNLKSNNENFTKKIDQLEEELEESNTKLQETKESLNNAELKAE 173

Query: 462 ELQNKKASLEEKIKSYTRKKE 482
           EL+ K  ++EE+   + R+ E
Sbjct: 174 ELERKLKAIEEEKDDWERRNE 194

>ZYRO0A07524g Chr1 (615902..619174) [3273 bp, 1090 aa] {ON} highly
            similar to uniprot|P15436 Saccharomyces cerevisiae
            YDL102W CDC2 Catalytic subunit of DNA polymerase delta
            required for chromosomal DNA replication during mitosis
            and meiosis intragenic recombination repair of double
            strand DNA breaks and DNA replication during nucleotide
            excision repair (NER)
          Length = 1090

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1340 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLIG 1390
            PLYV++   +ID+     N      +SIVA  + E+  NA F+V S++ N   +   L+G
Sbjct: 935  PLYVLEHNMQIDSRYYLTNQLQNPIISIVAPILGEKQANAMFVVKSIKINTGNMKGGLMG 994

Query: 1391 IYKRDNKTKSA 1401
              K+ +  K+ 
Sbjct: 995  FVKKVDSCKNC 1005

>NCAS0A09380 Chr1 (1859233..1862289) [3057 bp, 1018 aa] {ON} Anc_1.282
            YJL084C
          Length = 1018

 Score = 33.1 bits (74), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 33/83 (39%), Gaps = 10/83 (12%)

Query: 1062 CCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTT 1121
            C  L + +N       K K YEI +   +  LN L  H   ++  YD  +    L N  +
Sbjct: 502  CLRLSKMVNN------KRKHYEISIDSPIHVLNKLCSHANTLLPSYDSHM----LCNEES 551

Query: 1122 IFGDEGDNNSINGVDRTSHGGGV 1144
             F D   ++   G D + H   +
Sbjct: 552  AFQDSQTDSQRRGFDTSYHNSNI 574

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score = 32.7 bits (73), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 4/73 (5%)

Query: 1317 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1376
            LSGG+  +  LA+V AL + KP  L V+DE  +ALD R+  I++ ++K    +   +V++
Sbjct: 1197 LSGGQ--VQRLAIVRALLR-KPQ-LLVLDECTSALDARHSFIMSEFVKHHLYHTTTLVVT 1252

Query: 1377 LRNNMFELAQQLI 1389
                M     +++
Sbjct: 1253 HSEQMMRSCHRIL 1265

>SAKL0G00616g Chr7 complement(59495..60487) [993 bp, 330 aa] {ON}
            similar to uniprot|P41834 Saccharomyces cerevisiae
            YOR075W UFE1 t-SNARE that resides on the endoplasmic
            reticulum and mediates retrograde traffic from the Golgi
            complex potential Cdc28p substrate endoplasmic reticulum
            t- SNARE coprecipitates with Sec20p Tip1p. and Sec22p
          Length = 330

 Score = 32.0 bits (71), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 57/123 (46%), Gaps = 15/123 (12%)

Query: 904  LESTQDQLKQKITFYERHTQNKDEVVEIEHXXXXXXXXXXXXXDSTKNISEKIDKLKKRI 963
            +E+TQ+++KQ      + +Q + +V+E EH                    EK+ KL K +
Sbjct: 206  IETTQEEIKQYEETISKLSQEQLQVLETEHEELLNHKNKEL---------EKVQKLTKTV 256

Query: 964  MEIGGID------LQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAE 1017
             EI  +       LQ+Q   +N+++ N D I+   ++G   ++K +    +S + ++   
Sbjct: 257  TEIASLQNELATHLQVQTENINTLLDNHDDIEVDIQQGNKQLRKAQERGGKSARMITYLS 316

Query: 1018 LDF 1020
            + F
Sbjct: 317  ITF 319

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 140,409,572
Number of extensions: 6463871
Number of successful extensions: 47235
Number of sequences better than 10.0: 1877
Number of HSP's gapped: 44431
Number of HSP's successfully gapped: 4363
Length of query: 1415
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1293
Effective length of database: 39,492,147
Effective search space: 51063346071
Effective search space used: 51063346071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)