Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B019608.258ON43943922720.0
NCAS0B049908.258ON42043916290.0
Smik_12.1448.258ON43844115820.0
YLR085C (ARP6)8.258ON43844115740.0
Suva_10.1698.258ON43844215640.0
Skud_12.1538.258ON43844115610.0
KAFR0B027008.258ON42044115120.0
TBLA0H014608.258ON44244914990.0
TDEL0F038508.258ON41944014900.0
Kpol_543.368.258ON42744114860.0
ZYRO0C01738g8.258ON41443914740.0
KLTH0G13772g8.258ON42043914550.0
KNAG0G020108.258ON42443914550.0
SAKL0H17138g8.258ON41944014350.0
CAGL0L12166g8.258ON42143413890.0
Kwal_56.238328.258ON41943913550.0
AGR091W8.258ON41043613450.0
Ecym_43128.258ON41143613440.0
TPHA0A018308.258ON42144213400.0
KLLA0F19063g8.258ON41544213071e-179
NCAS0C037008.23ON3754482651e-24
TBLA0C004408.23ON3754482641e-24
ZYRO0F02772g8.23ON3754482622e-24
TPHA0D002508.23ON3754482622e-24
NDAI0G030408.23ON3754452622e-24
TDEL0C004708.23ON3754452622e-24
CAGL0K12694g8.23ON3754452622e-24
Suva_6.188.23ON3754452622e-24
Smik_6.398.23ON3754452622e-24
YFL039C (ACT1)8.23ON3754452622e-24
KNAG0L002508.23ON3754482623e-24
KAFR0D009408.23ON3754482623e-24
SAKL0B00968g8.23ON3754482587e-24
Kpol_1058.158.23ON3754452587e-24
ABR222W8.23ON3764492571e-23
KLLA0D05357g8.23ON3754382552e-23
Ecym_15208.23ON3764492552e-23
KLTH0G18832g8.23ON3754382509e-23
Skud_6.318.23ON3603812453e-22
Kwal_14.11098.23ON3603742341e-20
ZYRO0B04928g3.161ON3913782059e-17
TBLA0F008703.161ON3913762032e-16
KLTH0F06490g3.161ON3913762012e-16
SAKL0C07370g3.161ON3913762013e-16
KLLA0C03850g3.161ON3914521995e-16
ADR316W3.161ON3913751986e-16
SAKL0E11814g2.117ON3794361978e-16
TDEL0D046103.161ON3913751961e-15
NCAS0C035503.161ON3923741952e-15
YDL029W (ARP2)3.161ON3914551942e-15
NDAI0G029003.161ON3913741933e-15
KLLA0E22925g2.117ON3804311933e-15
Kpol_1023.188.23ON3193521903e-15
Kwal_33.141773.161ON3373091904e-15
Kpol_479.253.161ON3913761915e-15
KNAG0K01130na 1ON3933781916e-15
Suva_4.2203.161ON3913731907e-15
Smik_4.2063.161ON3913731891e-14
CAGL0K01595g3.161ON3913751871e-14
Skud_4.2223.161ON3913731862e-14
Ecym_52373.161ON3913761853e-14
Ecym_63852.117ON3774321834e-14
AFR051W2.117ON4054321836e-14
ZYRO0G05676g2.117ON3814331754e-13
KAFR0C01040na 1ON3373071745e-13
YHR129C (ARP1)2.117ON3843791692e-12
TPHA0I013002.117ON3794301684e-12
TPHA0A009203.161ON3913761675e-12
TDEL0B048102.117ON3734321667e-12
Skud_8.1902.117ON3844361622e-11
NCAS0B071302.117ON3814391613e-11
Suva_15.3262.117ON3843751595e-11
Smik_8.2102.117ON3843791587e-11
TDEL0C041402.248ON7491381599e-11
NDAI0B044602.117ON3813701523e-10
YNL059C (ARP5)2.248ON7551571535e-10
Kwal_23.48482.248ON7451361526e-10
Suva_14.2812.248ON7551591527e-10
KLTH0B05940g2.117ON3834411507e-10
KNAG0I018602.248ON7531521527e-10
ADL253C2.248ON7511401518e-10
Skud_14.2722.248ON7551661482e-09
TBLA0B010702.117ON3834501462e-09
Ecym_32852.248ON7461591472e-09
TPHA0C031602.248ON7551291473e-09
NDAI0D010602.248ON7531381447e-09
KLLA0F03421g2.248ON7471341437e-09
Kwal_33.146422.117ON3833321418e-09
Smik_14.2672.248ON7551571438e-09
SAKL0E08602g2.248ON7471351429e-09
Kpol_1003.162.248ON7491321411e-08
KLLA0B13904g1.514ON4562531401e-08
TBLA0E038602.248ON7591441402e-08
ZYRO0G01936g1.514ON4613311392e-08
TPHA0O010401.514ON4582531392e-08
KNAG0H036502.117ON3874391354e-08
KNAG0B001701.514ON4531741365e-08
TBLA0D036801.514ON4583721356e-08
Kpol_1056.161.514ON4601731348e-08
CAGL0H09042g2.117ON3873731321e-07
KAFR0F005902.117ON3864371302e-07
AFR419C1.514ON4551731312e-07
KAFR0D037001.514ON4493651293e-07
NCAS0A122701.514ON4541731284e-07
TDEL0F004701.514ON4611741284e-07
CAGL0F00517g1.514ON4541731284e-07
Smik_10.3551.514ON4491731266e-07
YJR065C (ARP3)1.514ON4491731267e-07
ZYRO0A01584g2.248ON7481351278e-07
Ecym_31531.514ON4581741258e-07
Skud_10.2891.514ON4491731251e-06
SAKL0D12804g1.514ON4561731241e-06
Kwal_27.99581.514ON4451741231e-06
NDAI0A039701.514ON4621731232e-06
Suva_12.1541.514ON4491731232e-06
KLTH0G09482g2.248ON7451581232e-06
KLTH0C02508g1.514ON4511731195e-06
CAGL0J10054g2.248ON7541321197e-06
KAFR0J011602.248ON7511571081e-04
NDAI0G055801.287ON5152431043e-04
YJL081C (ARP4)1.287ON4892381018e-04
AFR105C1.287ON4793721000.001
Smik_10.1611.287ON489239990.001
Suva_6.1541.287ON489238990.001
Skud_10.1321.287ON488238980.002
TBLA0D053601.287ON596185970.003
Kpol_282.41.287ON501106960.004
Ecym_63301.287ON480105890.022
KLLA0D02288g1.287ON520105880.034
TPHA0I010301.287ON503106860.058
KLTH0H09702g1.287ON481143830.13
Kwal_14.23771.287ON481145820.15
KNAG0B019201.287ON505258820.15
ZYRO0G21428g1.287ON483323820.17
TDEL0D015501.287ON48089820.17
CAGL0M03201g1.287ON493142800.31
SAKL0D05874g1.287ON497105770.60
KAFR0A015601.287ON485165741.3
KLLA0D13354g5.275ON70791732.0
NCAS0G030502.248ON74347722.6
NDAI0A002001.11ON33024713.3
TDEL0D017801.310ON31566703.7
KLTH0F14960g5.477ON775147713.8
KAFR0D010308.50ON730153713.9
Smik_13.4908.839ON732100696.7
SAKL0F13772g7.448ON422291678.7
Skud_8.2225.88ON1169145688.7
NDAI0D025605.94ON129460689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B01960
         (439 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   879   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   632   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   613   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   610   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   607   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   605   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   587   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   582   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   578   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   577   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   572   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   565   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   565   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   557   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   539   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   526   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   522   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   522   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   520   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   508   e-179
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   106   1e-24
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   106   1e-24
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   105   2e-24
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   105   2e-24
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   105   2e-24
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   105   2e-24
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   105   2e-24
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   105   2e-24
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   105   2e-24
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   105   2e-24
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   105   3e-24
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   105   3e-24
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   103   7e-24
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   103   7e-24
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   103   1e-23
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   102   2e-23
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   102   2e-23
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   100   9e-23
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    99   3e-22
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    95   1e-20
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    84   9e-17
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    83   2e-16
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    82   2e-16
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    82   3e-16
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    81   5e-16
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    81   6e-16
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    80   8e-16
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    80   1e-15
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    80   2e-15
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    79   2e-15
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    79   3e-15
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    79   3e-15
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    78   3e-15
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    78   4e-15
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    78   5e-15
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    78   6e-15
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    78   7e-15
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    77   1e-14
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    77   1e-14
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    76   2e-14
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    76   3e-14
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    75   4e-14
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    75   6e-14
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    72   4e-13
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    72   5e-13
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    70   2e-12
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    69   4e-12
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    69   5e-12
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    69   7e-12
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    67   2e-11
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    67   3e-11
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    66   5e-11
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    65   7e-11
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    66   9e-11
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    63   3e-10
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    64   5e-10
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    63   6e-10
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    63   7e-10
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    62   7e-10
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    63   7e-10
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    63   8e-10
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    62   2e-09
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    61   2e-09
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    61   2e-09
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    61   3e-09
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    60   7e-09
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    60   7e-09
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    59   8e-09
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    60   8e-09
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    59   9e-09
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    59   1e-08
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    59   1e-08
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    59   2e-08
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    58   2e-08
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    58   2e-08
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    57   4e-08
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    57   5e-08
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    57   6e-08
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    56   8e-08
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    55   1e-07
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    55   2e-07
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    55   2e-07
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    54   3e-07
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    54   4e-07
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    54   4e-07
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    54   4e-07
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    53   6e-07
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    53   7e-07
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    54   8e-07
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    53   8e-07
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    53   1e-06
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    52   1e-06
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    52   1e-06
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     52   2e-06
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    52   2e-06
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    52   2e-06
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    50   5e-06
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    50   7e-06
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    46   1e-04
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    45   3e-04
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    44   8e-04
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    43   0.001
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    43   0.001
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    43   0.001
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    42   0.002
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    42   0.003
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    42   0.004
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    39   0.022
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    39   0.034
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    38   0.058
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    37   0.13 
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    36   0.15 
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    36   0.15 
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    36   0.17 
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    36   0.17 
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    35   0.31 
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    34   0.60 
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    33   1.3  
KLLA0D13354g Chr4 (1148444..1150567) [2124 bp, 707 aa] {ON} weak...    33   2.0  
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    32   2.6  
NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11         32   3.3  
TDEL0D01780 Chr4 complement(353592..354539) [948 bp, 315 aa] {ON...    32   3.7  
KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} simi...    32   3.8  
KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 a...    32   3.9  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...    31   6.7  
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    30   8.7  
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    31   8.7  
NDAI0D02560 Chr4 (589972..593856) [3885 bp, 1294 aa] {ON} Anc_5....    31   9.0  

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/439 (97%), Positives = 427/439 (97%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180
           EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180

Query: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240
           KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD
Sbjct: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300
           LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE
Sbjct: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300

Query: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
           GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN
Sbjct: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360

Query: 361 FNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEY 420
           FNLPHF            PTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEY
Sbjct: 361 FNLPHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEY 420

Query: 421 YEHGPDWLTKHKFGYQNWL 439
           YEHGPDWLTKHKFGYQNWL
Sbjct: 421 YEHGPDWLTKHKFGYQNWL 439

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/439 (67%), Positives = 357/439 (81%), Gaps = 19/439 (4%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           M+S+P+ +DNGSYEIKFG ++   PYRA+N FA+DKY + YLSNQ+K I++++ VT RRP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           HELGQLTSWELES IWDY L+NPDEF GF+L     KHLI SE CMTLPELSKNMDQV+F
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180
           EEYEFDS +K+  AG+I F   ADD+   +  ISGK  +D          IS D++   +
Sbjct: 121 EEYEFDSYYKSSIAGFIQF---ADDKNTKI--ISGKTEED----------ISLDSVNQVR 165

Query: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240
           +K   +Y DY+LVIDSGFNCTWIIP+IKGVPYYKA+KKLDIGGRFL GLLKETLSFRHYD
Sbjct: 166 EK---EYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYD 222

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300
           +MDET+LVNNIKE CLFVSPTSYFDSFK K ET+VEY+LP+  +++LG+ R+ K+KPLPE
Sbjct: 223 VMDETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD-KTKPLPE 281

Query: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
            +Q +KLYDELFSVPETFFHPEI+RILKPG+VETILESLSM+PE+LRPLLV N+VCTGGN
Sbjct: 282 NTQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGN 341

Query: 361 FNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEY 420
           FNLPHF            PTDW CR SVP KECELF WK+M QFA+T+SY+KTR+++EEY
Sbjct: 342 FNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEY 401

Query: 421 YEHGPDWLTKHKFGYQNWL 439
           YEHG DWLTK++FGYQNW+
Sbjct: 402 YEHGTDWLTKNRFGYQNWI 420

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/441 (63%), Positives = 345/441 (78%), Gaps = 5/441 (1%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           M++ P+V+DNGSYEIKFG S +E+P+RALN  A DK+G++YLSN +K I+++S VT RRP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           HELGQLT WELESCIWDYC +NP EFDGF+L      HL+ SE CMTLPELSK+ DQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180
           EEYEFDSLFK+P A ++PF       K  +  ISGK  D D++    N      N   D 
Sbjct: 121 EEYEFDSLFKSPVAAFVPF---TKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDT 177

Query: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240
           +KF +DY D++LVIDSGFNCTWIIP++KG+PYYKA+KKLD+GGRFLTGLLKETLSFRHY+
Sbjct: 178 QKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYN 237

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENK--SKPL 298
           +MDET+LVNNIKEKCLFVSP SYFDSFK K++ ++EY+LPD  +S+LGY R  +  + PL
Sbjct: 238 MMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPL 297

Query: 299 PEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTG 358
            E +Q + L DELF++PETFFHPEI++I KPGIVE ILESLSM+PEI+RPL+V NIVCTG
Sbjct: 298 AEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357

Query: 359 GNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKE 418
           GNFNLP+F            PTDWTC +SVP+ +C LF W+ M QF++T SY+  R+++E
Sbjct: 358 GNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTRE 417

Query: 419 EYYEHGPDWLTKHKFGYQNWL 439
           EYYEHG DW TKH+FGYQNW+
Sbjct: 418 EYYEHGSDWCTKHRFGYQNWI 438

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/441 (63%), Positives = 353/441 (80%), Gaps = 5/441 (1%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           M++ P+V+DNGSYEIKFG S +++P+RALN  A DK+G++YLSN +K I+++S +T RRP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           HELGQLT WELESCIWDYCL+NP EFDGF+L      HL+ SE CMTLPELSK+ DQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180
           EEYEFDSLFK+P A ++PF       K  + TISGK  D D++  + + T ST +   + 
Sbjct: 121 EEYEFDSLFKSPVAVFVPF---TKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNA 177

Query: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240
           +   +DY D++LVIDSGFNCTWIIP++KG+PYYKA+KKLDIGGRFLTGLLKETLSFRHY+
Sbjct: 178 QDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYN 237

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSK--PL 298
           +MDET+LVNNIKE+CLFVSP SYFDSFK K++ ++EY+LPD  +S+LGY R  + +  PL
Sbjct: 238 MMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPL 297

Query: 299 PEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTG 358
           PE +Q++ L DELF++PETFFHPEIS+I KPGIVE ILESLSM+PEI+RPL+V NIVCTG
Sbjct: 298 PEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357

Query: 359 GNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKE 418
           GNFNLP+F            PTDWTC +SVP+ +C LF W+ M QFA TDSY+K R+++E
Sbjct: 358 GNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTRE 417

Query: 419 EYYEHGPDWLTKHKFGYQNWL 439
           EYYEHGPDW TKH+FGYQNW+
Sbjct: 418 EYYEHGPDWCTKHRFGYQNWI 438

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/442 (63%), Positives = 351/442 (79%), Gaps = 7/442 (1%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           M++ P+V+DNGSYEIKFG S ++ P+RALN  A DK+G++YLSN +K I+++S VT RRP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           HELGQLT WELESCIWDYCL+NP EFDGF+L      HL+ SE CMTLPELSK+ DQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDM-IGQSENVTISTDNLKDD 179
           EEYEFDSLFK+P A ++PF       K  + TISGK  D D+ I  S++ T ++    D+
Sbjct: 121 EEYEFDSLFKSPVAVFVPF---TKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDE 177

Query: 180 KKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHY 239
               +NDY D++LVIDSGF+CTWIIP++KG+PYYKA+KKLDIGGRFLTGLLKETLSFRHY
Sbjct: 178 TNS-NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY 236

Query: 240 DLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRE--NKSKP 297
           ++MDET+LVNNIKEKCLFVSPTSYFDSFK+K +  +EY+LPD  +S++GY R    +  P
Sbjct: 237 NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSP 296

Query: 298 LPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCT 357
           LP  +Q + L DELF++PETFFHPEIS+I+KPGIVE ILESLSM+PEI+RPL++ NIVCT
Sbjct: 297 LPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCT 356

Query: 358 GGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISK 417
           GGNFNLP+F            PTDWTC +SVP+ +C LF W+ M QFA T+SY++ R+++
Sbjct: 357 GGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTR 416

Query: 418 EEYYEHGPDWLTKHKFGYQNWL 439
           EEYYEHGPDW TKH+FGYQNW+
Sbjct: 417 EEYYEHGPDWCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/441 (62%), Positives = 344/441 (78%), Gaps = 5/441 (1%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           M+ +P+V+DNGSYEIKF  S +E P+RALN  A DK+G++YLSN +K I+++S +T RRP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           HELGQLT WELESCIWDYC +NP EF GF+L      HL+ SE CMTLPELSK+ DQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180
           EEYEFDSLFK+P A ++PF       K  L TISGK  + D++  +  +T  T       
Sbjct: 121 EEYEFDSLFKSPVAVFVPF---TKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSA 177

Query: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240
           +   +DY D++LVIDSGFNCTWIIP++KG+PYYKA+KKLDIGGRFLTGLLKETLSFRHY+
Sbjct: 178 QNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYN 237

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTR--ENKSKPL 298
           +MDET+LVNN+KEKCLFVSP SYFDSFKAK++ ++EY+LPD  +S++GY R    ++ PL
Sbjct: 238 MMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPL 297

Query: 299 PEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTG 358
           PE +Q + L DELF++PETFFHPEIS+I KPGIVE ILESLSM+PEI+RPL+V NIVCTG
Sbjct: 298 PEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357

Query: 359 GNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKE 418
           GNFNLP+F            PTDWTC +SVP  +C LF W+ M QFA T+SY++ R++++
Sbjct: 358 GNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRD 417

Query: 419 EYYEHGPDWLTKHKFGYQNWL 439
           EYYEHGPDW TK +FGYQNW+
Sbjct: 418 EYYEHGPDWCTKQRFGYQNWI 438

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/441 (62%), Positives = 343/441 (77%), Gaps = 23/441 (5%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           M+ TP+V+DNGSY +KFG ++ E PY ALN  A DKY ++YLSNQ+K I+++S V+++RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           H LGQLTSWE+++ IWDYCLYNPDEF+GF +G +  KHLI SE CMTLPEL KNMDQVIF
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180
           EEYEF SL K+P AGY+PF     D+ ++     G+++ +  +      T ST+      
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQIII-----GERDTEPFVE-----TPSTE------ 164

Query: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240
                +Y+D++LV+DSGFNCTWIIP+IKG+PYYKA+KKLDIGGRFL GLLKETLSFRHY+
Sbjct: 165 -----EYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN 219

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTREN--KSKPL 298
           +MDET+LVNNIKEKCLFVSP SYFDSFK K+ TS EY+LPD  +S+LGY R +  + KPL
Sbjct: 220 VMDETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPL 279

Query: 299 PEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTG 358
           PE SQ + L DELF+VPETFFHPEIS+ILKPG+VETILESLSMIPE++RPL+V+NI+C G
Sbjct: 280 PEDSQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIG 339

Query: 359 GNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKE 418
           GNFNLPHF            PTDW CRI++ K   EL  WK+M  FA+TD YK TR+++E
Sbjct: 340 GNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTRE 399

Query: 419 EYYEHGPDWLTKHKFGYQNWL 439
           EYYEHG DW TKH+FGYQNW+
Sbjct: 400 EYYEHGIDWCTKHRFGYQNWV 420

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/449 (59%), Positives = 345/449 (76%), Gaps = 17/449 (3%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           MD  P+V+DNGSYEIKFG+SNS  P+RA+N  A DKY + YLSNQ+K I+++S V  RRP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           +ELGQLTSWELES IWDYC YNP+EFDGF+L  + KKHL++SE C++LPE S+N+D +IF
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGK----------KNDDDMIGQSENVT 170
           EEY + S++K+P AG+IPF     D    + +ISGK          K  + ++    N  
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTKD----VISISGKADDDDDDNNAKFQEQLVTNDLNTY 176

Query: 171 ISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLL 230
           IS++     K   + +Y+D++L+IDSGFNCTWIIP+IKG+PYYKAIKK+DIGGRFLTGLL
Sbjct: 177 ISSEEPSVTK---TAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233

Query: 231 KETLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYT 290
           KETLSFRHY++ DET+LVNNIKEKCLFV+P SY +SFK K +T+VEY+LPD  ++++GY 
Sbjct: 234 KETLSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYI 293

Query: 291 RENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLL 350
           ++N    LP+ +Q++ L DELFSV ET FHPEISRILKPGI+ETI+ESLSM+PE++RPL+
Sbjct: 294 KDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLM 353

Query: 351 VANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSY 410
           V NIVC GGNFNLP+F            PTDWT  + +PK + ELF WK+M QF++TDSY
Sbjct: 354 VNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSY 413

Query: 411 KKTRISKEEYYEHGPDWLTKHKFGYQNWL 439
           +K RI++EEY EHG +W TKH+FGYQNW+
Sbjct: 414 RKARITREEYMEHGVEWCTKHRFGYQNWI 442

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/440 (60%), Positives = 346/440 (78%), Gaps = 22/440 (5%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           M+S PLV+DNGSYE+KFG S + +P+RALN  A DK+G+ YLSNQ+ +I+++S V+ +RP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           HE GQLTSWEL+SC+WDYC +NP+EFDGF+L  S  +HLI SE CMTLPELSKNMDQV+F
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180
           EEYEFDSL KAP +G++PF    ++ KV    ISGK       G SE+ T +++      
Sbjct: 121 EEYEFDSLLKAPISGFMPFSKHTENTKV----ISGK-------GDSESGTSTSE------ 163

Query: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240
              + DY+ +++VIDSGFNCTW++P+IKGVP+YKA+KKLD+GGRF+ GLLKETLSFRHY+
Sbjct: 164 ---TKDYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYN 220

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300
           +MDET+LVNNIKEKCLF+SP SYFDSF  K++T+VEY+LPD  +++LGY  + K+ P  +
Sbjct: 221 VMDETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPP-SK 279

Query: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
            +Q V L DELFSVPETFFHPEI+++LKPGI+ETILESLS++PE LRPL+V+NI+CTGGN
Sbjct: 280 DAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGN 339

Query: 361 FNLPHFXXXXXXXXXXXXPTDWTCRISVPK-KECELFSWKSMCQFANTDSYKKTRISKEE 419
           FNLPHF            PTDW+ +I +P+ K CEL  W SM  FA+TD YK  R+S++E
Sbjct: 340 FNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQE 399

Query: 420 YYEHGPDWLTKHKFGYQNWL 439
           YYEHG +W TK++FGYQNW+
Sbjct: 400 YYEHGVEWTTKNRFGYQNWI 419

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/441 (62%), Positives = 337/441 (76%), Gaps = 16/441 (3%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           M+  P+V+DNGSYE+KFG S+++ P RALN  A DKYG+ YLSNQM  I+++S VT+RRP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           HELGQL SWELE  +WDYC +NPDEF  F L  +   HL+VSE CMTLPELS NMDQV+F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180
           EEYEF+SLFK+P AG++PF    D+ K+    I GK   DD++G          N+  D 
Sbjct: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKM----ICGK--GDDVMGD------LISNM--DS 166

Query: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240
           +   N Y D+ LVIDSGFNCTWIIP+IKGVPYYKA+KK+++GGRFL GL KET+S+RHYD
Sbjct: 167 QNIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYD 226

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKP-LP 299
           + DET+LVNNIKEKCLF+SPTSY DSFK K+  SV+Y+LPD  +S++GY ++ KS   LP
Sbjct: 227 VTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLP 286

Query: 300 EGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGG 359
           E SQV+ L DELFSVPET FHPE++++LKPGIVETILESLS++PE +RPLLV NIVC GG
Sbjct: 287 ENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGG 346

Query: 360 NFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFA-NTDSYKKTRISKE 418
           NFN+P+F            PTDW C I +P+K+CEL  WKSM QFA NTD YKK RIS+E
Sbjct: 347 NFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISRE 406

Query: 419 EYYEHGPDWLTKHKFGYQNWL 439
           EYYEHG DW TK +FGYQNW+
Sbjct: 407 EYYEHGTDWTTKKRFGYQNWI 427

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/439 (60%), Positives = 333/439 (75%), Gaps = 25/439 (5%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           M+S P+V+DNGSYEIKFG  + E P+RA N  A DK+GS YLSNQ+K I+++S V  RRP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           HE GQLTSWELES IWDYC +NPDEF+GF+L  S  +HL+VSE CMT+PELSKNMDQV+F
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180
           EEYEF S+FK+P AG+ PFG  +         ISGK +D                 + ++
Sbjct: 121 EEYEFASMFKSPIAGFAPFGRPS-------IAISGKGDD-----------------QPNR 156

Query: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240
           K   + Y+ ++LVID GFNCTW++P+IKG+PYYKA+KKLDIGGRFL GLLKETLSFRHY+
Sbjct: 157 KAEPDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN 216

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300
           +MDET+LVNNIKE CLFVSP SYF+SFK KE+T+VEY+LPD  +S+LGY ++ K KPLP+
Sbjct: 217 VMDETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPK-KPLPQ 275

Query: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
            SQ V+L DELFSVPETFFHPEI ++LKPGI+ETILESLS++PE LRPL++ NIVCTGGN
Sbjct: 276 DSQTVELKDELFSVPETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGN 335

Query: 361 FNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEY 420
           FNLP+F            PTDWTC + +P    EL+ W SM  F N+  Y   R+++EEY
Sbjct: 336 FNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEY 395

Query: 421 YEHGPDWLTKHKFGYQNWL 439
           +EHG DW T+H+FGYQNW+
Sbjct: 396 FEHGVDWCTRHRFGYQNWM 414

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/439 (59%), Positives = 335/439 (76%), Gaps = 19/439 (4%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           M+  P+V+DNGSYEIKFG ++S  P+ ALN  A DKYG+ +LSNQ++ I+++S VT  RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           H+LGQL SWELES IWDYCL+NPDEFDG+ L  +  KHLI SE CMTLPELSKNMDQV+F
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180
           EEYE+DSLFKAP   ++PF  + D   +L+      K D D+        +++D+  D+K
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILV-----AKEDADV--------VASDHPSDNK 167

Query: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240
                DY+DYELVIDSGFNCTW++P+IKGVPYYKA+KKLDIGGRFL G L+E LSFRHY+
Sbjct: 168 -----DYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYN 222

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300
           +MDET+LVN+IKEKCLF+SP SYFDSF+++ +T+ EY+LPD S+S+ GY R+   + LPE
Sbjct: 223 VMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRK-PGQTLPE 281

Query: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
            SQ + L DELF+VPETFFHPEI+ +L PGI+E ILES+SM+PE LRPLLV N+V TGGN
Sbjct: 282 DSQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGN 341

Query: 361 FNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEY 420
           FN+P+F            PTDW+CR+SVP  +  L+ WK M +F+ T +Y+++R+S+EEY
Sbjct: 342 FNIPNFASRLATELQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAYRESRVSREEY 401

Query: 421 YEHGPDWLTKHKFGYQNWL 439
           YEHG DW T  +FGYQ WL
Sbjct: 402 YEHGVDWCTSKRFGYQAWL 420

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/439 (59%), Positives = 335/439 (76%), Gaps = 21/439 (4%)

Query: 5   PLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRPHELG 64
           P V+DNGSYEIKFG +N   P+RA NG A DKYG++YLSN MK I+++S  T+RRPHELG
Sbjct: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62

Query: 65  QLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLPELSKNMDQVIFEEY 123
           QL SWELE CIWDYCLYNPDEFDGF LG + ++  LI++E C TLPELSKN DQV+FEEY
Sbjct: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122

Query: 124 EFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDKKKF 183
           EF ++FK+P +G++PF             + G KN + + G+  +  ++TD      K  
Sbjct: 123 EFATMFKSPASGFMPFA-----------NLIGNKNMEHLCGK--DTAVNTDYTTATTK-- 167

Query: 184 SNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMD 243
             +Y+D++LVIDSGFNCTW++P+IKGVP+YKAIKK+DIGGRFL GLLKETLSFRHY++MD
Sbjct: 168 --EYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMD 225

Query: 244 ETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGY-TRENKSKPLPEGS 302
           ET+L+NNIKEKCLFVSP SYFDSFK K++ +VEY+LPD  +S+LGY   E+  K +  GS
Sbjct: 226 ETILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGS 285

Query: 303 -QVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNF 361
            Q + L DE F+VPETFFHPE++ ILKPG+VETILE++SM+PE LRP+LV+NIVC GGNF
Sbjct: 286 VQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNF 345

Query: 362 NLPHFXXXXXXXXXXXXPTDWTCRISVP-KKECELFSWKSMCQFANTDSYKKTRISKEEY 420
            LPH             PTDWTCR++VP   +CEL +W +M QF++TD YK TR+++EEY
Sbjct: 346 KLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEY 405

Query: 421 YEHGPDWLTKHKFGYQNWL 439
            EHG DW +KH+F YQNW+
Sbjct: 406 LEHGTDWCSKHRFTYQNWI 424

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/440 (58%), Positives = 333/440 (75%), Gaps = 22/440 (5%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           MD TP+++DNGSYE+KFG + +  P+RALN  A DKYG+ +LSNQ+ +++++S V  RRP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           HELGQLTSWEL+SCIWDYCLYNPDEF+ +E+G +  KHL++SE CM++PELSK  DQV+F
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180
           EEYEF S FK P AG++PF  QA +               +MI   E+     D+  +  
Sbjct: 120 EEYEFGSCFKGPVAGFVPFNWQALEH--------------NMIYAKEDSVYRKDSTGE-- 163

Query: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240
               N+Y D++LVIDSGFNCTW++P++KG+PYYKAIKKLDIGGRFL G LKETLSFRHY+
Sbjct: 164 ---RNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN 220

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300
           +MDET+LVNNIKEKCLF+SP SYF+SF+ KE+T+ EY+LPD  +S+ GY ++ K K +PE
Sbjct: 221 VMDETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQK-IPE 279

Query: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
            SQ +KLYDELFS+PETFFHPEI+ +LKPGIVETILES+SM+PE +RPL+V+N V TGGN
Sbjct: 280 DSQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGN 339

Query: 361 FNLPHFXXXXXXXXXXXXPTDWTCRISVPK-KECELFSWKSMCQFANTDSYKKTRISKEE 419
           FN+ +F            PTDW   +SVP   +  LF W SM QF+ T +Y++TR+++EE
Sbjct: 340 FNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREE 399

Query: 420 YYEHGPDWLTKHKFGYQNWL 439
           YYEHG DW TK +FGYQ WL
Sbjct: 400 YYEHGVDWCTKQRFGYQKWL 419

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/434 (57%), Positives = 325/434 (74%), Gaps = 19/434 (4%)

Query: 6   LVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRPHELGQ 65
           +V+DNGSY++KFGL++  RP  ALN  A DKYG  +LSNQ++ I+++S V  RRPHELGQ
Sbjct: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66

Query: 66  LTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIFEEYEF 125
           LTSWELESCIWDYCLYNPDEF G +      +H+++SE CMTLPELSKN DQV+FEEYE 
Sbjct: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125

Query: 126 DSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDKKKFSN 185
           DSL+KAPTA YIPF    ++ K    TISGK +  ++               ++K +   
Sbjct: 126 DSLYKAPTAAYIPFYTTNENIK----TISGKSDHGELD-------------IEEKIEAGK 168

Query: 186 DYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDET 245
           +Y D+ LVIDSGFNCTW+IP++KGVPYYKA+KKLD+GGRFL GLLKET+SFRHY++MDE+
Sbjct: 169 EYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDES 228

Query: 246 LLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVV 305
           +LVNNIKE+CL+V P SYF++FKAK +  ++++LPD  +S+ GY R+ K+  LP+ +Q++
Sbjct: 229 ILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKT-ALPDNAQIL 287

Query: 306 KLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNLPH 365
            L DE FSVPE FFHPEIS+ LKPGI+ET+LES+ M+PE+LRPL+ +NIVC GGNFNLP 
Sbjct: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347

Query: 366 FXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGP 425
           F            PTDW CR  +   +  L  W +M +FA+TD+YKK R++KE+Y+EHG 
Sbjct: 348 FTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGL 407

Query: 426 DWLTKHKFGYQNWL 439
           DW TK +FGYQNW+
Sbjct: 408 DWTTKERFGYQNWV 421

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/439 (54%), Positives = 328/439 (74%), Gaps = 20/439 (4%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           M+ +PL++DNGSYEIKFG  + + P+RALN  A DKYG+ +LSNQ++ I+++S V   RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           HELGQL SWELE+ IWDYCL+NPD+F+G+ +  +  KHLI SE CMT+PELSKNMDQV+F
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180
           EEYEF+++FKAP   ++PF              +GKK+   ++ + ++    ++      
Sbjct: 121 EEYEFETMFKAPVPVFVPFN-------------TGKKSTHMLVAKEDSEVEESEVAP--- 164

Query: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240
              + +Y D++LVIDSGFNC+WI+P+IKGVPYYKA+KKLDIGGRFL G L+E LSFRHY+
Sbjct: 165 ---AKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYN 221

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300
           +MDET+LVN+IKE CLF+SP +YF+SF+++ +T+ EY+LPD ++S+ GY R+   + LP 
Sbjct: 222 VMDETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRK-PGQVLPA 280

Query: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
            SQ + L DELF+VPETFFHPEI+ +L  GIVETILES+SM+PE +RPL+V NIV TGGN
Sbjct: 281 ESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGN 340

Query: 361 FNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEY 420
           FN+P+F            PTDW+CR+S+PK +  L+ WK M +F+ T+ Y ++R++++EY
Sbjct: 341 FNIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEY 400

Query: 421 YEHGPDWLTKHKFGYQNWL 439
           YEHG DW T  +FGYQ WL
Sbjct: 401 YEHGVDWCTAKRFGYQAWL 419

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/436 (56%), Positives = 315/436 (72%), Gaps = 28/436 (6%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRPHEL 63
            PL+++NGSYEIKFG +N E PYRA N    D+YG  +LSNQM +I+++S   +RRP EL
Sbjct: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62

Query: 64  GQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIFEEY 123
           GQL SWELE  IWDYCL+NPDEF G+EL  S    LI SE CMT+PE+SKNMDQV+FEEY
Sbjct: 63  GQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEY 121

Query: 124 EFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDKKKF 183
           EF S+ K P A ++PF                +  D D++G +  V            + 
Sbjct: 122 EFGSMMKCPVAQFVPFD---------------RARDYDIVGGAGEVV-----------EA 155

Query: 184 SNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMD 243
            + Y +++LV+DSGFNCTW++P+IKGVPYYKA KKLDIGGRFL GLLKET+SFRHY++MD
Sbjct: 156 KSGYNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMD 215

Query: 244 ETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQ 303
           ET+L+NNIKE+C F+ P SYFDSF+ KEET VEYILPD  +S +GY R+ K + +P+ SQ
Sbjct: 216 ETILINNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPK-QAIPKTSQ 274

Query: 304 VVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNL 363
           +++L DELF+VPETFFHPEIS ILKPG+VETILE +SM+PE+LRPLLV+NIV  GGNFN+
Sbjct: 275 ILRLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNI 334

Query: 364 PHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEYYEH 423
            +F            PTDW  R+  PK +  L  WKSM QF+ TDSYK +R+++ EY EH
Sbjct: 335 ANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEH 394

Query: 424 GPDWLTKHKFGYQNWL 439
           G DW TKH+FGY+ W+
Sbjct: 395 GADWCTKHRFGYEQWI 410

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  522 bits (1344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/436 (57%), Positives = 320/436 (73%), Gaps = 27/436 (6%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRPHEL 63
            P+++DNGSYEIKFG S+ + PYRALN  A DKYG  +LSNQMK+I+EVS   +RRP EL
Sbjct: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62

Query: 64  GQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIFEEY 123
           GQL SWELE  IWDYCL+N DEF  ++L  S    LIVSE CM++PE+SK+MDQV+FEEY
Sbjct: 63  GQLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEY 121

Query: 124 EFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDKKKF 183
           EF SL K P A YIPF   AD +                          +D L   +KK 
Sbjct: 122 EFGSLMKCPVAQYIPFDNMADYK-----------------------VYGSDGLPVVRKK- 157

Query: 184 SNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMD 243
            +DY D++LV+DSGFNCTW+IP+IKGVPYYKA+KKLDIGGRFLTGLLKET+SFRHY+LMD
Sbjct: 158 -DDYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMD 216

Query: 244 ETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQ 303
           ET+L NNIKE+C F+ P SYFDSF+ K ET ++Y+LPD  +S +GY R+ K + +PE SQ
Sbjct: 217 ETILANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPK-QAIPEDSQ 275

Query: 304 VVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNL 363
            + L DELF++PETFFHPEI+ ILKPG++ET+LES+SM+PE++RPL+V+NI   GGNFN+
Sbjct: 276 TLNLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNI 335

Query: 364 PHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEYYEH 423
            +F            PTDW+ R+ +PK + EL  WK+M +F+NTDSYK+ R+++ EY EH
Sbjct: 336 SNFASRLATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEH 395

Query: 424 GPDWLTKHKFGYQNWL 439
           G DW TK++FGY+ W+
Sbjct: 396 GVDWCTKYRFGYEQWI 411

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  520 bits (1340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/442 (56%), Positives = 319/442 (72%), Gaps = 24/442 (5%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           M   PL++DNGSYEIKFG SN E P+ ALN  A DKY + YLSNQ+  I+++S V+++RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120
           H+LGQL SWELE  IWDYC YN D+F GFE+    + HL+++E  MTLPELS+N DQV+F
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180
           EEY FDSL+KAP A +IPF ++ DD   +   +SGK               S   L   K
Sbjct: 121 EEYGFDSLYKAPAANFIPF-IKNDDNSFI--RLSGK---------------SKTYLDGSK 162

Query: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240
           +   N+YQD+ LVIDSG+NC+WIIPMIKGVPYYKA+KK+D+GGRFL GLLKET+S+RHYD
Sbjct: 163 E---NNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD 219

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRE-NKSKPLP 299
           + DE++LVNNIKE C+F+SP SY +SFK K  T VEY+LPD  +S++GY R+  K   LP
Sbjct: 220 VTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLP 279

Query: 300 EGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGG 359
           E SQ + L DELFSVPE FFHPE++ +LKPGI+ETILESL ++PE LR L+V NIVCTGG
Sbjct: 280 EHSQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGG 339

Query: 360 NFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFA--NTDSYKKTRISK 417
           NFN+P+F             T+W C +S+PK   EL +WK+M  F   N + YK TR++K
Sbjct: 340 NFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTK 399

Query: 418 EEYYEHGPDWLTKHKFGYQNWL 439
           +EY EHG +W TK +FGYQNWL
Sbjct: 400 QEYNEHGFEWTTKQRFGYQNWL 421

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  508 bits (1307), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 249/442 (56%), Positives = 314/442 (71%), Gaps = 30/442 (6%)

Query: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60
           M    LV+DNGSYEIKFG S  ++P RALN    DKY   +LSNQ KK++++S+  +RRP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKK--HLIVSEPCMTLPELSKNMDQV 118
           HELGQL SWELES +WDYC YN D+F       +  K  HL+VSE  MT+PELSKNMDQV
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120

Query: 119 IFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKD 178
           IFEEY+F S+FK P A YIPF               G+  DD M               +
Sbjct: 121 IFEEYDFKSMFKGPVAQYIPF-------------YQGQYQDDAMTA------------AE 155

Query: 179 DKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRH 238
           DKK  ++ Y+D++LVIDSGFNCTW +P+IKGVPYYKAIKKLDIGGRFLTGLL+ET+SFRH
Sbjct: 156 DKK--TSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213

Query: 239 YDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPL 298
           Y++M+ET+LVNNIKE+C FV P SYF SF  K  T VEY+LPD  +S+LGY ++   + L
Sbjct: 214 YNVMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKL 273

Query: 299 PEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTG 358
            + +Q + L DE+FSVPETFFHPEI++ILKPGIVETILE ++M PE++RPLLVANIVCTG
Sbjct: 274 TDDAQTLLLTDEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTG 333

Query: 359 GNFNLPHFXXXXXXXXXXXXPTDWTCRISVPK-KECELFSWKSMCQFANTDSYKKTRISK 417
           GNFN+P+F            P DW+C++  P+ K+  L  W+SM  FAN+D ++  R+++
Sbjct: 334 GNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTR 393

Query: 418 EEYYEHGPDWLTKHKFGYQNWL 439
           EEY EHG DW TK++FGYQ WL
Sbjct: 394 EEYLEHGLDWCTKNRFGYQQWL 415

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  106 bits (265), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 116/448 (25%), Positives = 183/448 (40%), Gaps = 91/448 (20%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRAL----------NGFAVD-KYGSAYLSNQMK 47
           MDS    LV+DNGS   K G +  + P RA+           G  V      +Y+ ++ +
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  KIQEVSEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCM 106
             + +  +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQS 166
                 + M Q++FE +   + +           +QA    VL    SG+          
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG------- 150

Query: 167 ENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFL 226
                                    +V+DSG   T ++P+  G     AI ++D+ GR L
Sbjct: 151 -------------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDL 185

Query: 227 TGLLKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISS 284
           T  L + LS R Y      E  +V +IKEK  +V+     +   A + +S+E        
Sbjct: 186 TDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIE-------- 237

Query: 285 SYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPE 344
                    KS  LP+G QV+ + +E F  PE  FHP I  +   GI +T   S+     
Sbjct: 238 ---------KSYELPDG-QVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDV 287

Query: 345 ILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQF 404
            +R  L  NIV +GG    P              P+    +I  P  E +   W      
Sbjct: 288 DVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSIL 346

Query: 405 ANTDSYKKTRISKEEYYEHGPDWLTKHK 432
           A+  ++++  ISK+EY E GP  +  HK
Sbjct: 347 ASLTTFQQMWISKQEYDESGPS-IVHHK 373

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 115/448 (25%), Positives = 183/448 (40%), Gaps = 91/448 (20%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRAL----------NGFAVD-KYGSAYLSNQMK 47
           MDS    LV+DNGS   K G +  + P RA+           G  V      +Y+ ++ +
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  KIQEVSEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCM 106
             + +  +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQS 166
                 + M Q++FE +   + +           +QA    VL    SG+          
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG------- 150

Query: 167 ENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFL 226
                                    +V+DSG   T ++P+  G     AI ++D+ GR L
Sbjct: 151 -------------------------IVLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDL 185

Query: 227 TGLLKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISS 284
           T  L + LS R Y      E  +V +IKEK  +V+     +   A + +S+E        
Sbjct: 186 TDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIE-------- 237

Query: 285 SYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPE 344
                    KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+     
Sbjct: 238 ---------KSYELPDG-QVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDV 287

Query: 345 ILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQF 404
            +R  L  NIV +GG    P              P+    +I  P  E +   W      
Sbjct: 288 DVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMEVKIIAP-PERKYSVWIGGSIL 346

Query: 405 ANTDSYKKTRISKEEYYEHGPDWLTKHK 432
           A+  ++++  ISK+EY E GP  +  HK
Sbjct: 347 ASLTTFQQMWISKQEYDESGPS-IVHHK 373

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 115/448 (25%), Positives = 183/448 (40%), Gaps = 91/448 (20%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRAL----------NGFAVD-KYGSAYLSNQMK 47
           MDS    LV+DNGS   K G +  + P RA+           G  V      +Y+ ++ +
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  KIQEVSEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCM 106
             + +  +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQS 166
                 + M Q++FE +   + +           +QA    VL    SG+          
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG------- 150

Query: 167 ENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFL 226
                                    +V+DSG   T ++P+  G     AI ++D+ GR L
Sbjct: 151 -------------------------IVLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDL 185

Query: 227 TGLLKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISS 284
           T  L + LS R Y      E  +V +IKEK  +V+     +   A + +SVE        
Sbjct: 186 TDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSVE-------- 237

Query: 285 SYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPE 344
                    KS  LP+G QV+ + +E F  PE  FHP +  +   G+ +T   S+     
Sbjct: 238 ---------KSYELPDG-QVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDV 287

Query: 345 ILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQF 404
            +R  L  NIV +GG    P              P+    +I  P  E +   W      
Sbjct: 288 DVRKDLYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSIL 346

Query: 405 ANTDSYKKTRISKEEYYEHGPDWLTKHK 432
           A+  ++++  ISK+EY E GP  +  HK
Sbjct: 347 ASLTTFQQMWISKQEYDESGPS-IVHHK 373

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 115/448 (25%), Positives = 183/448 (40%), Gaps = 91/448 (20%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRAL----------NGFAVD-KYGSAYLSNQMK 47
           MDS    LV+DNGS   K G +  + P RA+           G  V      +Y+ ++ +
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  KIQEVSEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCM 106
             + +  +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQS 166
                 + M Q++FE +   + +           +QA    VL    SG+          
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG------- 150

Query: 167 ENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFL 226
                                    +V+DSG   T ++P+  G     AI ++D+ GR L
Sbjct: 151 -------------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDL 185

Query: 227 TGLLKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISS 284
           T  L + LS R Y      E  +V +IKEK  +V+     +   A + +S+E        
Sbjct: 186 TDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIE-------- 237

Query: 285 SYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPE 344
                    KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+     
Sbjct: 238 ---------KSYELPDG-QVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDI 287

Query: 345 ILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQF 404
            +R  L  NIV +GG    P              P+    +I  P  E +   W      
Sbjct: 288 DVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSIL 346

Query: 405 ANTDSYKKTRISKEEYYEHGPDWLTKHK 432
           A+  ++++  ISK+EY E GP  +  HK
Sbjct: 347 ASLTTFQQMWISKQEYDESGPS-IVHHK 373

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 112/445 (25%), Positives = 176/445 (39%), Gaps = 85/445 (19%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSE---- 54
           MDS    LV+DNGS   K G +  + P                +    +K   V +    
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS 60

Query: 55  ----VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLP 109
               +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M   
Sbjct: 61  KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENV 169
              + M Q++FE +   + +           +QA    VL    SG+             
Sbjct: 114 SNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG---------- 150

Query: 170 TISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGL 229
                                 +V+DSG   T ++P+  G     AI ++D+ GR LT  
Sbjct: 151 ----------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDY 188

Query: 230 LKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
           L + LS R Y      E  +V +IKEK  +V+     +   A + +S+E           
Sbjct: 189 LMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSSIE----------- 237

Query: 288 GYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILR 347
                 KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+      +R
Sbjct: 238 ------KSYELPDG-QVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVR 290

Query: 348 PLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANT 407
             L  NIV +GG+   P              P+    +I  P  E +   W      A+ 
Sbjct: 291 KELYGNIVMSGGSTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASL 349

Query: 408 DSYKKTRISKEEYYEHGPDWLTKHK 432
            ++++  ISK+EY E GP  +  HK
Sbjct: 350 TTFQQMWISKQEYDESGPS-IVHHK 373

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 112/445 (25%), Positives = 175/445 (39%), Gaps = 85/445 (19%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSE---- 54
           MDS    LV+DNGS   K G +  + P                +    +K   V +    
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS 60

Query: 55  ----VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLP 109
               +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M   
Sbjct: 61  KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENV 169
              + M Q++FE +   + +           +QA    VL    SG+             
Sbjct: 114 SNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG---------- 150

Query: 170 TISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGL 229
                                 +V+DSG   T ++P+  G     AI ++D+ GR LT  
Sbjct: 151 ----------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDY 188

Query: 230 LKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
           L + LS R Y      E  +V +IKEK  +V+     +   A + +S+E           
Sbjct: 189 LMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIE----------- 237

Query: 288 GYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILR 347
                 KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+      +R
Sbjct: 238 ------KSYELPDG-QVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVR 290

Query: 348 PLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANT 407
             L  NIV +GG    P              P+    +I  P  E +   W      A+ 
Sbjct: 291 KELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASL 349

Query: 408 DSYKKTRISKEEYYEHGPDWLTKHK 432
            ++++  ISK+EY E GP  +  HK
Sbjct: 350 TTFQQMWISKQEYDESGPS-IVHHK 373

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 112/445 (25%), Positives = 175/445 (39%), Gaps = 85/445 (19%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSE---- 54
           MDS    LV+DNGS   K G +  + P                +    +K   V +    
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS 60

Query: 55  ----VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLP 109
               +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M   
Sbjct: 61  KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENV 169
              + M Q++FE +   + +           +QA    VL    SG+             
Sbjct: 114 SNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG---------- 150

Query: 170 TISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGL 229
                                 +V+DSG   T ++P+  G     AI ++D+ GR LT  
Sbjct: 151 ----------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDY 188

Query: 230 LKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
           L + LS R Y      E  +V +IKEK  +V+     +   A + +S+E           
Sbjct: 189 LMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIE----------- 237

Query: 288 GYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILR 347
                 KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+      +R
Sbjct: 238 ------KSYELPDG-QVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVR 290

Query: 348 PLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANT 407
             L  NIV +GG    P              P+    +I  P  E +   W      A+ 
Sbjct: 291 KELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASL 349

Query: 408 DSYKKTRISKEEYYEHGPDWLTKHK 432
            ++++  ISK+EY E GP  +  HK
Sbjct: 350 TTFQQMWISKQEYDESGPS-IVHHK 373

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 112/445 (25%), Positives = 175/445 (39%), Gaps = 85/445 (19%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSE---- 54
           MDS    LV+DNGS   K G +  + P                +    +K   V +    
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS 60

Query: 55  ----VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLP 109
               +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M   
Sbjct: 61  KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENV 169
              + M Q++FE +   + +           +QA    VL    SG+             
Sbjct: 114 SNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG---------- 150

Query: 170 TISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGL 229
                                 +V+DSG   T ++P+  G     AI ++D+ GR LT  
Sbjct: 151 ----------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDY 188

Query: 230 LKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
           L + LS R Y      E  +V +IKEK  +V+     +   A + +S+E           
Sbjct: 189 LMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIE----------- 237

Query: 288 GYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILR 347
                 KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+      +R
Sbjct: 238 ------KSYELPDG-QVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVR 290

Query: 348 PLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANT 407
             L  NIV +GG    P              P+    +I  P  E +   W      A+ 
Sbjct: 291 KELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASL 349

Query: 408 DSYKKTRISKEEYYEHGPDWLTKHK 432
            ++++  ISK+EY E GP  +  HK
Sbjct: 350 TTFQQMWISKQEYDESGPS-IVHHK 373

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 112/445 (25%), Positives = 175/445 (39%), Gaps = 85/445 (19%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSE---- 54
           MDS    LV+DNGS   K G +  + P                +    +K   V +    
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS 60

Query: 55  ----VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLP 109
               +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M   
Sbjct: 61  KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENV 169
              + M Q++FE +   + +           +QA    VL    SG+             
Sbjct: 114 SNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG---------- 150

Query: 170 TISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGL 229
                                 +V+DSG   T ++P+  G     AI ++D+ GR LT  
Sbjct: 151 ----------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDY 188

Query: 230 LKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
           L + LS R Y      E  +V +IKEK  +V+     +   A + +S+E           
Sbjct: 189 LMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIE----------- 237

Query: 288 GYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILR 347
                 KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+      +R
Sbjct: 238 ------KSYELPDG-QVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVR 290

Query: 348 PLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANT 407
             L  NIV +GG    P              P+    +I  P  E +   W      A+ 
Sbjct: 291 KELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASL 349

Query: 408 DSYKKTRISKEEYYEHGPDWLTKHK 432
            ++++  ISK+EY E GP  +  HK
Sbjct: 350 TTFQQMWISKQEYDESGPS-IVHHK 373

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 112/445 (25%), Positives = 175/445 (39%), Gaps = 85/445 (19%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSE---- 54
           MDS    LV+DNGS   K G +  + P                +    +K   V +    
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS 60

Query: 55  ----VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLP 109
               +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M   
Sbjct: 61  KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENV 169
              + M Q++FE +   + +           +QA    VL    SG+             
Sbjct: 114 SNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG---------- 150

Query: 170 TISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGL 229
                                 +V+DSG   T ++P+  G     AI ++D+ GR LT  
Sbjct: 151 ----------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDY 188

Query: 230 LKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
           L + LS R Y      E  +V +IKEK  +V+     +   A + +S+E           
Sbjct: 189 LMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIE----------- 237

Query: 288 GYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILR 347
                 KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+      +R
Sbjct: 238 ------KSYELPDG-QVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVR 290

Query: 348 PLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANT 407
             L  NIV +GG    P              P+    +I  P  E +   W      A+ 
Sbjct: 291 KELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASL 349

Query: 408 DSYKKTRISKEEYYEHGPDWLTKHK 432
            ++++  ISK+EY E GP  +  HK
Sbjct: 350 TTFQQMWISKQEYDESGPS-IVHHK 373

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  105 bits (262), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 115/448 (25%), Positives = 183/448 (40%), Gaps = 91/448 (20%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRAL----------NGFAVD-KYGSAYLSNQMK 47
           MDS    LV+DNGS   K G +  + P RA+           G  V      +Y+ ++ +
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  KIQEVSEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCM 106
             + +  +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQS 166
                 + M Q++FE +   + +           +QA    VL    SG+          
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG------- 150

Query: 167 ENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFL 226
                                    +V+DSG   T ++P+  G     AI ++D+ GR L
Sbjct: 151 -------------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDL 185

Query: 227 TGLLKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISS 284
           T  L + LS R Y      E  +V +IKEK  +V+     +   A + +S+E        
Sbjct: 186 TDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIE-------- 237

Query: 285 SYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPE 344
                    KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+     
Sbjct: 238 ---------KSYELPDG-QVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDV 287

Query: 345 ILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQF 404
            +R  L  NIV +GG    P              P+    +I  P  E +   W      
Sbjct: 288 DVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSIL 346

Query: 405 ANTDSYKKTRISKEEYYEHGPDWLTKHK 432
           A+  ++++  ISK+EY E GP  +  HK
Sbjct: 347 ASLTTFQQMWISKQEYDESGPS-IVHHK 373

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  105 bits (262), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 115/448 (25%), Positives = 183/448 (40%), Gaps = 91/448 (20%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRAL----------NGFAVD-KYGSAYLSNQMK 47
           MDS    LV+DNGS   K G +  + P RA+           G  V      +Y+ ++ +
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  KIQEVSEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCM 106
             + +  +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQS 166
                 + M Q++FE +   + +           +QA    VL    SG+          
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG------- 150

Query: 167 ENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFL 226
                                    +V+DSG   T ++P+  G     AI ++D+ GR L
Sbjct: 151 -------------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDL 185

Query: 227 TGLLKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISS 284
           T  L + LS R Y      E  +V +IKEK  +V+     +   A + +S+E        
Sbjct: 186 TDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIE-------- 237

Query: 285 SYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPE 344
                    KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+     
Sbjct: 238 ---------KSYELPDG-QVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDV 287

Query: 345 ILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQF 404
            +R  L  NIV +GG    P              P+    +I  P  E +   W      
Sbjct: 288 DVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSIL 346

Query: 405 ANTDSYKKTRISKEEYYEHGPDWLTKHK 432
           A+  ++++  ISK+EY E GP  +  HK
Sbjct: 347 ASLTTFQQMWISKQEYDESGPS-IVHHK 373

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  103 bits (258), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 113/448 (25%), Positives = 183/448 (40%), Gaps = 91/448 (20%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRAL----------NGFAVD-KYGSAYLSNQMK 47
           MDS    LV+DNGS   K G +  + P RA+           G  V      +Y+ ++ +
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ 59

Query: 48  KIQEVSEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCM 106
             + +  +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQS 166
                 + M Q++FE +   + +           +QA    VL    SG+          
Sbjct: 111 NPKSNREKMTQILFETFNVPAFY---------VSIQA----VLSLYSSGRTTG------- 150

Query: 167 ENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFL 226
                                    +V+DSG   T ++P+  G     AI ++D+ GR +
Sbjct: 151 -------------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDM 185

Query: 227 TGLLKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISS 284
           T  L + LS R Y      E  +V +IKEK  +V+     +   A + +++E        
Sbjct: 186 TDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIE-------- 237

Query: 285 SYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPE 344
                    KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+     
Sbjct: 238 ---------KSYELPDG-QVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDV 287

Query: 345 ILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQF 404
            +R  L  NIV +GG    P              P+    +I  P  E +   W      
Sbjct: 288 DVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSIL 346

Query: 405 ANTDSYKKTRISKEEYYEHGPDWLTKHK 432
           A+  ++++  ISK+EY E GP  +  HK
Sbjct: 347 ASLTTFQQMWISKQEYDESGPS-IVHHK 373

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  103 bits (258), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 111/445 (24%), Positives = 174/445 (39%), Gaps = 85/445 (19%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSE---- 54
           MDS    LV+DNGS   K G +  + P                +    +K   V +    
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS 60

Query: 55  ----VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLP 109
               +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M   
Sbjct: 61  KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENV 169
              + M Q++FE +   + +           +QA    VL    SG+             
Sbjct: 114 SNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG---------- 150

Query: 170 TISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGL 229
                                 +V+DSG   T ++P+  G      I ++D+ GR LT  
Sbjct: 151 ----------------------IVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDY 188

Query: 230 LKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
           L + LS R Y      E  +V +IKEK  +V+     +   A + +S+E           
Sbjct: 189 LMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIE----------- 237

Query: 288 GYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILR 347
                 KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+      +R
Sbjct: 238 ------KSYELPDG-QVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVR 290

Query: 348 PLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANT 407
             L  NIV +GG    P              P+    +I  P  E +   W      A+ 
Sbjct: 291 KELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASL 349

Query: 408 DSYKKTRISKEEYYEHGPDWLTKHK 432
            ++++  ISK+EY E GP  +  HK
Sbjct: 350 TTFQQMWISKQEYDESGPS-IVHHK 373

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  103 bits (257), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 113/449 (25%), Positives = 183/449 (40%), Gaps = 92/449 (20%)

Query: 1   MDS---TPLVLDNGSYEIKFGLSNSERPYRAL----------NGFAVD-KYGSAYLSNQM 46
           MDS     LV+DNGS   K G +  + P RA+           G  V      +Y+ ++ 
Sbjct: 1   MDSGEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEA 59

Query: 47  KKIQEVSEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPC 105
           +  + +  +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  
Sbjct: 60  QSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAP 110

Query: 106 MTLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQ 165
           M      + M Q++FE +   + +           +QA    VL    SG+         
Sbjct: 111 MNPKSNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG------ 151

Query: 166 SENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRF 225
                                     +V+DSG   T ++P+  G     AI ++D+ GR 
Sbjct: 152 --------------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRD 185

Query: 226 LTGLLKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDIS 283
           +T  L + LS R Y      E  +V +IKEK  +V+     +   A + +++E       
Sbjct: 186 MTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIE------- 238

Query: 284 SSYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIP 343
                     KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+    
Sbjct: 239 ----------KSYELPDG-QVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCD 287

Query: 344 EILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQ 403
             +R  L  NIV +GG    P              P+    +I  P  E +   W     
Sbjct: 288 VDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSI 346

Query: 404 FANTDSYKKTRISKEEYYEHGPDWLTKHK 432
            A+  ++++  ISK+EY E GP  +  HK
Sbjct: 347 LASLTTFQQMWISKQEYDESGPS-IVHHK 374

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  102 bits (255), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 108/438 (24%), Positives = 172/438 (39%), Gaps = 84/438 (19%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSE---- 54
           MDS    LV+DNGS   K G +  + P                +    +K   V +    
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS 60

Query: 55  ----VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLP 109
               +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M   
Sbjct: 61  KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENV 169
              + M Q++FE +   + +           +QA    VL    SG+             
Sbjct: 114 NNREKMTQILFETFNVPAFY---------VSIQA----VLSLYSSGRTTG---------- 150

Query: 170 TISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGL 229
                                 +V+DSG   T ++P+  G     AI ++D+ GR +T  
Sbjct: 151 ----------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDY 188

Query: 230 LKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
           L + L+ R Y      E  +V +IKEK  +V+     +   A + ++VE           
Sbjct: 189 LMKILAERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSAVE----------- 237

Query: 288 GYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILR 347
                 KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+      +R
Sbjct: 238 ------KSYELPDG-QVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVR 290

Query: 348 PLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANT 407
             L  NIV +GG    P              P+    +I  P  E +   W      A+ 
Sbjct: 291 KELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASL 349

Query: 408 DSYKKTRISKEEYYEHGP 425
            ++++  ISK+EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  102 bits (255), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 113/449 (25%), Positives = 182/449 (40%), Gaps = 92/449 (20%)

Query: 1   MDS---TPLVLDNGSYEIKFGLSNSERPYRAL----------NGFAVD-KYGSAYLSNQM 46
           MDS     LV+DNGS   K G +  + P RA+           G  V       Y+ ++ 
Sbjct: 1   MDSGEVAALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDCYVGDEA 59

Query: 47  KKIQEVSEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPC 105
           +  + +  +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  
Sbjct: 60  QSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAP 110

Query: 106 MTLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQ 165
           M      + M Q++FE +   + +           +QA    VL    SG+         
Sbjct: 111 MNPKSNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG------ 151

Query: 166 SENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRF 225
                                     +V+DSG   T ++P+  G     AI ++D+ GR 
Sbjct: 152 --------------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRD 185

Query: 226 LTGLLKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDIS 283
           +T  L + LS R Y      E  +V +IKEK  +V+     +   A + +++E       
Sbjct: 186 MTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDYDQEMQTAAQSSAIE------- 238

Query: 284 SSYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIP 343
                     KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+    
Sbjct: 239 ----------KSYELPDG-QVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCD 287

Query: 344 EILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQ 403
             +R  L  NIV +GG    P              P+    +I  P  E +   W     
Sbjct: 288 VDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSI 346

Query: 404 FANTDSYKKTRISKEEYYEHGPDWLTKHK 432
            A+  ++++  ISK+EY E GP  +  HK
Sbjct: 347 LASLTTFQQMWISKQEYDESGPS-IVHHK 374

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  100 bits (250), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 107/438 (24%), Positives = 171/438 (39%), Gaps = 84/438 (19%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSE---- 54
           MDS    LV+DNGS   K G +  + P                +    +K   V +    
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS 60

Query: 55  ----VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLP 109
               +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M   
Sbjct: 61  KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENV 169
              + M Q++FE +   + +           +QA    VL    SG+             
Sbjct: 114 SNREKMTQILFETFNVPAFY---------VSIQA----VLSLYSSGRTTG---------- 150

Query: 170 TISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGL 229
                                 +V+DSG   T ++P+  G      I ++D+ GR +T  
Sbjct: 151 ----------------------IVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDY 188

Query: 230 LKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
           L + LS R Y      E  +V +IKEK  +V+     +   A + +++E           
Sbjct: 189 LMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIE----------- 237

Query: 288 GYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILR 347
                 KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+      +R
Sbjct: 238 ------KSYELPDG-QVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVR 290

Query: 348 PLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANT 407
             L  NIV +GG    P              P+    +I  P  E +   W      A+ 
Sbjct: 291 KELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASL 349

Query: 408 DSYKKTRISKEEYYEHGP 425
            ++++  ISK+EY E GP
Sbjct: 350 TTFQQMWISKQEYDESGP 367

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 99.0 bits (245), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 98/381 (25%), Positives = 155/381 (40%), Gaps = 75/381 (19%)

Query: 55  VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLPELSK 113
           +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M      +
Sbjct: 50  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 102

Query: 114 NMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIST 173
            M Q++FE +   + +           +QA    VL    SG+                 
Sbjct: 103 KMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG-------------- 135

Query: 174 DNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKET 233
                             +V+DSG   T ++P+  G     AI ++D+ GR LT  L + 
Sbjct: 136 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 177

Query: 234 LSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTR 291
           LS R Y      E  +V +IKEK  +V+     +   A + +S+E               
Sbjct: 178 LSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIE--------------- 222

Query: 292 ENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLV 351
             KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+      +R  L 
Sbjct: 223 --KSYELPDG-QVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELY 279

Query: 352 ANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYK 411
            NIV +GG    P              P+    +I  P  E +   W      A+  +++
Sbjct: 280 GNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQ 338

Query: 412 KTRISKEEYYEHGPDWLTKHK 432
           +  ISK+EY E GP  +  HK
Sbjct: 339 QMWISKQEYDESGPS-IVHHK 358

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 93/374 (24%), Positives = 151/374 (40%), Gaps = 74/374 (19%)

Query: 55  VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLPELSK 113
           +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M      +
Sbjct: 50  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 102

Query: 114 NMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIST 173
            M Q++FE +   + +           +QA    VL    SG+                 
Sbjct: 103 KMTQILFETFNVPAFY---------VSIQA----VLSLYSSGRTTG-------------- 135

Query: 174 DNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKET 233
                             +V+DSG   T ++P+  G      I ++D+ GR +T  L + 
Sbjct: 136 ------------------IVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKI 177

Query: 234 LSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTR 291
           LS R Y      E  +V +IKEK  +V+     +   A + +++E               
Sbjct: 178 LSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIE--------------- 222

Query: 292 ENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLV 351
             KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+      +R  L 
Sbjct: 223 --KSYELPDG-QVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELY 279

Query: 352 ANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYK 411
            NIV +GG    P              P+    +I  P  E +   W      A+  +++
Sbjct: 280 GNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQ 338

Query: 412 KTRISKEEYYEHGP 425
           +  ISK+EY E GP
Sbjct: 339 QMWISKQEYDESGP 352

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 83.6 bits (205), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 97/378 (25%), Positives = 158/378 (41%), Gaps = 89/378 (23%)

Query: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNG---FAVDKYGSAYLSNQMKKI---QEVSE 54
           +P+VLD G+  +K G +    P   + ++ G      ++ GS  +S  +K I   +E S+
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGS--ISTPLKDIMIGEEASD 62

Query: 55  V----TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPE 110
           V     +  P E G + +W+    +WDY  YN  +F       SG K ++++EP M   +
Sbjct: 63  VRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFPS----TSGGK-ILLTEPPMNPLK 117

Query: 111 LSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVT 170
             + M +V+FE+Y+F  ++ A         +QA    VL     G  +            
Sbjct: 118 NRELMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG----------- 153

Query: 171 ISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLL 230
                                +V+DSG   T I+P+ + V      ++LD+ GR +T  L
Sbjct: 154 ---------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHL 192

Query: 231 KETLSFRHYDLMDETLL--VNNIKEKCLFVSPTSYFDSFKAKEETSV--EYILPDISSSY 286
            + LS R Y          V  IKEK  +VS     D+  A+E T +   Y LPD     
Sbjct: 193 IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLARETTVLVENYELPD----- 247

Query: 287 LGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEIL 346
                           +V+K+  E F  PE  F P++  + +PGI E +  ++      +
Sbjct: 248 ---------------GRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDI 292

Query: 347 RPLLVANIVCTGGNFNLP 364
           R  L   IV +GG+   P
Sbjct: 293 RSSLYRAIVLSGGSSMYP 310

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 91/376 (24%), Positives = 153/376 (40%), Gaps = 85/376 (22%)

Query: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV- 55
           +P+VLD G+  +K G +    P   + ++ G  + +      +S  +K I    E SEV 
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEASEVR 64

Query: 56  ---TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112
               +  P E G + +W     +WDY  +N       +L  +    ++++EP M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLPTTSGGKVLLTEPPMNPVKNR 119

Query: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172
           + M +V+FE Y+F  ++ A         +QA    VL     G  +              
Sbjct: 120 ERMCEVMFERYDFGGVYVA---------IQA----VLALYAQGLSSG------------- 153

Query: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232
                              +V+DSG   T I+P+ + V      ++LD+ GR +T  L +
Sbjct: 154 -------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194

Query: 233 TLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSV--EYILPDISSSYLG 288
            LS R Y      +   V  IKEK  +VS     D+  A+E T++  EY LPD       
Sbjct: 195 LLSRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLARETTTLVQEYELPD------- 247

Query: 289 YTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRP 348
                         +++K+  E F  PE  F P++  +  PG+ E +  ++      +R 
Sbjct: 248 -------------GRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRS 294

Query: 349 LLVANIVCTGGNFNLP 364
            L   IV +GG+   P
Sbjct: 295 SLYKAIVLSGGSSMYP 310

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 91/376 (24%), Positives = 149/376 (39%), Gaps = 85/376 (22%)

Query: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQEVSEVTLRR 59
           TP+VLD G+  +K G +    P   + ++ G  + +    A +   +K I    E +  R
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVR 64

Query: 60  -------PHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112
                  P E G + +W     +WDY  Y     D  +L  +    ++++EP M      
Sbjct: 65  SYLQISYPMENGVIKNWSDMELLWDYAFY-----DQMKLPSTSGGKVMLTEPPMNPLRNR 119

Query: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172
           + M +V+FE+Y+F  ++ A         +QA    VL     G  +              
Sbjct: 120 EQMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG------------- 153

Query: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232
                              +V+DSG   T I+P+ + V      ++LD+ GR +T  L +
Sbjct: 154 -------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194

Query: 233 TLSFRHYDLMDETLL--VNNIKEKCLFVSPTSYFDSFKAKEETSV--EYILPDISSSYLG 288
            LS R Y          V  IKEK  +VS     D+  A+E T++   Y LPD       
Sbjct: 195 LLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD------- 247

Query: 289 YTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRP 348
                         +V+K+  E F  PE  F P +  + +PG+ E +  ++      +R 
Sbjct: 248 -------------GRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRS 294

Query: 349 LLVANIVCTGGNFNLP 364
            L   IV +GG+   P
Sbjct: 295 ALYRAIVLSGGSSMYP 310

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 91/376 (24%), Positives = 152/376 (40%), Gaps = 85/376 (22%)

Query: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV- 55
           TP+VLD G+  +K G +    P   + ++ G  + +    A ++  +K I    E S+V 
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVR 64

Query: 56  ---TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112
               +  P E G + +W     +WDY  Y     +  +L  +    ++++EP M      
Sbjct: 65  SYLQISYPMENGIIKNWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRNR 119

Query: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172
           + M +V+FE+Y+F  ++ A         +QA    VL     G  +              
Sbjct: 120 EQMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG------------- 153

Query: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232
                              +V+DSG   T I+P+ + V      K+LD+ GR +T  L +
Sbjct: 154 -------------------VVVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLID 194

Query: 233 TLSFRHYDLMDETLL--VNNIKEKCLFVSPTSYFDSFKAKEETSV--EYILPDISSSYLG 288
            LS R Y          V  IKEK  +VS     D+  A+E T++   Y LPD       
Sbjct: 195 LLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD------- 247

Query: 289 YTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRP 348
                         +V+K+  E F  PE  F P +  + +PG+ E +  ++      +R 
Sbjct: 248 -------------GRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRT 294

Query: 349 LLVANIVCTGGNFNLP 364
            L   +V +GG+   P
Sbjct: 295 ALYRAVVLSGGSSMYP 310

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 81.3 bits (199), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 107/452 (23%), Positives = 181/452 (40%), Gaps = 94/452 (20%)

Query: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV- 55
           TP+VLD G+  +K G +    P   + ++ G  + +     + S  +K I    E SEV 
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR 64

Query: 56  ---TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112
               +  P E G + +W     +WDY       F+  +L  +    ++++EP M   +  
Sbjct: 65  SYLQISYPMENGIIRNWADMELLWDYAF-----FEQMKLPTTSGGKVLLTEPPMNPIKNR 119

Query: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172
           + M +V+FE+Y+F   + A         +QA    VL     G  +              
Sbjct: 120 EQMCEVMFEKYDFGGTYVA---------IQA----VLALYAQGLSSG------------- 153

Query: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232
                              +V+DSG   T I+P+ + V      ++LD+ GR +T  L +
Sbjct: 154 -------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194

Query: 233 TLSFRHY--DLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYT 290
            LS R Y  +   +   V  IKEK  +VS     D+  A+E T++               
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTL--------------- 239

Query: 291 RENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLL 350
              +S  LP+G +V+K+  E F  PE  F P +  + +PG+ E +  ++      +R  L
Sbjct: 240 --VESYELPDG-RVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSL 296

Query: 351 VANIVCTGGNFNLPHFXXXXX--------XXXXXXXPT---DWTCRISVPKKECELFSWK 399
              IV +GG+   P                      PT    +  RI  P +   +  + 
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMV-FI 355

Query: 400 SMCQFANTDSYKKTR-ISKEEYYEHGPDWLTK 430
                AN  + K    +SK+E++E GP  ++K
Sbjct: 356 GGAVLANIMADKDHMWLSKQEWHEIGPAAMSK 387

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 91/375 (24%), Positives = 150/375 (40%), Gaps = 85/375 (22%)

Query: 5   PLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV-- 55
           P+VLD G+  +K G +    P   + ++ G  + +    A +S  +K I    E S+V  
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQVRS 65

Query: 56  --TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSK 113
              +  P E G +  W     +WDY  Y     +  +L  +    ++++EP M      +
Sbjct: 66  YLQISYPMENGIIRDWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 114 NMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIST 173
            M +V+FE+Y+F  ++          G+QA    VL     G  +               
Sbjct: 121 QMCEVMFEKYDFGGVY---------VGIQA----VLALYAQGLSSG-------------- 153

Query: 174 DNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKET 233
                             +V+DSG   T I+P+ + V      ++LD+ GR +T  L + 
Sbjct: 154 ------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDL 195

Query: 234 LSFRHYDLMDETLL--VNNIKEKCLFVSPTSYFDSFKAKEETSV--EYILPDISSSYLGY 289
           LS R Y          V  IKEK  +VS     D+  A+E T++  +Y LPD        
Sbjct: 196 LSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLVEQYELPD-------- 247

Query: 290 TRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPL 349
                        +V+K+  E F  PE  F P +  + +PGI E +  ++      +   
Sbjct: 248 ------------GRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVST 295

Query: 350 LVANIVCTGGNFNLP 364
           L   IV +GG+   P
Sbjct: 296 LYKAIVLSGGSSMYP 310

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 102/436 (23%), Positives = 176/436 (40%), Gaps = 88/436 (20%)

Query: 5   PLVLDNGSYEIKFGLSNSERP----YRALNGFAVDKY------GSAYLSNQMKKIQEVSE 54
           P+VLDNGS  IK G S  ERP    Y  +     +K       G  ++ NQ ++++ +  
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL-- 68

Query: 55  VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKN 114
           + LR P E G + +W     IW++  +   + +  E     +  ++ +E  +   +  + 
Sbjct: 69  LKLRYPLEHGIVKNWSDMELIWNHVFHKSLQLNNIE-----EHPVLATEAPLNPLKNREA 123

Query: 115 MDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTD 174
           M +++FE +   +++ +         +QA    VL    SG+                  
Sbjct: 124 MCEMLFETFNVPAVYVS---------IQA----VLSLYASGRTTG--------------- 155

Query: 175 NLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGR----FLTGLL 230
                             V+D G  C   +P+  G     +I+++D+ GR    FL  LL
Sbjct: 156 -----------------CVLDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLL 198

Query: 231 KETLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYT 290
           ++T          E  +V  IKEK  +V+          +E+T   Y L   S+ +    
Sbjct: 199 RKTTGVSLLS-SSEREIVRIIKEKACYVARDPL-----TEEQT---YHLTPTSTIF---- 245

Query: 291 RENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLL 350
                  LP+G +V+ L +E F  PE  F P++       I E   +S+S +   LRP L
Sbjct: 246 ------KLPDG-KVLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPAL 298

Query: 351 VANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSY 410
           ++NIV +GG    P F                  +I  P  E +  +W      +   ++
Sbjct: 299 LSNIVLSGGTTMFPGFGDRLLTELRNLSEPQTKIKIFAP-PERKYSTWIGGSILSGLSTF 357

Query: 411 KKTRISKEEYYEHGPD 426
           KK  ++K E+ E+ PD
Sbjct: 358 KKIWVTKSEWQEN-PD 372

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 91/375 (24%), Positives = 151/375 (40%), Gaps = 85/375 (22%)

Query: 5   PLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV-- 55
           P+VLD G+  +K G +    P   + ++ G  + +    A +S  +K I    E S+V  
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVRS 65

Query: 56  --TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSK 113
              +  P E G + +W     +WDY       FD  +L  +    ++++EP M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FDQMKLPTTSNGKILLTEPPMNPVKNRE 120

Query: 114 NMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIST 173
            M +V+FE+Y+F  ++ A         +QA    VL     G  +               
Sbjct: 121 QMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG-------------- 153

Query: 174 DNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKET 233
                             +V+DSG   T I+P+ + V      ++LD+ GR +T  L + 
Sbjct: 154 ------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDL 195

Query: 234 LSFRHYDLMDETLL--VNNIKEKCLFVSPTSYFDSFKAKEETSV--EYILPDISSSYLGY 289
           LS R Y          V  IKEK  +VS     D+  A+E T++   Y LPD        
Sbjct: 196 LSRRGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLARETTTLVENYELPD-------- 247

Query: 290 TRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPL 349
                        +V+K+  E F  PE  F P +  + + G+ E +  ++      +R  
Sbjct: 248 ------------GRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSA 295

Query: 350 LVANIVCTGGNFNLP 364
           L   IV +GG+   P
Sbjct: 296 LYRAIVLSGGSSMYP 310

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 90/374 (24%), Positives = 157/374 (41%), Gaps = 81/374 (21%)

Query: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV- 55
           +P+VLD G+  +K G +    P   + ++ G  + +    A ++  +K I    E SEV 
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64

Query: 56  ---TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112
               +  P E G + +W     +WDY       F+  +L  +    ++++EP M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPTTSNGKILLTEPPMNPTKNR 119

Query: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172
           + M +V+FE+Y+F  ++ A         +QA    VL     G  +              
Sbjct: 120 EKMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG------------- 153

Query: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232
                              +V+DSG   T I+P+ + V      ++LD+ GR +T  L +
Sbjct: 154 -------------------VVVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLID 194

Query: 233 TLSFRHY--DLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYT 290
            LS R Y  +   +   V  IKEK  +VS     D+  A+E T++               
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTL--------------- 239

Query: 291 RENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLL 350
              +S  LP+G + +K+  E F  PE  F P +  + +PG+ E + +++      +R  L
Sbjct: 240 --VESYELPDG-RTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSAL 296

Query: 351 VANIVCTGGNFNLP 364
              IV +GG+   P
Sbjct: 297 YKAIVLSGGSSMYP 310

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 103/455 (22%), Positives = 179/455 (39%), Gaps = 102/455 (22%)

Query: 5   PLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV-- 55
           P+VLD G+  +K G +    P   + ++ G  + +    A ++  +K I    E SEV  
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRS 65

Query: 56  --TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSK 113
              +  P E G + +W     +WDY       F+  +L  +    ++++EP M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIST 173
            M +V+FE+Y+F  ++ A         +QA    VL     G  +               
Sbjct: 121 KMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG-------------- 153

Query: 174 DNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKET 233
                             +V+DSG   T I+P+ + V      ++LD+ GR +T  L + 
Sbjct: 154 ------------------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDL 195

Query: 234 LSFRHY--DLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTR 291
           LS R Y  +   +   V  IKEK  +VS     D+  A+E T++                
Sbjct: 196 LSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTAL---------------- 239

Query: 292 ENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLV 351
             +S  LP+G + +K+  E F  PE  F P +  + +PG+ E +  ++      +R  L 
Sbjct: 240 -VESYELPDG-RTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLY 297

Query: 352 ANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRI----------------SVPKKECEL 395
             IV +GG+   P                 W  R+                  P+++  +
Sbjct: 298 KAIVLSGGSSMYPGLPSRLEKELKQL----WFSRVLHNDPSRLDKFKVRIEDPPRRKHMV 353

Query: 396 FSWKSMCQFANTDSYKKTRISKEEYYEHGPDWLTK 430
           F   ++      D      +SK+E+ E GP  +TK
Sbjct: 354 FIGGAVLASIMADK-DHMWLSKQEWQESGPSAMTK 387

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 88/374 (23%), Positives = 156/374 (41%), Gaps = 81/374 (21%)

Query: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV- 55
           +P+VLD G+  +K G +    P   + ++ G  + +    A ++  ++ I    E S+V 
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVR 64

Query: 56  ---TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112
               +  P E G + +W     +WDY  +N       +L  +    ++++EP M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLNNTSGGKILLTEPPMNPLKNR 119

Query: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172
           + M +V+FE+Y+F  ++ A         +QA    VL     G  +              
Sbjct: 120 EKMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG------------- 153

Query: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232
                              +V+DSG   T I+P+ + V      ++LD+ GR +T  L +
Sbjct: 154 -------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194

Query: 233 TLSFRHY--DLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYT 290
            LS R Y  +   +   V  IKEK  +VS     D+  A+E T++               
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV-------------- 240

Query: 291 RENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLL 350
              +S  LP+G + +K+  E F  PE  F P +  + +PG+ E +  ++      +R  L
Sbjct: 241 ---ESYELPDG-RTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSAL 296

Query: 351 VANIVCTGGNFNLP 364
              IV +GG+   P
Sbjct: 297 YKAIVLSGGSSMYP 310

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 95/431 (22%), Positives = 176/431 (40%), Gaps = 83/431 (19%)

Query: 5   PLVLDNGSYEIKFGLSNSERPY---RALNGFAVDKY---------GSAYLSNQMKKIQEV 52
           P+VLDNGS  IK G    ++P     +L G  + KY         G+ ++ NQ ++I+ +
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVG--IPKYSKVMAGRFDGNTFVGNQAQEIRGL 69

Query: 53  SEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112
             + LR P E G +T W     +W +         G +L       ++V+E  +   +  
Sbjct: 70  --LKLRHPLEHGVVTDWNALEQLWGHVFEK-----GLQLSSLQDHPVLVTEAPLNPKKNR 122

Query: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172
           + M +++FE +   +++           +QA    VL    SG+                
Sbjct: 123 EQMCELLFETFSVPAVY---------VSIQA----VLSLYASGRTTG------------- 156

Query: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232
                               V+DSG  C+  +P+  G     AI+++DI GR ++ LL+ 
Sbjct: 157 -------------------CVLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELLQV 197

Query: 233 TLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRE 292
            +          +LL ++ +E    +   + + +   KEE            +Y  + ++
Sbjct: 198 LIR----KSTGVSLLSSSEREIVRIIKEKACYIALDPKEE----------EKNYTMHGKQ 243

Query: 293 NKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVA 352
              + LP+G Q+ +L +E F  PE  F+P++       + E + ES+  +   LR  L +
Sbjct: 244 TMFR-LPDGKQI-ELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFS 301

Query: 353 NIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKK 412
           NIV +GG   +P F                  +I  P  E +  +W      +   ++KK
Sbjct: 302 NIVFSGGTTMIPGFGDRVLKELKLSCEPQTKIKIFAP-PERKYSTWIGGSILSGLSTFKK 360

Query: 413 TRISKEEYYEH 423
             ++K+E+ E+
Sbjct: 361 IWVTKKEWEEN 371

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 87/352 (24%), Positives = 138/352 (39%), Gaps = 83/352 (23%)

Query: 1   MDS--TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSE---- 54
           MDS    LV+DNGS   K G +  + P                +    +K   V +    
Sbjct: 1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS 60

Query: 55  ----VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLP 109
               +TLR P E G +T+W+    IW +  YN       EL  + ++H ++++E  M   
Sbjct: 61  KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPK 113

Query: 110 ELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENV 169
              + M Q++FE +   + +           +QA    VL    SG+             
Sbjct: 114 SNREKMTQIMFETFNVPAFY---------VSIQA----VLSLYSSGRTTG---------- 150

Query: 170 TISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGL 229
                                 +V+DSG   T ++P+  G      I ++D+ GR LT  
Sbjct: 151 ----------------------IVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDY 188

Query: 230 LKETLSFRHYDL--MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
           L + LS R Y      E  +V +IKEK  +V+     +   A + +S+E           
Sbjct: 189 LMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIE----------- 237

Query: 288 GYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESL 339
                 KS  LP+G QV+ + +E F  PE  FHP +  +   GI +T   S+
Sbjct: 238 ------KSYELPDG-QVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 120/309 (38%), Gaps = 74/309 (23%)

Query: 60  PHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVI 119
           P E G + +W     +WDY  Y     D  +L  +    ++++EP M   +  + M +V+
Sbjct: 18  PMENGVIKNWSDMELLWDYAFY-----DQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVM 72

Query: 120 FEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDD 179
           FE+Y+F  ++ A  A    +                        G S  V          
Sbjct: 73  FEKYDFGGVYVAIQAVLALYAQ----------------------GLSSGV---------- 100

Query: 180 KKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHY 239
                        V+DSG   T I+P+ + V      ++LD+ GR +T  L + LS R Y
Sbjct: 101 -------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGY 147

Query: 240 DLMDETLL--VNNIKEKCLFVSPTSYFDSFKAKEETSV--EYILPDISSSYLGYTRENKS 295
                     V  IKEK  +VS     D+  A+E T++   Y LPD              
Sbjct: 148 AFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD-------------- 193

Query: 296 KPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIV 355
                  +V+K+  E F  PE  F P +  + +PG+ E +  ++      +R  L   IV
Sbjct: 194 ------GRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIV 247

Query: 356 CTGGNFNLP 364
            +GG+   P
Sbjct: 248 LSGGSSMYP 256

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 90/376 (23%), Positives = 154/376 (40%), Gaps = 85/376 (22%)

Query: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV- 55
           +P+VLD G+  +K G +    P   + ++ G  + +    A +S  +K I    E SEV 
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEASEVR 64

Query: 56  ---TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112
               +  P E G + +W     +WDY  Y     +  +L  +    ++++EP M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLKNR 119

Query: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172
           + M +V+FE+Y+F  ++ A         +QA    VL     G  +              
Sbjct: 120 EQMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG------------- 153

Query: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232
                              +V+DSG   T I+P+ + V      ++LD+ GR +T  L +
Sbjct: 154 -------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194

Query: 233 TLSFRHY--DLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSV--EYILPDISSSYLG 288
            LS R Y  +   +   V  IKEK  +VS     D+  A+E T++  +Y LPD       
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLARETTTLVEKYELPD------- 247

Query: 289 YTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRP 348
                         +++K+  E F  PE  F P +  +   G+ E +  ++      +R 
Sbjct: 248 -------------GRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRS 294

Query: 349 LLVANIVCTGGNFNLP 364
            L   IV +GG+   P
Sbjct: 295 SLYKAIVLSGGSSMYP 310

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 78.2 bits (191), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 86/378 (22%), Positives = 150/378 (39%), Gaps = 87/378 (23%)

Query: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYGSAYLSNQMKKIQEV-------- 52
           +P+VLD G+  +K G +    P   + ++ G  + +       +    I+++        
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEASD 64

Query: 53  --SEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPE 110
             S + +  P E G +  W     +WD+       F+  +L  +    ++++EP M   +
Sbjct: 65  VRSYLQISYPMENGIIKHWTDMELLWDHAF-----FEKMKLPSTSGGKILLTEPPMNPLK 119

Query: 111 LSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVT 170
             + M QV+FE+Y+F  ++ A         +QA    VL     G  +            
Sbjct: 120 NREMMCQVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG----------- 155

Query: 171 ISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLL 230
                                +V+DSG   T I+P+ + V      ++LD+ GR +T  L
Sbjct: 156 ---------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHL 194

Query: 231 KETLSFRHYDLMDETLL--VNNIKEKCLFVSPTSYFDSFKAKEETSV--EYILPDISSSY 286
            + LS R Y          V  IKEK  +VS    FD+  A+E T++   Y LPD     
Sbjct: 195 IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDFDTKLARETTTLVENYELPD----- 249

Query: 287 LGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEIL 346
                           +++K+  E F  PE  F P +  + +PG+ E +  ++      +
Sbjct: 250 ---------------GRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDI 294

Query: 347 RPLLVANIVCTGGNFNLP 364
           R  L   IV +GG+   P
Sbjct: 295 RSSLYKAIVLSGGSSMYP 312

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 77.8 bits (190), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 89/373 (23%), Positives = 155/373 (41%), Gaps = 81/373 (21%)

Query: 5   PLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV-- 55
           P+VLD G+  +K G +    P   + ++ G  + +    A ++  +K I    E S+V  
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 56  --TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSK 113
              +  P E G + +W     +WDY       F+  +L  +    ++++EP M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLQSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIST 173
            M +V+FE+Y+F  ++ A         +QA    VL     G  +               
Sbjct: 121 KMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG-------------- 153

Query: 174 DNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKET 233
                             +V+DSG   T I+P+ + V      ++LD+ GR +T  L + 
Sbjct: 154 ------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDL 195

Query: 234 LSFRHY--DLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTR 291
           LS R Y  +   +   V  IKEK  +VS     D+  A+E T++                
Sbjct: 196 LSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV--------------- 240

Query: 292 ENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLV 351
             +S  LP+G + +K+  E F  PE  F P +  + +PG+ E +  ++      +R  L 
Sbjct: 241 --ESYELPDG-RTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLY 297

Query: 352 ANIVCTGGNFNLP 364
             IV +GG+   P
Sbjct: 298 KAIVLSGGSSMYP 310

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 89/373 (23%), Positives = 155/373 (41%), Gaps = 81/373 (21%)

Query: 5   PLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV-- 55
           P+VLD G+  +K G +    P   + ++ G  + +    A ++  +K I    E S+V  
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 56  --TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSK 113
              +  P E G + +W     +WDY       F+  +L  +    ++++EP M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIST 173
            M +V+FE+Y+F  ++ A         +QA    VL     G  +               
Sbjct: 121 KMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG-------------- 153

Query: 174 DNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKET 233
                             +V+DSG   T I+P+ + V      ++LD+ GR +T  L + 
Sbjct: 154 ------------------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDL 195

Query: 234 LSFRHY--DLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTR 291
           LS R Y  +   +   V  IKEK  +VS     D+  A+E T++                
Sbjct: 196 LSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTAL---------------- 239

Query: 292 ENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLV 351
             +S  LP+G + +K+  E F  PE  F P +  + +PG+ E +  ++      +R  L 
Sbjct: 240 -VESYELPDG-RTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLY 297

Query: 352 ANIVCTGGNFNLP 364
             IV +GG+   P
Sbjct: 298 KAIVLSGGSSMYP 310

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 89/375 (23%), Positives = 151/375 (40%), Gaps = 85/375 (22%)

Query: 5   PLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV-- 55
           P+VLD G+  +K G +    P   + ++ G  + +    A ++  +K I    E S+V  
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEASDVRS 65

Query: 56  --TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSK 113
              +  P E G + +W     +WDY  +N       +L  +    ++++EP M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MQLPTTSGGKILLTEPPMNPVKNRE 120

Query: 114 NMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIST 173
            M +V+FE+Y+F  ++ A         +QA    VL     G  +               
Sbjct: 121 QMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG-------------- 153

Query: 174 DNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKET 233
                             +V+DSG   T I+P+ + V      ++LD+ GR +T  L + 
Sbjct: 154 ------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDL 195

Query: 234 LSFRHYDLMDETLL--VNNIKEKCLFVSPTSYFDSFKAKEETSV--EYILPDISSSYLGY 289
           LS R Y          V  IKEK  +VS     D+  A+E T++   Y LPD        
Sbjct: 196 LSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD-------- 247

Query: 290 TRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPL 349
                        +++K+  E F  PE  F P +  + + GI E +  ++      +R  
Sbjct: 248 ------------GRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSS 295

Query: 350 LVANIVCTGGNFNLP 364
           L   IV +GG+   P
Sbjct: 296 LYKAIVLSGGSSMYP 310

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 89/373 (23%), Positives = 154/373 (41%), Gaps = 81/373 (21%)

Query: 5   PLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQ---EVSEV-- 55
           P+VLD G+  +K G +    P   + ++ G  + +    A ++  +K I    E S+V  
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASDVRS 65

Query: 56  --TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSK 113
              +  P E G + +W     +WDY       F+  +L  +    ++++EP M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIST 173
            M +V+FE+Y+F  ++ A         +QA    VL     G  +               
Sbjct: 121 KMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG-------------- 153

Query: 174 DNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKET 233
                             +V+DSG   T I+P+ + V      ++LD+ GR +T  L + 
Sbjct: 154 ------------------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDL 195

Query: 234 LSFRHY--DLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTR 291
           LS R Y  +   +   V  IKEK  +VS     D+  A+E T +                
Sbjct: 196 LSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTVLV--------------- 240

Query: 292 ENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLV 351
             +S  LP+G + +K+  E F  PE  F P +  + +PG+ E +  ++      +R  L 
Sbjct: 241 --ESYELPDG-RTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLY 297

Query: 352 ANIVCTGGNFNLP 364
             IV +GG+   P
Sbjct: 298 RAIVLSGGSSMYP 310

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 89/376 (23%), Positives = 148/376 (39%), Gaps = 85/376 (22%)

Query: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQEVSEVTLRR 59
            P+VLD G+  +K G +    P   + ++ G  + + G  + +S  +K I    E +  R
Sbjct: 5   VPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVR 64

Query: 60  -------PHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112
                  P E G + +W     +WDY  Y     D  ++  +    ++++EP M   +  
Sbjct: 65  SYLQISYPMENGIIKNWADMEQLWDYAFY-----DQMKIPSTAGHKVLLTEPPMNPLKNR 119

Query: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172
           + M +V+FE+Y+F  ++ A         +QA    VL     G  +              
Sbjct: 120 EQMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG------------- 153

Query: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232
                              +V+DSG   T I+P+ + V      ++LD+ GR +T  L +
Sbjct: 154 -------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLID 194

Query: 233 TLSFRHYDLMDETLL--VNNIKEKCLFVSPTSYFDSFKAKEETSV--EYILPDISSSYLG 288
            LS R Y          V  IKEK  +VS     D+  A E T++   Y LPD       
Sbjct: 195 LLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTKLAHETTTLVETYELPD------- 247

Query: 289 YTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRP 348
                         +V+K+  E F  PE  F P +  + + GI E +  ++      +  
Sbjct: 248 -------------GRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIIS 294

Query: 349 LLVANIVCTGGNFNLP 364
            L   IV +GG+   P
Sbjct: 295 ALYRAIVLSGGSSMYP 310

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 96/432 (22%), Positives = 167/432 (38%), Gaps = 87/432 (20%)

Query: 5   PLVLDNGSYEIKFGLSNSERP----YRALNGFAVDKY------GSAYLSNQMKKIQEVSE 54
           P+VLDNGS  IK G S  E+P    Y  +     +K       G  ++ NQ ++++ +  
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL-- 66

Query: 55  VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKN 114
           + LR P E G + +W     IW Y      +    E        ++++E  +      + 
Sbjct: 67  LKLRHPVEHGIVKNWSDMEHIWSYVFNKSLQLQNVE-----DHPILITEAPLNPRNNRER 121

Query: 115 MDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTD 174
           M +++FE +   +L+ +         +QA    VL    SG+                  
Sbjct: 122 MCELLFESFNVPALYVS---------IQA----VLSLYASGRTTG--------------- 153

Query: 175 NLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGR----FLTGLL 230
                             V+D G  C   +P+  G     +I+++DI GR    FL  LL
Sbjct: 154 -----------------CVVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLL 196

Query: 231 KETLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYT 290
           ++T          E  +V  IKEK  +V+   +       EE +       I+ +Y  + 
Sbjct: 197 RKTTGVSLLS-SSEREVVRIIKEKACYVAKDPHI------EEQNF-----SINPNYTKFK 244

Query: 291 RENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLL 350
                  LP+G + + L  E F  PE  F PE+       + +   +S+  +   LR LL
Sbjct: 245 -------LPDG-KTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLL 296

Query: 351 VANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSY 410
            +N++ +GG   LP F             +    +I  P  E +  +W      +   ++
Sbjct: 297 FSNVLLSGGTSILPGFGDRLLSELKSLSDSQTKIKIFAP-PERKYSTWIGGSILSGLSTF 355

Query: 411 KKTRISKEEYYE 422
           KK  +++ E+ E
Sbjct: 356 KKLWVTRAEWEE 367

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 99/432 (22%), Positives = 169/432 (39%), Gaps = 87/432 (20%)

Query: 5   PLVLDNGSYEIKFGLSNSERP----YRALNGFAVDKY------GSAYLSNQMKKIQEVSE 54
           P+VLDNGS  IK G S  E+P    Y  +     +K       G  ++ NQ ++++ +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL-- 94

Query: 55  VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKN 114
           + LR P + G +T+W     +W Y      +    E         +V+E  +   +  + 
Sbjct: 95  LKLRYPLQHGIVTNWADMEQVWGYVFNKSLQLQNVE-----DHPNLVTEAPLNPHKNREK 149

Query: 115 MDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTD 174
           M +++FE +   +L+ +         VQA    VL    SG+                  
Sbjct: 150 MCELLFESFNVPALYVS---------VQA----VLSLYASGRTTG--------------- 181

Query: 175 NLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGR----FLTGLL 230
                             V+D G  C   +P+  G     +I+++DI GR    FL  LL
Sbjct: 182 -----------------CVVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLL 224

Query: 231 KETLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYT 290
           ++T          E  +V  IKEK  FV+          K+    E   P ++ S+  + 
Sbjct: 225 RKTTGVSLLS-SSEREIVRTIKEKACFVT----------KDPKLEEQNFP-MNPSFSKFK 272

Query: 291 RENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLL 350
                  LP+G + ++L  E +  PE  F PE+       + +   +S+  +   LR LL
Sbjct: 273 -------LPDG-KTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLL 324

Query: 351 VANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSY 410
            +NI+ +GG   LP F             +    +I  P  E +  +W      +   ++
Sbjct: 325 YSNILLSGGTSMLPGFGDRLLKELKSLSGSRTKIKIFAP-PERKYSTWIGGSILSGLSTF 383

Query: 411 KKTRISKEEYYE 422
           KK  ++K E+ E
Sbjct: 384 KKLWVTKSEWEE 395

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 103/433 (23%), Positives = 166/433 (38%), Gaps = 84/433 (19%)

Query: 3   STPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMK--------KIQEVSE 54
           S P+VLDNGS  +K G S  +RP + L    V      Y+++  K          +  S 
Sbjct: 10  SQPVVLDNGSAILKAGYSGEDRP-KFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI 68

Query: 55  VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKN 114
           + LR P + G + +W     IWDY        D  +L    +  ++++E  +        
Sbjct: 69  LQLRHPVDHGVVKNWNDMELIWDYMFK-----DKLKLKDVDEHPVLITEAPLNPVSNRDE 123

Query: 115 MDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTD 174
           M  ++FE +   +L+ A  A             VL    SGK +                
Sbjct: 124 MCDLLFESFGVQALYVANPA-------------VLSLYASGKISG--------------- 155

Query: 175 NLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETL 234
                             V+D G   +  +P+ +G     AIK++D+GGR LT  L+  L
Sbjct: 156 -----------------CVLDCGDGYSCSVPVYQGYTLKSAIKRIDLGGRDLTEQLQ--L 196

Query: 235 SFRHYDLMD-----ETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGY 289
             R    +      E  LV  IKEK  +V+               V+  + +   +Y G 
Sbjct: 197 QLRKSTGLSLTTSGEMELVRMIKEKSCYVA---------------VDLDIEEEKCNYEGD 241

Query: 290 TRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPL 349
               K K LP+G + + L  + F VPE  F P +       I E I +S+S +   LRP 
Sbjct: 242 QVGLKFK-LPDG-KFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQ 299

Query: 350 LVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDS 409
           + ++I+ +GG   L  F                  +I  P  E +  SW      A   +
Sbjct: 300 MWSDILLSGGTTMLKGFGNRLVQELDKLNQAQSRVKIWAP-PERKYTSWIGGSILAELST 358

Query: 410 YKKTRISKEEYYE 422
           ++K  ++K ++ E
Sbjct: 359 FQKIIVTKSQWQE 371

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 73/307 (23%), Positives = 122/307 (39%), Gaps = 70/307 (22%)

Query: 60  PHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVI 119
           P E G + +W     +WDY  Y     +  +L  +    ++++EP M   +  + M +V+
Sbjct: 18  PMENGIIKNWTDMELLWDYAFY-----EQMKLPDTSNGKILLTEPPMNPIKNREKMCEVM 72

Query: 120 FEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDD 179
           FE+Y F  ++ A  A    +                        G S  V          
Sbjct: 73  FEKYNFGGVYVAIQAVLALYAQ----------------------GLSSGV---------- 100

Query: 180 KKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHY 239
                        V+DSG   T I+P+ + V      ++LD+ GR +T  L + LS R Y
Sbjct: 101 -------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGY 147

Query: 240 --DLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKP 297
             +   +   V  IKEK  +VS     D+  A+E T++                  +S  
Sbjct: 148 AFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV-----------------ESYE 190

Query: 298 LPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCT 357
           LP+G +V+K+  E F  PE  F P +  + + G+ E +  ++      +R  L   IV +
Sbjct: 191 LPDG-RVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLS 249

Query: 358 GGNFNLP 364
           GG+   P
Sbjct: 250 GGSSMYP 256

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 85/379 (22%), Positives = 156/379 (41%), Gaps = 90/379 (23%)

Query: 5   PLVLDNGSYEIKFGLSNSERP----YRALNGFAVDKY------GSAYLSNQMKKIQEVSE 54
           P+V+DNGS  IK G S  ERP    Y  +     DK       G  ++ N  +K++ +  
Sbjct: 14  PVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL-- 71

Query: 55  VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKN 114
           + LR P + G +  W+    IW Y L      +  +L   G+  L+++E  M   +  + 
Sbjct: 72  LKLRYPIKHGVVEDWDSMELIWSYVLN-----EVLQLQNIGEHPLLITEAPMNPLKNREQ 126

Query: 115 MDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTD 174
           M QV+FE ++  +L+ +  A             VL    SG+                  
Sbjct: 127 MAQVLFETFDVSALYVSNPA-------------VLSLYASGRTTG--------------- 158

Query: 175 NLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETL 234
                             V+D G      +P+  G     ++ ++DIGG  +T    E L
Sbjct: 159 -----------------CVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADIT----EQL 197

Query: 235 SFRHYDLMDETL-------LVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
            F+       +L       +V  +KEK  +++      + K +EE  ++    D+ S++ 
Sbjct: 198 QFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAK-----NIKKEEEKYLQGT-QDLISTF- 250

Query: 288 GYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILR 347
                     LP+G + +++ ++ +  PE  F P+I  +   G+ +  ++S+  +   LR
Sbjct: 251 ---------KLPDG-RCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLR 300

Query: 348 PLLVANIVCTGGNFNLPHF 366
             L+++I+ +GG   L  F
Sbjct: 301 KPLLSSIILSGGTTTLKGF 319

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 92/430 (21%), Positives = 164/430 (38%), Gaps = 81/430 (18%)

Query: 5   PLVLDNGSYEIKFGLSNSERP----YRALNGFAVDKYGSAYLSNQM---KKIQE-VSEVT 56
           P+V+DNG+  +K G    ++P    +  +     DK     L + M    K QE    + 
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKVMIGGLDDNMYIGNKAQENRGLLR 69

Query: 57  LRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMD 116
           LR P E G++  W+    +W + L +       E     +  ++++E  +   +  ++M 
Sbjct: 70  LRHPMEHGEVKHWDEMEAVWKHTLLHDLNIQHIE-----EHPILITEAPLNSSKNREHMC 124

Query: 117 QVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNL 176
           +++FE +             IP  +  ++  VL     G+                    
Sbjct: 125 EILFESFN------------IP-AIHVENPAVLALYSGGRTTG----------------- 154

Query: 177 KDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSF 236
                           VID G      +P+ +G     +I+++DIGGR +T    E L F
Sbjct: 155 ---------------CVIDCGEGYCSAVPIYEGFALTPSIRRIDIGGREIT----EQLQF 195

Query: 237 RHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISS---SYLGYTREN 293
           +    +  +L  +N KE    +           KE     Y+  DIS     Y+  +  N
Sbjct: 196 QIRKSVGMSLFSSNEKEIVRTI-----------KERAC--YVADDISKEEHKYILDSESN 242

Query: 294 KSK-PLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVA 352
            SK  LP+G  +  + +  F   E  F+P +       + E + ++LS +   LRP+L  
Sbjct: 243 SSKFKLPDGKSL-SIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYK 301

Query: 353 NIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKK 412
           ++V  GG   LP F              D   RI +   E +  +W      A   +++K
Sbjct: 302 SLVLNGGTTVLPGFGNRILKELQILTKQDTKLRI-IASPERKYTTWIGGSILAGLSTFQK 360

Query: 413 TRISKEEYYE 422
             ++K  + E
Sbjct: 361 ILVTKSNWNE 370

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 86/376 (22%), Positives = 149/376 (39%), Gaps = 85/376 (22%)

Query: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYG-SAYLSNQMKKIQEVSEVTLRR 59
           +P+VLD G+  +K G +    P   + ++ G  + +      L+  +K +    E +  R
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64

Query: 60  -------PHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112
                  P E G + +W     +WDY  Y     +  +L  +    ++++EP +   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPLNPLKNR 119

Query: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172
           + M +V+FE+Y+F  ++ A         +QA    VL     G  +              
Sbjct: 120 EKMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG------------- 153

Query: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232
                              +VIDSG   T I+P+ + V      ++LD+ GR +T  L +
Sbjct: 154 -------------------VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194

Query: 233 TLSFRHY--DLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSV--EYILPDISSSYLG 288
            LS R Y  +   +   V  IKEK  +VS     D+  A+E T++   Y LPD       
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELPD------- 247

Query: 289 YTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRP 348
                         +V+K+  E F   E  F P +  +   G+ E +  ++      +R 
Sbjct: 248 -------------GRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRS 294

Query: 349 LLVANIVCTGGNFNLP 364
            L   IV +GG+   P
Sbjct: 295 SLYKAIVLSGGSSMYP 310

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 91/432 (21%), Positives = 167/432 (38%), Gaps = 83/432 (19%)

Query: 5   PLVLDNGSYEIKFGLSNSERP----YRALNGFAVDKY------GSAYLSNQMKKIQEVSE 54
           P+V+DNGS  +K G    E+P    Y  +     +K         +++ N+ ++++ +  
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL-- 68

Query: 55  VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKN 114
           + L+ P E G ++ W+    +W + L     FD  +L    +  L+++E  +      + 
Sbjct: 69  LKLKHPMERGVVSDWDDMELLWSHIL-----FDSLQLTSGMEHPLLITEAPLNPESNKEK 123

Query: 115 MDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTD 174
           M +V FE +   ++  +     IP         VL    SG+                  
Sbjct: 124 MLEVFFETFNIPAICVS-----IP--------GVLSLYASGRTTG--------------- 155

Query: 175 NLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETL 234
                             V+D G      +P+ +G     +IK++++GG  +T  L+  L
Sbjct: 156 -----------------CVVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQL 198

Query: 235 SFRHYDLM---DETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTR 291
                  +    E  LV  +KEK  +VS     +  K +E+ + E              +
Sbjct: 199 RKESGVWLFSSGERELVRTMKEKSCYVS----LNQLKDEEKFTFEP------------GK 242

Query: 292 ENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLV 351
            N +  LP+G+ ++ L    F  PE  F P+I    +P + E  L+S+  +   LRP L+
Sbjct: 243 MNTNFKLPDGN-MLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLM 301

Query: 352 ANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYK 411
           + I  +GG      F                  RI  P  E +  +W      A   +++
Sbjct: 302 SRITLSGGTTMFRGFGDRFLQELQISTCKKSNIRILAP-PERKYTAWIGGSMLAGLTTFR 360

Query: 412 KTRISKEEYYEH 423
           K   +K ++ EH
Sbjct: 361 KMLTTKSDWREH 372

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 94/436 (21%), Positives = 166/436 (38%), Gaps = 93/436 (21%)

Query: 5   PLVLDNGSYEIKFGLSNSERP----YRALNGFAVDKY------GSAYLSNQMKKIQEVSE 54
           P+V+DNGS  IK G S  ERP    Y  +     +K       G  ++ N+ +K++ +  
Sbjct: 14  PIVIDNGSGIIKVGFSGEERPKALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 55  VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKN 114
           + LR P   G +  W+    IW Y L    +    E     +  L+++E  M   +  + 
Sbjct: 72  LRLRYPMTHGVVEDWDSMELIWSYMLNEVLQLQNIE-----EHPLLITEAPMNPLKNREV 126

Query: 115 MDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTD 174
           M QV+FE +   +L+ +  A             VL    SG+                  
Sbjct: 127 MAQVLFETFNLPALYISNPA-------------VLSLYASGRTTG--------------- 158

Query: 175 NLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETL 234
                             V+D G      +P+  G     +I ++DIGGR +T    E L
Sbjct: 159 -----------------CVVDCGEGYCSTVPIYDGFALPASIMRMDIGGRDIT----EQL 197

Query: 235 SFRHYDLMDETL-------LVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
            F+       +L       +V  IKEK  +++          KEE        D+ S + 
Sbjct: 198 QFQLRKSAGISLFSSSELEVVRMIKEKVCYLAKNI------KKEEDRYLQGHHDLGSVF- 250

Query: 288 GYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILR 347
                     LP+G + +++ ++ +  PE  F P+I      G+ +  ++S+  +   LR
Sbjct: 251 ---------KLPDG-KCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLR 300

Query: 348 PLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRIS-VPKKECELFSWKSMCQFAN 406
             L+++I+ +GG   L  F             +  TC+I  +   E +  +W        
Sbjct: 301 KTLLSSIILSGGTTTLRGFGERMLHDLEAL--SKGTCKIKIIAPPERKYTTWVGGSILTG 358

Query: 407 TDSYKKTRISKEEYYE 422
             +++K    K ++ E
Sbjct: 359 LSTFQKLWTKKSDWLE 374

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 88/439 (20%), Positives = 161/439 (36%), Gaps = 96/439 (21%)

Query: 5   PLVLDNGSYEIKFGLSNSERPY-------------RALNGFAVDKYGSAYLSNQMKKIQE 51
           P+VLDNGS  IK G S   +P              + +   A+      Y+ N+ +K + 
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKSRG 69

Query: 52  VSEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPEL 111
           +  + LR P   G + +W+    +W +   +  + + F+     +  L+++E  +   + 
Sbjct: 70  L--LRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFD-----EHPLLITEAPLNPEKN 122

Query: 112 SKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTI 171
              M +V FE+++F +++ A  +    +              SG+               
Sbjct: 123 RDKMCEVFFEKFDFAAVYIANPSTLSLYA-------------SGRTTG------------ 157

Query: 172 STDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLK 231
                                V+D G      +P+ +G     +I+++D+GGR +T  L+
Sbjct: 158 --------------------CVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQ 197

Query: 232 ETLSFRHYDLMD-----ETLLVNNIKEKCLFVSPTSYFDSFKAK---EETSVEYILPDIS 283
                R Y  +      E  +V N+KEK  +VS     D   +    E+   ++ LPD  
Sbjct: 198 --FQIRKYTGISLYSSSEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEKIRCQFKLPDGK 255

Query: 284 SSYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIP 343
              L   R                    F  PE  F P+I  +    + +   ES+S + 
Sbjct: 256 DLILDKAR--------------------FRAPEILFRPQIMGLEYDSVSDMCFESISKVD 295

Query: 344 EILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQ 403
             LRP L ++I+  GG+     F                  +I  P  E +  SW     
Sbjct: 296 LELRPKLFSSIILNGGSTMFRGFGDRLLKELQIRTGNKNLIKIIAP-PERKYTSWIGGSI 354

Query: 404 FANTDSYKKTRISKEEYYE 422
                ++K+  ++K E+ E
Sbjct: 355 LTGLSTFKQLWMTKAEWQE 373

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 84/375 (22%), Positives = 149/375 (39%), Gaps = 82/375 (21%)

Query: 5   PLVLDNGSYEIKFGLSNSERP----YRALNGFAVDKY------GSAYLSNQMKKIQEVSE 54
           P+V+DNGS  IK G S  E+P    Y  +     DK       G  ++ N+ ++++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGL-- 71

Query: 55  VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKN 114
           + L+ P E G +  W+    IW + L    +    E     +  L+++E  M   +  + 
Sbjct: 72  LRLQYPIEHGVVEDWDSMELIWAHILNEVLQLQNIE-----EHPLLITEAPMNPLKNREV 126

Query: 115 MDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTD 174
           M QV+FE +   +L+ +  A             VL    SG+                  
Sbjct: 127 MAQVLFETFNLPALYVSNPA-------------VLSLYASGRTTG--------------- 158

Query: 175 NLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETL 234
                             VID G      +P+  G     ++ ++DIGGR +T  L+  L
Sbjct: 159 -----------------CVIDCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQL 201

Query: 235 SFRHYDLM---DETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTR 291
                  +    E  +V  IKEK        Y  +   KEE +      D++S +     
Sbjct: 202 RKSAGVSLFSSSEREIVRTIKEK------VCYLATDIKKEENTYMQESQDLTSVF----- 250

Query: 292 ENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLV 351
                 LP+G + +++ ++ +  PE  F P+I      G+ +  ++S+  +   LR  L+
Sbjct: 251 -----KLPDG-KCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLL 304

Query: 352 ANIVCTGGNFNLPHF 366
           ++I+ +GG   L  F
Sbjct: 305 SSIILSGGTTTLRGF 319

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 83/379 (21%), Positives = 148/379 (39%), Gaps = 90/379 (23%)

Query: 5   PLVLDNGSYEIKFGLSNSERP----YRALNGFAVDKY------GSAYLSNQMKKIQEVSE 54
           P+V+DNGS  IK G S  ERP    Y  +     DK       G  ++ N+ +K++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 55  VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKN 114
           + LR P + G +  W+    IW Y L    +    E     +  L+++E  M   +  + 
Sbjct: 72  LRLRYPMKHGVVEDWDSMELIWSYVLNEVLQLQNIE-----EHPLLITEAPMNPLKNREM 126

Query: 115 MDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTD 174
           + QV+FE +   +++               D  VL    SG+                  
Sbjct: 127 IAQVMFETFNLSAIY-------------VSDPAVLSLYASGRTTG--------------- 158

Query: 175 NLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETL 234
                             V+D G      +P+  G     +I ++DIGG    G + E L
Sbjct: 159 -----------------CVVDCGEGYCSSVPIYDGFALPASIMRMDIGG----GDITEQL 197

Query: 235 SFRHYDLMDETL-------LVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
            F+       +L       +V  IKEK  +++  +       KEE        D+ S++ 
Sbjct: 198 QFQIRKSAGVSLFSSSEREIVRTIKEKVCYLAKDA------KKEEDKYLQGTQDLISAF- 250

Query: 288 GYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILR 347
                     LP+G + +++ ++ +  PE  F P+I      G+    ++S+  +   LR
Sbjct: 251 ---------KLPDG-KSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLR 300

Query: 348 PLLVANIVCTGGNFNLPHF 366
             L+++++ +GG   L  F
Sbjct: 301 KNLLSSVILSGGTTTLKGF 319

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 65/138 (47%), Gaps = 9/138 (6%)

Query: 310 ELFSVPETFFHPEISRILKPGIVE----TILESLSMIPEILRPL---LVANIVCTGGNFN 362
           E   VPE FF P +    + G+ E     +L      P  +  +   +  N+  TGGN  
Sbjct: 612 ERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVTGGNAK 671

Query: 363 LPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFA-NTDSYKKTRISKEEYY 421
           +P              P + +  +++   +  L +W+ M ++A N   YKK+ ISK+EY 
Sbjct: 672 IPGLRERIVKEFTGFLPVNTSFNVNI-SSDPSLDAWRGMAKYAQNETDYKKSFISKKEYE 730

Query: 422 EHGPDWLTKHKFGYQNWL 439
           E+GPD++ +HK G  N+ 
Sbjct: 731 EYGPDYIKEHKLGNMNYF 748

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 83/370 (22%), Positives = 147/370 (39%), Gaps = 82/370 (22%)

Query: 5   PLVLDNGSYEIKFGLSNSERPYR-ALNGFAVDKYGSAYLSNQMKKIQEV---------SE 54
           P+V+DNGS  IK G S  ++P     N   + KY    ++ Q++ + +            
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 55  VTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKN 114
           + L+ P   G + +W+    +W + ++N    D   +    +  L+++E  +T+ +    
Sbjct: 71  LRLQHPMNRGVVDNWDDMELLW-WHIFN----DTLNVQNIEEHPLLITEAPLTIEKQRHI 125

Query: 115 MDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTD 174
           M + +FE +   SL+ A             +  VL    SG                   
Sbjct: 126 MCERLFETFNIPSLYVA-------------NPSVLSLYASGNTTG--------------- 157

Query: 175 NLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLL---- 230
                             V+D G       P+ +G     +I+K+++GGR +T  L    
Sbjct: 158 -----------------CVVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQI 200

Query: 231 KETLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYT 290
           +++     Y   +E  +V  IKEK  ++S     + F   EE           S YL   
Sbjct: 201 RKSSGISLYS-SNEKEIVRTIKEKVCYIS-----EDFNKSEE-----------SYYLRQD 243

Query: 291 RENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLL 350
             +    LP+G ++  L  E F  PE  F+P++  +    +     ES+S +   LRP L
Sbjct: 244 EMSCKFKLPDGKELT-LNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKL 302

Query: 351 VANIVCTGGN 360
            +NI+ TGG+
Sbjct: 303 FSNILLTGGS 312

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 73/157 (46%), Gaps = 10/157 (6%)

Query: 286 YLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVE----TILESLSM 341
           +L   R + S+ + E  Q+  L  E   VPE  F P +    + GI E     +L+    
Sbjct: 594 FLRGPRPHDSENIHEQHQM-HLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGS 652

Query: 342 IPEILRPL---LVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSW 398
            P  L      +V N++ TGGN  +P              PT     +++   +  L +W
Sbjct: 653 QPGKLSQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNM-SSDPSLDAW 711

Query: 399 KSMCQFA-NTDSYKKTRISKEEYYEHGPDWLTKHKFG 434
           K M   A N + Y+KT ISK+EY E+GP+++ +HK G
Sbjct: 712 KGMAALARNEEQYRKTVISKKEYEEYGPEYIKEHKLG 748

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 65/136 (47%), Gaps = 15/136 (11%)

Query: 310 ELFSVPETFFHPEISRILKPGIVETILES--------LSMIPEILRPLLVANIVCTGGNF 361
           E   VPE  F P +  + + GI+E I E+               +   L +N+  TGGN 
Sbjct: 609 ERIRVPEVIFQPSMGGLDQAGIIE-ICETNFLKKFGSSRSELSSISRSLASNVFLTGGNM 667

Query: 362 NLPHFXXXXXXXXXXXXP--TDWTCRISVPKKECELFSWKSMCQFANTDS-YKKTRISKE 418
            LP              P  T+   R++    +C L +W+ M + + TDS ++ T ++++
Sbjct: 668 RLPGMRERVVREFRGLLPIGTELNVRMA---NDCALDAWRGMAKLSRTDSLFRDTYVTRQ 724

Query: 419 EYYEHGPDWLTKHKFG 434
           EY+E+GPD++ +H  G
Sbjct: 725 EYHEYGPDYIKEHNLG 740

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 102/275 (37%), Gaps = 76/275 (27%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTL------ 57
           T + +D GS E++ G  N ERP        + ++    L+  +  I   + + L      
Sbjct: 37  TAIAIDFGSSEVRAGYGNQERPSHIFPN-RIARWRDRKLNRNLTFIGNDTNLDLSVRSQS 95

Query: 58  RRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHL----IVSEPCMTLPELSK 113
           R P++   +T+W+    I +Y  ++        LG  G   +    I++E    L     
Sbjct: 96  RSPYDGALVTNWDYTEDIMEYTFHH--------LGVKGTDGIPNPIIMTEKLGALHSQRD 147

Query: 114 NMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIST 173
           N  Q++FE       F AP                                    VT   
Sbjct: 148 NWYQLLFE------CFGAP-----------------------------------QVTFGL 166

Query: 174 DNLKDDKKKFS----NDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGR----F 225
           D+L      FS    ND     LVI SG   T IIP++ G       K+++ GGR    +
Sbjct: 167 DSL------FSFYANNDASASGLVISSGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDY 220

Query: 226 LTGLLKETLSFRHYDLMDETLLVNNIKEKCLFVSP 260
           L+ LL   L + ++ +   T     + ++  +VSP
Sbjct: 221 LSNLL--ALKYPYFPIKPSTHQFKALYDEFCYVSP 253

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 74/159 (46%), Gaps = 14/159 (8%)

Query: 286 YLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVE----TILESLSM 341
           +L   R + S+ + E  Q+  L  E   VPE  F P +    + GI E     +L+    
Sbjct: 594 FLRGPRPHDSENIHEQHQM-HLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGS 652

Query: 342 IPEILRPL---LVANIVCTGGNFNLPHFXXXXXXXXXXXXP--TDWTCRISVPKKECELF 396
            P  L      +V N+  TGGN  +P              P  T+++  +S    +  L 
Sbjct: 653 QPGKLSSTSLDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNMS---SDPSLD 709

Query: 397 SWKSMCQFA-NTDSYKKTRISKEEYYEHGPDWLTKHKFG 434
           +WK M   A N + YKKT ISK+EY E+GPD++ +HK G
Sbjct: 710 AWKGMAALAQNKEEYKKTVISKKEYEEYGPDYIKEHKLG 748

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 94/441 (21%), Positives = 165/441 (37%), Gaps = 99/441 (22%)

Query: 5   PLVLDNGSYEIKFGLSNSERP------------YRAL--NGFAVDKYGSAYLSNQMKKIQ 50
           P+VLDNGS  IK G S  E+P            Y  +   G A D   S  + N+ +K++
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASD---SQLIGNEAQKMR 67

Query: 51  EVSEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPE 110
            +  + L  P E G +  W     +W +  YN  +    E     +  ++++E  +   +
Sbjct: 68  GL--LKLHYPLEHGVVQDWPGLEQLWTHVFYNSLKLANIE-----EHPMLITEAPLNPMK 120

Query: 111 LSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVT 170
               M +++FE +   +++ +         +QA     +L   +G +             
Sbjct: 121 NRNKMCEMLFETFGSPAVYVS---------IQA-----VLALYAGGRTTG---------- 156

Query: 171 ISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLL 230
                                 VID G  C   +P+  G     AI+++D+ GR +T  L
Sbjct: 157 ---------------------CVIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFL 195

Query: 231 KETL---SFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
           +  L   S        E  +V  IKEK  FV+                     D+ +   
Sbjct: 196 QLLLRKSSGVTLSSSSEREIVRMIKEKACFVA--------------------TDVGNEEQ 235

Query: 288 GYTRENKSK-----PLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMI 342
            Y   N ++      LP+G +++ L  E F  PE  F P +       I E   +S+S +
Sbjct: 236 NYEGANSAELETRFKLPDG-KILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKV 294

Query: 343 PEILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMC 402
              LR  L ++IV +GG+     F              +   +I  P  E +  +W    
Sbjct: 295 DLDLRSSLYSSIVLSGGSTMFSGFGDRLLSEIRKTSEPNTKIKIFAP-PERKYSTWIGGS 353

Query: 403 QFANTDSYKKTRISKEEYYEH 423
             A   +++K  +++ E+ E+
Sbjct: 354 ILAGLSTFEKLWVTRAEWQEN 374

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 68/152 (44%), Gaps = 15/152 (9%)

Query: 297 PLPEGSQVVK------LYDELFSVPETFFHPEISRILKPGIVE----TILESLSMIPEIL 346
           P P  S+ V       L  E   VPE  F P I+   + GI E     +L+     P  L
Sbjct: 594 PRPHDSEDVHQQHQLHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNL 653

Query: 347 RPL---LVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQ 403
                 +V N+  TGGN  +P              P      + +  ++  L +WK M +
Sbjct: 654 SAASSRMVNNVWITGGNARIPGIKNRIVKEFTEFLPAGTPLSVHM-SEDPSLDAWKGMAK 712

Query: 404 FANTDS-YKKTRISKEEYYEHGPDWLTKHKFG 434
            AN ++ YK T ++++EY E+GPD++ +HK G
Sbjct: 713 LANNETDYKNTAVTRKEYEEYGPDYIKEHKLG 744

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 65/140 (46%), Gaps = 13/140 (9%)

Query: 310 ELFSVPETFFHPEISRILKPGIVE---TILESLSMIPEILRPL------LVANIVCTGGN 360
           E   VPE  F P I  + + G+VE   T+L  L       R L      +  N+  TGGN
Sbjct: 614 ERIRVPEVIFQPSIGGLDQAGVVELCETVL--LKKFDSSRRALSATCEKMAKNVFITGGN 671

Query: 361 FNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFA-NTDSYKKTRISKEE 419
             LP              P     ++++ K +  L +WK M +FA +  SYK + ++K E
Sbjct: 672 TKLPGIRERIVREFTGFLPVGTELKVTLAK-DPSLSAWKGMAKFASDPTSYKSSILTKRE 730

Query: 420 YYEHGPDWLTKHKFGYQNWL 439
           Y E+GP+++ +H  G   ++
Sbjct: 731 YEEYGPEYIKEHNLGNAKFM 750

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 70/166 (42%), Gaps = 28/166 (16%)

Query: 286 YLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVE---TIL------ 336
           +L   R + S+ + E  Q+  L  E   VPE  F P +    + GI E   TIL      
Sbjct: 594 FLRGPRPHDSENIHEQHQM-HLNVERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGS 652

Query: 337 -------ESLSMIPEILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVP 389
                   SL M         V NI+ TGGN  +P              P      +++ 
Sbjct: 653 QRGKLSSTSLDM---------VNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVNIS 703

Query: 390 KKECELFSWKSMCQFA-NTDSYKKTRISKEEYYEHGPDWLTKHKFG 434
                L +W+ M   A N   YKKT ISKEEY E+GPD++ +HK G
Sbjct: 704 SNPS-LDAWRGMAALARNKAEYKKTVISKEEYEEYGPDYIKEHKLG 748

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 92/450 (20%), Positives = 173/450 (38%), Gaps = 97/450 (21%)

Query: 3   STPLVLDNGSYEIKFGLSNSERP----YRALNGFAVDKY------GSAYLSNQMKKIQEV 52
           + P+VLDNGS  +K G    ++P    Y  +     DK          ++ N  ++ + +
Sbjct: 11  NQPIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGL 70

Query: 53  SEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112
             + LR P + G + +WE    +WD+        D  ++   G+  L+V+E  +      
Sbjct: 71  --LKLRYPMDHGIIENWEHMETVWDHIFK-----DCLKVSNLGEHPLVVTEAPLNPKPNR 123

Query: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172
           + M + +FE +   +L+ A  A             VL    SG+                
Sbjct: 124 EKMCETLFESFNIPALYIANPA-------------VLSLYASGRTTG------------- 157

Query: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232
                               V+++G      +P+ +G     +I+++DIGGR +T  L+ 
Sbjct: 158 -------------------CVVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQ- 197

Query: 233 TLSFRHYDLM-----DETLLVNNIKEKCLFVSPTSYFDSFK---AKEETSVEYILPDISS 284
            L  R    M      E  +V  IKE   ++      +  K    +E+ S+ + LPD  +
Sbjct: 198 -LQLRKSTGMWLYSSSEQEIVRLIKENGCYICSNHKKEEEKFLLDQEKKSISFKLPDGKN 256

Query: 285 SYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPE 344
             +G  R                    F  PE  F+P +       + + I++S+S +  
Sbjct: 257 LVIGPGR--------------------FRAPEILFNPLLIGSEDSSLPDMIMQSISKVDI 296

Query: 345 ILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRI-SVPKKECELFSWKSMCQ 403
            LR  L+ NI  +GG+     F                  RI + P+++   F   S+  
Sbjct: 297 DLRSKLLNNITLSGGSTMFQGFCDRLITELDFSVDKTTKVRILAPPERKYSAFIGGSI-- 354

Query: 404 FANTDSYKKTRISKEEYYEHGPDWLTKHKF 433
            AN  +++   ++K+++   G + + ++KF
Sbjct: 355 LANLSTFRNMWVTKDQW--EGDNRIIENKF 382

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 76/159 (47%), Gaps = 14/159 (8%)

Query: 286 YLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSM---- 341
           +L   R + S+ + E  Q+  L  E   VPE  F P I  + + GIVE + E+L +    
Sbjct: 586 FLRGPRSHDSESIHEQHQM-HLNVERIRVPEVIFQPSIGGLDQAGIVE-LCETLLLKKFG 643

Query: 342 -----IPEILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELF 396
                + EI + ++  NI  TGGN  LP              P      + + + +  + 
Sbjct: 644 SNRRELSEISK-MMAKNIFITGGNAKLPGIRERVVREFTGFLPVGTNLNVKLAE-DPSMS 701

Query: 397 SWKSMCQFANTDS-YKKTRISKEEYYEHGPDWLTKHKFG 434
           +W+ M +FAN  S Y+ + ++K+EY E GP+++ +H  G
Sbjct: 702 AWRGMAKFANNTSLYETSIMTKKEYEELGPEYIKEHNLG 740

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 62/129 (48%), Gaps = 9/129 (6%)

Query: 314 VPETFFHPEISRILKPGIVE----TILESLSMIPEILR---PLLVANIVCTGGNFNLPHF 366
           VPE  F P +    + GI+E     +L+     P  L      +  N+  TGG+  LP  
Sbjct: 622 VPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGL 681

Query: 367 XXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDS-YKKTRISKEEYYEHGP 425
                       P D    +++ K    L +WK M +F++ D+ +K + ISK+EY E+GP
Sbjct: 682 KTRIVKEFTSFLPNDAKFSVNISKHPS-LDAWKGMAKFSSDDADFKSSLISKKEYEEYGP 740

Query: 426 DWLTKHKFG 434
           +++ +H+ G
Sbjct: 741 EYIKEHRLG 749

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 62/138 (44%), Gaps = 9/138 (6%)

Query: 305 VKLYDELFSVPETFFHPEISRILKPGIVE----TILESLSMIPEILRPL---LVANIVCT 357
           + L  E   VPE  F P +  + + GI E     +L      P+ L  L   +  NI  T
Sbjct: 611 IHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELSLTMANNIWLT 670

Query: 358 GGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFA-NTDSYKKTRIS 416
           GGN  +P              P +    +++   +    +W  M + A N   YKKT IS
Sbjct: 671 GGNSKIPGLRERIVKEFREFLPVNTQFNVNMTS-DPTFDAWNGMAKLAQNETDYKKTIIS 729

Query: 417 KEEYYEHGPDWLTKHKFG 434
           K+EY E+GP+++ +HK G
Sbjct: 730 KKEYEEYGPEYIKEHKLG 747

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 61/134 (45%), Gaps = 12/134 (8%)

Query: 310 ELFSVPETFFHPEISRILKPGIVET---ILE------SLSMIPEILRPLLVANIVCTGGN 360
           E    PE  F P +  + + GI E    IL       S  +  + L   + +NI  TGGN
Sbjct: 611 ERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLD--MASNIFITGGN 668

Query: 361 FNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEY 420
             +P+             P +    ++  +    L +WK M +FA +D+Y  T ++K EY
Sbjct: 669 TKIPNLRERIVNEFTGFLPVNTPLNVNYAQN-VSLDAWKGMAKFARSDTYSSTCVTKVEY 727

Query: 421 YEHGPDWLTKHKFG 434
            E GP+++ +HK G
Sbjct: 728 EEFGPNYIKEHKLG 741

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 87/242 (35%), Gaps = 54/242 (22%)

Query: 3   STPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMK------KIQEVSEVT 56
           +TP+ LD GSYE++ G ++ + P        V +Y    +   +        +       
Sbjct: 39  NTPIALDFGSYEVRAGFTSQDTPSHVFPTKIV-RYKERKIQKALTFIGNDCSLDNAVRSH 97

Query: 57  LRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMD 116
            R P++   +T+WE    +  Y  ++     G +        +I++E   T+     N  
Sbjct: 98  SRSPYDGSLITNWEYMEDMLSYTFHHL----GVQPNDGISNPMILTEKMATVQAQRSNWY 153

Query: 117 QVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNL 176
           Q++FE Y             + FG+       L    +   N  D  G            
Sbjct: 154 QLLFECYGIPQ---------VTFGIDG-----LFSFYAN--NSPDSTG------------ 185

Query: 177 KDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSF 236
                          L+I+SG   T IIP+IKG       K++D GG      LK  LS 
Sbjct: 186 ---------------LIINSGHEDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSL 230

Query: 237 RH 238
           ++
Sbjct: 231 KY 232

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 77/332 (23%), Positives = 131/332 (39%), Gaps = 80/332 (24%)

Query: 5   PLVLDNGSYEIKFGLSNSERP----YRALNGFAVDKYGSAYLSNQMKKIQEVSE-----V 55
           P+VLDNGS  IK G S  E+P    Y  +     DK  +  LS++ + +   ++     +
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 56  TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNM 115
            L+ P E G +  W     +W +  Y+       +L   G   ++V+E  +   E    M
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYS-----SLKLNNIGDHPMLVTEAPLNPLENRDKM 125

Query: 116 DQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDN 175
            ++++E +   +++ +         +QA     +L   +G +                  
Sbjct: 126 CEMLYETFNVPAVYVS---------IQA-----VLALYAGGRTTG--------------- 156

Query: 176 LKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGR----FLTGLLK 231
                            VID G  C   +P+  G     AI+++D+ GR    FL  LL+
Sbjct: 157 ----------------CVIDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLR 200

Query: 232 ETLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTR 291
           +++         E  +V  IKEK  +V+P        A EE           +S  G   
Sbjct: 201 KSIGVTLLS-SSEREIVRMIKEKACYVAPEV------AAEEQKY--------ASSRGSEE 245

Query: 292 ENKSKPLPEGSQVVKLYDELFSVPETFFHPEI 323
             K K LP+G +++ L  E F  PE  F P++
Sbjct: 246 LTKFK-LPDG-KILSLGAEKFRAPEILFQPQL 275

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 70/157 (44%), Gaps = 10/157 (6%)

Query: 286 YLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVE----TILESLSM 341
           +L   R + S+ + E  Q+  L  E   VPE  F P +    + GI E     +L+    
Sbjct: 594 FLRGPRPHDSENIHEQHQM-HLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGS 652

Query: 342 IPEILRPL---LVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSW 398
            P  L      +  N+  TGGN  +P              P      I++   +  L +W
Sbjct: 653 QPGKLSQTSIDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININM-SSDPSLDAW 711

Query: 399 KSMCQFA-NTDSYKKTRISKEEYYEHGPDWLTKHKFG 434
           K M   A N + YK+T IS++EY E+GPD++ +HK G
Sbjct: 712 KGMAALAQNEEEYKRTIISRKEYEEYGPDYIKEHKLG 748

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 62/135 (45%), Gaps = 13/135 (9%)

Query: 310 ELFSVPETFFHPEISRILKPGIVE---TILESLSMIPEILRPL------LVANIVCTGGN 360
           E   VPE  F P +  + + GI+E   TI+  ++      R L      +  N+  TGGN
Sbjct: 610 ERIRVPEVIFQPPMGGLDQAGIIELSETII--MNKFGSSRRQLSSVSQEMANNVFLTGGN 667

Query: 361 FNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDS-YKKTRISKEE 419
             +P              P      I V      + +WK M +FA + + YK + ++K+E
Sbjct: 668 VRVPGLRDRIVREFTEFLPVGTKYNIKVASDPA-IDAWKGMAKFAQSSTDYKGSYVTKKE 726

Query: 420 YYEHGPDWLTKHKFG 434
           Y E+GPD++ +HK G
Sbjct: 727 YEEYGPDYIKEHKLG 741

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 59/132 (44%), Gaps = 8/132 (6%)

Query: 310 ELFSVPETFFHPEISRILKPGIVE----TILESLSMIPEILRPL---LVANIVCTGGNFN 362
           E   VPE  F P +    + G+ E     +L+     P  L      +  NI  +GGN  
Sbjct: 613 ERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAK 672

Query: 363 LPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEYYE 422
           +P              P      +++      L SWK M ++A ++ Y K+ I+K+EY E
Sbjct: 673 VPGLKNRIVKEFTSFLPVGTKLSVNMSSDPL-LDSWKGMAKWAKSEDYNKSFITKKEYEE 731

Query: 423 HGPDWLTKHKFG 434
           +GP+++ +HK G
Sbjct: 732 YGPEYIKEHKMG 743

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 101/253 (39%), Gaps = 38/253 (15%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R     D +L     I
Sbjct: 212 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEQDASLRTAERI 269

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F    E   ++I+            ENK +      +VV +  
Sbjct: 270 KQEYCYVCPDIVKEFNKFDRDSEKFAQFIV------------ENKERTT---KKVVDVGY 314

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFX 367
           E F  PE FF+PEI  S  L P  V  + E++   P  +R  L  NIV +GG+     F 
Sbjct: 315 ERFLAPEIFFNPEIASSDFLTPLPV-VVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFG 373

Query: 368 X--------------XXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKT 413
                                     T     +   K++     W      A T  +K  
Sbjct: 374 RRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAV-WFGGSLLAQTGEFKSY 432

Query: 414 RISKEEYYEHGPD 426
             +K++Y E+GPD
Sbjct: 433 CHTKQDYEEYGPD 445

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 63/144 (43%), Gaps = 9/144 (6%)

Query: 299 PEGSQVVKLYDELFSVPETFFHPEISRILKPGIVET----ILESLSMIPEILRPL---LV 351
           P     + +  E   VPE  F P I    + GI E      L   +  P  L  +   ++
Sbjct: 611 PHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERML 670

Query: 352 ANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFA-NTDSY 410
            N+  TGG+  LP              P      I++   +  L +WK M + A NTD  
Sbjct: 671 NNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINI-SNDPSLDTWKGMAKLASNTDYL 729

Query: 411 KKTRISKEEYYEHGPDWLTKHKFG 434
           KK +++K++Y E+GP+++ +H  G
Sbjct: 730 KKIQVTKKDYEEYGPEYMMEHNLG 753

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 94/240 (39%), Gaps = 51/240 (21%)

Query: 5   PLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMK------KIQEVSEVTLR 58
           P+ +D GSY +K G +N   P        + +Y    L+  M        + +   +  +
Sbjct: 38  PIAIDFGSYNVKAGYTNQSLPTHVFTN-KLTRYRDRKLAKTMTFIGNDTNLDQPLRIQAK 96

Query: 59  RPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQV 118
           RP++   + +WE    I+DY L++          GS    +I++E    L     N  Q+
Sbjct: 97  RPYDGLFIANWEYAEEIFDYTLHH---LGVQTTNGSISNPIILTEKMACLQSQRANWYQL 153

Query: 119 IFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKD 178
           +FE       F  P+A    FG         LD++    N+                   
Sbjct: 154 LFE------TFDVPSAT---FG---------LDSLYAFYNN------------------- 176

Query: 179 DKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRH 238
                +N ++   LVI+ G   T I+P+++G       K+++ GGR  T  L   L+ ++
Sbjct: 177 ----CANPFESDGLVINCGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLLTLKY 232

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 77/331 (23%), Positives = 130/331 (39%), Gaps = 78/331 (23%)

Query: 41  YLSNQMKKIQEVSEVTLRRPHELGQLTSWE-----LESCIWDYCLYNPDEFDGFELGGSG 95
           Y+ N+     + +  +L  P   GQ+ +W+      E+ I+ Y    P++          
Sbjct: 108 YIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFKYLRTEPED---------- 157

Query: 96  KKHLIVSEPCMTLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISG 155
               +++EP +  PE  + + ++ FE +    L+ A                +     S 
Sbjct: 158 -HFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIA----------VQAVLALAASWTSS 206

Query: 156 KKNDDDMIGQSENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKA 215
           K  D  + G                            VIDSG   T +IP+ +G     A
Sbjct: 207 KVVDRSLTGT---------------------------VIDSGDGVTHVIPVAEGYVIGSA 239

Query: 216 IKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNIKEKCLFVSP--TSYFDSFKAKEE 272
           +K + I GR +T  ++  L  R    +D +L     IK++  +V P     F+ F    E
Sbjct: 240 LKNIPIAGRDITQFIQSLL--RERGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAE 297

Query: 273 TSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEI--SRILKPG 330
              +Y++            EN+ K      +VV +  E F  PE FF+PEI  S  L P 
Sbjct: 298 KFAQYVV------------ENQDKTR---QKVVDIGYERFLAPEIFFNPEIASSDFLTP- 341

Query: 331 IVETIL-ESLSMIPEILRPLLVANIVCTGGN 360
            + T+L +++   P  +R  L  NIV +GG+
Sbjct: 342 -LPTVLDQTIQACPIDVRKGLYNNIVLSGGS 371

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 103/253 (40%), Gaps = 38/253 (15%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R     D +L     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLL--RERGEADSSLKTAERI 271

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F  + E   ++I+            EN+ K      +V+ +  
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRQPEKFAQFII------------ENQDKTT---KKVIDIGY 316

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFX 367
           E F  PE FF+PEI  S  L P +   + +++   P  +R  L  NIV +GG+     F 
Sbjct: 317 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFS 375

Query: 368 X--------------XXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKT 413
                                     T    ++   +K+     W      A T  +K  
Sbjct: 376 RRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAV-WFGGSLLAQTAEFKGY 434

Query: 414 RISKEEYYEHGPD 426
             +K++Y EHGP+
Sbjct: 435 CHTKKDYEEHGPE 447

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 91/439 (20%), Positives = 169/439 (38%), Gaps = 95/439 (21%)

Query: 5   PLVLDNGSYEIKFGLSNSERP------------YRALNGFAVDKYGSAYLSNQMKKIQEV 52
           P+VLDNGS  +K G S  E P            Y+ +    ++     ++ N+ ++++ +
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLED--RTFVGNEAQRLRGL 70

Query: 53  SEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGS----GKKHLIVSEPCMTL 108
             +   RP   G++T+W+    +W +  Y+       +LG      G   L+++E  +  
Sbjct: 71  LALR--RPISRGEVTNWDDMELLWSHIFYSK-----LQLGQGNSQIGDHPLLITEAPLNS 123

Query: 109 PELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSEN 168
            +  + M ++++E + FD+L+ A  A             VL    +G             
Sbjct: 124 TKNRETMCEILYETFNFDALYVAHPA-------------VLSLYATG------------- 157

Query: 169 VTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTG 228
                              Q    V++ G   +   P+ +G     +I+++DIGGR +T 
Sbjct: 158 -------------------QTTGCVLECGEGYSASTPVYQGFALPSSIRRIDIGGRDITQ 198

Query: 229 LL----KETLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISS 284
            L    +++     +    E  +V  IKEK  +V+       +K +EE            
Sbjct: 199 ELQFYIRKSTGLSLFS-NSEQEIVRTIKEKANYVAL-----DYKFEEE------------ 240

Query: 285 SYLGYTRENKSK-PLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIP 343
            +  + REN S   LP+G Q +      +   E  F P++       + E +LES++ + 
Sbjct: 241 KFFIHERENTSTVKLPDG-QELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVD 299

Query: 344 EILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQ 403
             LR  L+ NIV +GG   L  F            P     +I     E    +W     
Sbjct: 300 MDLRTQLLENIVLSGGTTMLKGFDQRTMSETKKMLPKHTKVKIR-SLAERSYIAWIGGSI 358

Query: 404 FANTDSYKKTRISKEEYYE 422
            +    ++   +++E Y E
Sbjct: 359 LSGLYGFRNLWLTREMYEE 377

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 82/174 (47%), Gaps = 25/174 (14%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R     D +L     I
Sbjct: 209 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEADTSLRTAERI 266

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F    E   +Y++            EN+ K      +VV +  
Sbjct: 267 KQEYCYVCPDIVKEFNKFDRDPEKFAQYVV------------ENQEKTQ---KKVVDVGY 311

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETIL-ESLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P  + TI+ +++   P  +R  L  NIV +GG+
Sbjct: 312 ERFLAPEIFFNPEIASSDFLTP--LPTIVDQTIQACPIDVRKGLYNNIVLSGGS 363

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 86/372 (23%), Positives = 142/372 (38%), Gaps = 87/372 (23%)

Query: 10  NGSYEIKFGLSNSERPYRALNGFAV-------DKYGSA----YLSNQMKKIQEVSEVTLR 58
           NGS    FG S S   +  L G  +        K G+     Y+ N+     +    +L 
Sbjct: 63  NGSSNPYFGNSTSATNFGGLTGGKMLLSNNLAGKRGTEDLDFYIGNEALVAAQSPSYSLS 122

Query: 59  RPHELGQLTSWE-----LESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSK 113
            P   GQ+ +W+      E+ I+ Y    P++            + +++EP +  PE  +
Sbjct: 123 YPIRHGQVENWDHMERFWENSIFKYLRTEPED-----------HYFLLTEPPLNPPENRE 171

Query: 114 NMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIST 173
            + ++ FE +    L+ A                +     S K  D  + G         
Sbjct: 172 QVAEIFFESFNCAGLYIA----------VQAVLALAASWTSSKVIDRSLTGT-------- 213

Query: 174 DNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKET 233
                              VIDSG   T +IP+ +G     AIK + I GR +T  ++  
Sbjct: 214 -------------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSL 254

Query: 234 LSFRHYDLMDETL-LVNNIKEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYT 290
           L  R     D +L     IK++  +V P     F+ F  + E   ++I+           
Sbjct: 255 L--RERGEADTSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIVES--------- 303

Query: 291 RENKSKPLPEGSQVVKLYDELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRP 348
            + K+K      +VV +  E F  PE FF+PEI  S  L P +   + +++   P  +R 
Sbjct: 304 -QEKTK-----QKVVDVGYERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDVRK 356

Query: 349 LLVANIVCTGGN 360
            L  NIV +GG+
Sbjct: 357 GLYNNIVLSGGS 368

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 23/173 (13%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R     D +L     I
Sbjct: 216 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 273

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F  + E   ++I+ +          ++K+K      +VV +  
Sbjct: 274 KQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN----------QDKTK-----QKVVDIGY 318

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P +   +  ++   P  +R  L  NIV +GG+
Sbjct: 319 ERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGS 370

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 74/373 (19%), Positives = 152/373 (40%), Gaps = 77/373 (20%)

Query: 5   PLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYGSAYLSNQMKKI-----QEVSEVT 56
           P++LDNGS  IK G + S++P     A  G  + +     +SN+   I     +  + + 
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERRATLH 71

Query: 57  LRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMD 116
           L  P+    + SW+    +WDY L N  E +  +     +  ++++    T  +  + M 
Sbjct: 72  LESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQ-----EHPVVLTNSMSTSKKEEEKMC 126

Query: 117 QVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNL 176
           +V+FE++   +++ +       +G                      +G++   ++S    
Sbjct: 127 EVLFEKFSIPAIYCSRDPIMSLYG----------------------LGRTTGCSVSC--- 161

Query: 177 KDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSF 236
                               G     I  +I G+    + +  + GG  +T  + + L  
Sbjct: 162 --------------------GHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRH 201

Query: 237 RHYDL---MDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTREN 293
            H  L    +   L+ +IKE+C  +S   +++  +A E  + +             T  N
Sbjct: 202 NHPKLENGQNGIELIRSIKERCCVLS-KDFYNEIRAYELITSK-------------TSNN 247

Query: 294 KSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVAN 353
           K + LP+G+ ++++  E F  PE  F+P+     +  + + I+ S+S    + R  L+ +
Sbjct: 248 KYR-LPDGN-IIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLES 305

Query: 354 IVCTGGNFNLPHF 366
           IV +GG+  +  F
Sbjct: 306 IVLSGGSSLIKGF 318

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 88/437 (20%), Positives = 159/437 (36%), Gaps = 94/437 (21%)

Query: 5   PLVLDNGSYEIKFGLSNSERP----YRALNGFAVDKY-------GSAYLSNQMKKIQEVS 53
           P+V+DNG+  IK G +   +P    Y  +     DK          +++ N+ +K + + 
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGI- 72

Query: 54  EVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSK 113
            + LR P   G + +W+    IW Y        D   L    +  ++++EP +      +
Sbjct: 73  -LKLRHPMLRGVVQNWDDMETIWQYVFD-----DTLYLENLNEHPILITEPPLNNMANRQ 126

Query: 114 NMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIST 173
            M + +FE + F +++ + +              VL    SG                  
Sbjct: 127 KMCEALFEIFGFPAVYISVSP-------------VLSLYASG------------------ 155

Query: 174 DNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLT-----G 228
                         Q     +D G      IP+  G     ++KK+DIGG  +T      
Sbjct: 156 --------------QTTGCAVDCGDGYCTSIPVYNGFSLASSVKKIDIGGCDITEQLQFS 201

Query: 229 LLKETLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFK---AKEETSVEYILPDISSS 285
           +LK T  F +     E  +V  IKEK  +++     ++ K    +E+ + ++ LPD    
Sbjct: 202 ILKNTGLFMYSS--SEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMASQFKLPD---- 255

Query: 286 YLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEI 345
                            +++ +    ++  E  F PE+       + E   +S+  +   
Sbjct: 256 ----------------GKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSD 299

Query: 346 LRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFA 405
           LR  L +NIV +GG    P F              D   RI  P  E +  SW      +
Sbjct: 300 LRLPLYSNIVLSGGTTMCPGFGSRLLKELQTLTGYDTKIRIIAP-PERKYTSWIGGSILS 358

Query: 406 NTDSYKKTRISKEEYYE 422
              ++ K  ++K  + E
Sbjct: 359 GLSTFSKIWVTKSMWEE 375

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 80/173 (46%), Gaps = 23/173 (13%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R    +D +L     I
Sbjct: 211 VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLL--RERGEVDTSLRTAERI 268

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F        ++I+            ENK K      +VV +  
Sbjct: 269 KQEYCYVCPDIVKEFNKFDRDATKFAQFIV------------ENKEK---TQKKVVDVGY 313

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P +   + +++   P  +R  L  NIV +GG+
Sbjct: 314 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGS 365

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 84/365 (23%), Positives = 139/365 (38%), Gaps = 88/365 (24%)

Query: 17  FGLSNSERPYRALNGFA------VDKYGSA----YLSNQMKKIQEVSEVTLRRPHELGQL 66
           FG S S   + +LN           K G+     Y+ N+     +    +L  P   GQ+
Sbjct: 62  FGNSTSATSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSYSLSYPIRHGQI 121

Query: 67  TSWE-----LESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIFE 121
            +W+      E+ I+ Y    P++              +++EP +  PE  + + ++ FE
Sbjct: 122 ENWDHMERFWENSIFKYLRTEPED-----------HFFLLTEPPLNPPENREQVAEIFFE 170

Query: 122 EYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDKK 181
            +    L+ A                +     S K  D  + G                 
Sbjct: 171 SFNCAGLYIA----------VQAVLALAASWTSSKVTDRSLTGT---------------- 204

Query: 182 KFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDL 241
                      VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R    
Sbjct: 205 -----------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGE 251

Query: 242 MDETL-LVNNIKEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPL 298
            D +L     IK++  +V P     F+ F    +   ++I+            EN+ K  
Sbjct: 252 TDTSLRTAERIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIV------------ENQEK-- 297

Query: 299 PEGSQVVKLYDELFSVPETFFHPEI--SRILKPGIVETILE-SLSMIPEILRPLLVANIV 355
               ++V +  E F  PE FF+PEI  S  L P  + TI++ ++   P  +R  L  NIV
Sbjct: 298 -TQKKIVDVGYERFLAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYNNIV 354

Query: 356 CTGGN 360
            +GG+
Sbjct: 355 LSGGS 359

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 81/173 (46%), Gaps = 23/173 (13%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R     D +L     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 267

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F    E   ++++ +  S     TR+          ++V +  
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQES-----TRK----------KIVDVGY 312

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P +   + +++   P  +R  L  NIV +GG+
Sbjct: 313 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGS 364

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 84/174 (48%), Gaps = 25/174 (14%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  +++ L  R  +  D +L     I
Sbjct: 217 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLLRERGEE--DTSLRTAERI 274

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F    E   ++++            E++ K      +VV +  
Sbjct: 275 KQEYCYVCPDIVKEFNKFDRDSEKFAQFVV------------ESQEKTR---RKVVDVGC 319

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILE-SLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P  + TI++ ++   P  +R  L  NIV +GG+
Sbjct: 320 ERFMAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYNNIVLSGGS 371

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 80/173 (46%), Gaps = 23/173 (13%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  +++ L  R     D +L     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEQDTSLKTAERI 267

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F        ++++          ++E   K      ++V +  
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDASKFAQFVVE---------SQEKTRK------KIVDVGY 312

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P +   + E++   P  +R  L  NIV +GG+
Sbjct: 313 ERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVLSGGS 364

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 79/173 (45%), Gaps = 23/173 (13%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R     D +L     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F        ++++            EN+ K      +VV +  
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRDPSKFAQFVV------------ENQEKTR---RKVVDIGY 307

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P +   + +++   P  +R  L  NIV +GG+
Sbjct: 308 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGS 359

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 79/173 (45%), Gaps = 23/173 (13%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R     D +L     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F        ++++            EN+ K      +VV +  
Sbjct: 263 KQEYCYVCPDIVKEFNKFDKDPSKFAQFVV------------ENQEKTR---RKVVDIGY 307

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P +   + +++   P  +R  L  NIV +GG+
Sbjct: 308 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGS 359

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 59/135 (43%), Gaps = 13/135 (9%)

Query: 310 ELFSVPETFFHPEISRILKPGI---VETILESLSMIPEILRPL------LVANIVCTGGN 360
           E   VPE  F P +    + GI    ET+L  L       R L      +  N+  TGGN
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLL--LRKFGSTQRQLSDVSTSMAQNVWITGGN 668

Query: 361 FNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFA-NTDSYKKTRISKEE 419
             LP              P+     I    ++  L +W+ M + A NT+ +K   I+K+E
Sbjct: 669 AKLPGLRERIVKEFSEFLPSGSPFSIR-KSQDPSLDAWRGMAKLAQNTEDFKHGYITKQE 727

Query: 420 YYEHGPDWLTKHKFG 434
           Y E+GP+++ +H  G
Sbjct: 728 YLEYGPEYIKEHNLG 742

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 83/174 (47%), Gaps = 25/174 (14%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R    +D +L     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 271

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F        ++I+            EN+ K      ++V +  
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRDVGKFSQFII------------ENQGKTQ---KKIVDVGY 316

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILE-SLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P  + TI++ ++   P  +R  L +NIV +GG+
Sbjct: 317 ERFLAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYSNIVLSGGS 368

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 79/173 (45%), Gaps = 23/173 (13%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R     D +L     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F        ++++            EN+ K      +VV +  
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRDPSKFAQFVV------------ENQEKTR---RKVVDIGY 307

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P +   + +++   P  +R  L  NIV +GG+
Sbjct: 308 ERFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIVLSGGS 359

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 79/173 (45%), Gaps = 23/173 (13%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R    +D +L     I
Sbjct: 212 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLRTAERI 269

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F        ++I+ +  S+                 ++V +  
Sbjct: 270 KQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSESTK---------------KKIVDVGY 314

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P +   + +++   P  +R  L  NIV +GG+
Sbjct: 315 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGS 366

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 81/174 (46%), Gaps = 25/174 (14%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R  +  D TL     I
Sbjct: 201 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEE--DTTLRTAERI 258

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V       F+ F    E   ++I+            EN  K      +V+ +  
Sbjct: 259 KQEYCYVCSDIVKEFNKFDRDSEKFAQFIV------------ENSEKTR---RKVIDVGY 303

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETIL-ESLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P  + TI+ +++   P  +R  L  NIV +GG+
Sbjct: 304 ERFLAPEIFFNPEIASSDFLTP--LPTIVDQTIQACPIDVRKGLYNNIVLSGGS 355

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 79/173 (45%), Gaps = 23/173 (13%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R    +D +L     I
Sbjct: 218 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 275

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F        ++I+            EN+ +      +VV +  
Sbjct: 276 KQEYCYVCPDIVKEFNKFDRDGSKFAQFIV------------ENQEQTR---KKVVDVGY 320

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P +   +  ++   P  +R  L  NIV +GG+
Sbjct: 321 ERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGS 372

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 78/173 (45%), Gaps = 23/173 (13%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R     D +L     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V P     F+ F        ++++            EN+ K      + V +  
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRDPSKFAQFVV------------ENQEKTR---RKAVDIGY 307

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P +   + +++   P  +R  L  NIV +GG+
Sbjct: 308 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGS 359

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 68/158 (43%), Gaps = 12/158 (7%)

Query: 286 YLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVE--------TILE 337
           +L   R + S+ + E  Q+  L  E   VPE  F P ++ + + G+ E            
Sbjct: 586 FLRGPRPHDSENINEQHQM-HLNVERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGS 644

Query: 338 SLSMIPEILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFS 397
           + S + E  + L  AN+  TGGN  LP              P      + +   +  + +
Sbjct: 645 TRSQLSEGSKKL-AANVFLTGGNMRLPGVRERIVREFTGMLPMGSNLNVRMAS-DSAVDA 702

Query: 398 WKSMCQFANTDS-YKKTRISKEEYYEHGPDWLTKHKFG 434
           W+ M + +   S YK + I+++EY E G D++ +H  G
Sbjct: 703 WRGMAKLSQAGSQYKGSYITRKEYQELGADYIKEHNLG 740

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 47/246 (19%), Positives = 92/246 (37%), Gaps = 62/246 (25%)

Query: 3   STPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTL----- 57
           + P+ +D GS E++ G  N ++P        + ++     +  +  I   + + L     
Sbjct: 36  NVPIAIDFGSSEVRAGFGNQDQPSHIFTN-RISRWRDRRKNRNLTFIGNDTNLDLSVRSQ 94

Query: 58  -RRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH----LIVSEPCMTLPELS 112
            + P++   +++W+    I +Y  ++        LG +G       ++++E   TL    
Sbjct: 95  AKSPYDGAIVSNWDYTEEIMEYTFHH--------LGVNGNDGVSNPILMTEKLATLQSQR 146

Query: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172
           +N  Q++FE       F  P    + FG+                  D +     N    
Sbjct: 147 ENWYQLLFE------CFGVPQ---VTFGI------------------DSLFSFYAN---- 175

Query: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232
                       ND     LVI+SG   T +IP++ G       K+++ GGR     L  
Sbjct: 176 ------------NDATASGLVINSGNEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSN 223

Query: 233 TLSFRH 238
            L+ ++
Sbjct: 224 LLALKY 229

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 79/173 (45%), Gaps = 23/173 (13%)

Query: 193 VIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-LVNNI 251
           VIDSG   T +IP+ +G     AIK + I GR +T  ++  L  R  +  D TL     I
Sbjct: 207 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEE--DTTLRTAERI 264

Query: 252 KEKCLFVSP--TSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           K++  +V       F+ F    +   ++I+            EN  K      +V+ +  
Sbjct: 265 KQEYCYVCSDIVKEFNKFDRDPQKFAQFIV------------ENSEK---TKRKVIDVGY 309

Query: 310 ELFSVPETFFHPEI--SRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360
           E F  PE FF+PEI  S  L P +   + +++   P  +R  L  NIV +GG+
Sbjct: 310 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGS 361

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 55/132 (41%), Gaps = 9/132 (6%)

Query: 310 ELFSVPETFFHPEISRILKPGIVET----ILESLSMIPEILRPL---LVANIVCTGGNFN 362
           E   VPE  F P +    + GI E     I +     P  L      +  N+   GGN  
Sbjct: 617 ERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLVGGNAQ 676

Query: 363 LPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSWKSMCQFANTDS-YKKTRISKEEYY 421
           +P              P+D    +++ +    L  W  M + ANT+  Y++T ++ EEY 
Sbjct: 677 VPGLKSRVVKEFTEFLPSDTKINVNISEAPT-LDVWNGMYRLANTEEDYQRTIVTSEEYD 735

Query: 422 EHGPDWLTKHKF 433
           E G D+L +HK 
Sbjct: 736 ECGVDYLKEHKL 747

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 53/126 (42%), Gaps = 9/126 (7%)

Query: 3   STPLVLDNGSYEIKFGLSNSERPYRAL-NGFA--VDKYGSAYLS--NQMKKIQEVSEVTL 57
           + P+ +D GSYE++ G +N  RP     N F+   D+  + YL        + + +    
Sbjct: 40  NIPIAIDFGSYELRAGYTNISRPSHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTTRSQA 99

Query: 58  RRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQ 117
           R P +   + +W++   I  Y  ++     G +        +I++E    L     N  Q
Sbjct: 100 RSPFDGPLVVNWDMVEDILQYTFHHL----GVQPDNGVTNPIIINEKLACLQSQRSNWYQ 155

Query: 118 VIFEEY 123
            +FE +
Sbjct: 156 TLFESF 161

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 68/157 (43%), Gaps = 10/157 (6%)

Query: 286 YLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGI---VETILES-LSM 341
           +L   R + S+ + E  Q+  L  E   VPE  F P I    + GI    ETIL +    
Sbjct: 591 FLRGPRPHDSENIHEQHQL-HLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGS 649

Query: 342 IPEILRPL---LVANIVCTGGNFNLPHFXXXXXXXXXXXXPTDWTCRISVPKKECELFSW 398
            P  L      +  NI  TGG+  LP              P      + + K    L +W
Sbjct: 650 KPRELSETSLGMAKNIWLTGGHSKLPGLRERIVKEFTGFLPVGTKLGVKMSKNPS-LDAW 708

Query: 399 KSMCQFANTDS-YKKTRISKEEYYEHGPDWLTKHKFG 434
             M + A  ++ YK + ISK++Y E+G +++ +HK G
Sbjct: 709 YGMRKLAQNEADYKDSIISKKDYEEYGAEYIKEHKLG 745

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 89/246 (36%), Gaps = 64/246 (26%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRAL-NGFAVDK----------YGSAYLSNQMKKIQEV 52
           TP+ +D GSYE++ G ++S  P     N     +           G+  L +Q  + Q  
Sbjct: 37  TPIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRHRDRKLSKTFTFIGNDVLLDQTVRSQSK 96

Query: 53  SEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112
           S      P +   + +W+    I  Y   +     G     S +  LI++EP  +L    
Sbjct: 97  S------PFDGSFIANWDYVEDIMQYTFNHL----GVVGDNSVRNPLIINEPLGSLQSQR 146

Query: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172
           KN  +++FE       F  P    + FG+                  D M G   N   +
Sbjct: 147 KNWYELLFE------CFHLPN---VSFGI------------------DGMFGFYANNEGN 179

Query: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232
            D                 +VI+     T +IP++ G       K+++ GGR     L +
Sbjct: 180 QDG----------------IVINCSNEETDVIPVVDGRGVLTDAKRINWGGRQAVDYLSD 223

Query: 233 TLSFRH 238
            +S ++
Sbjct: 224 LMSLKY 229

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 92/243 (37%), Gaps = 58/243 (23%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMK-KIQEVSEVTLRRPH- 61
           T +V+D GSY    G S S+ P   +         +A   NQ K K+     + L RP  
Sbjct: 13  TSIVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLARPDY 72

Query: 62  ------ELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNM 115
                 E G++  W+     WD+ L N    + F    SG   ++++EP     E  K  
Sbjct: 73  EIKRIVENGEIADWDTAQEQWDWVLKN----ELFLKSNSGIP-VLLTEPIWNSVENRKKS 127

Query: 116 DQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDN 175
            +V+ E  +F++ + +P +  + F              +G+ N                 
Sbjct: 128 LEVLLEGMDFEACYLSPVSTCVSFA-------------AGRPNC---------------- 158

Query: 176 LKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLS 235
                           LV+D G + T + P+I G+   K+  +  I GR++  L++  L 
Sbjct: 159 ----------------LVVDIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLK 202

Query: 236 FRH 238
            R 
Sbjct: 203 PRE 205

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 88/238 (36%), Gaps = 61/238 (25%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKI-QEVSEVTLRRPHE 62
           + +V+D GSY    G S S+ P   L       YG        KKI  E S    R+ +E
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGNKKIFSEQSIGIPRKDYE 70

Query: 63  L------GQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMD 116
           L      G +  W+     W + L N        L  +     +++EP     E  K   
Sbjct: 71  LKPIIENGLVIDWDTAQEQWQWALQNE-----LYLNSNSGIPALLTEPVWNSTENRKKSL 125

Query: 117 QVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNL 176
           +V+ E  +F++ + APT+  + F              +G+ N                  
Sbjct: 126 EVLLEGMQFEACYLAPTSTCVSFA-------------AGRPNC----------------- 155

Query: 177 KDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETL 234
                          LV+D G +   + P++ G+   K+ ++  I G+F+  L+K+ L
Sbjct: 156 ---------------LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 80/372 (21%), Positives = 132/372 (35%), Gaps = 115/372 (30%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRPHEL 63
           T +V+D GS+    G S ++ P   L       YG      + +   E S    R+ +E+
Sbjct: 15  TAVVIDPGSFTTNIGYSGTDCPQAILPSC----YGKYTEGEKDELFSEQSIGLPRKDYEI 70

Query: 64  ------GQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQ 117
                 G++  WE     WD+ + +   F+      SG   L+ +EP     E  K   +
Sbjct: 71  HNIVQNGEVVDWEKAEKQWDWAIRSELRFET----NSGMPALL-TEPIWNSEENRKKSLE 125

Query: 118 VIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLK 177
           V+ E  +F + +  PTA  + F +             G+                     
Sbjct: 126 VLLESMDFSACYLVPTATAVSFAM-------------GRPTC------------------ 154

Query: 178 DDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFR 237
                         LV+D G + T + P++ G+   K+  +  I G  L  L++  L+ R
Sbjct: 155 --------------LVVDIGHDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPR 200

Query: 238 H--------------------YDL-------MDETLLVNNIKEKCLFVSPTSYFDSFKAK 270
                                Y++       ++E       KE  L V+PTS    FK++
Sbjct: 201 KVIPLFQVAQRRPVFMERKFDYEIHPSLQKFVNERQFFQEFKETMLQVAPTS-ISKFKSE 259

Query: 271 EETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYDEL--FSVPETFFHPEISR--- 325
            ET+                   +S   P G ++V  YD L      E  F P++S+   
Sbjct: 260 IETT-----------------SKRSIEAPWGEELV--YDSLQRLEFAEQLFTPDLSQFPE 300

Query: 326 ---ILKPGIVET 334
              I K G+VET
Sbjct: 301 DWPISKDGVVET 312

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 42/105 (40%), Gaps = 1/105 (0%)

Query: 330 GIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPT-DWTCRISV 388
           G+ + I  S+      LR  L  N+V TGG  +LP              P   +    S 
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 389 PKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGPDWLTKHKF 433
             +E +   W      A+  ++ +  + K+EY E G D L K +F
Sbjct: 434 QLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 91/239 (38%), Gaps = 63/239 (26%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKK--IQEVSEVTLRRPH 61
           + +V+D GSY    G S S+ P   L       YG  Y +++ KK    E S    R+ +
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGK-YTADEGKKNIFSEQSIGIPRKDY 69

Query: 62  EL------GQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNM 115
           EL      G +  W+     W + L N        L  +     +++EP     E  K  
Sbjct: 70  ELKPIVKDGLVIDWDTAQEQWQWALKNE-----LYLNSNSGTPALLTEPVWNSTENRKKS 124

Query: 116 DQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDN 175
            +V+ E  +F++ + APT+  + F              +G+ N                 
Sbjct: 125 LEVLLEGMQFEACYLAPTSTCVSFA-------------AGRPNC---------------- 155

Query: 176 LKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETL 234
                           LV+D G +   + P++ G+   K+ ++  + G+F+  L+K+ L
Sbjct: 156 ----------------LVVDIGHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 89/238 (37%), Gaps = 61/238 (25%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKI-QEVSEVTLRRPHE 62
           + +V+D GSY    G S S+ P   L       YG +      K I  E S    R+ +E
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKSTSDKDSKTIFSEQSIGIPRKDYE 70

Query: 63  L------GQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMD 116
           L      G +  W+     W + L N    D      SG   L+ +EP     E  K   
Sbjct: 71  LKPIIENGLVIDWDTAQEQWQWALKNELYLDS----NSGIPALL-TEPVWNSTENRKKSL 125

Query: 117 QVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNL 176
           +V+ E  +F++ + APT+  + F              +G+ N                  
Sbjct: 126 EVLLEGMQFEACYLAPTSTCVSFA-------------AGRPNC----------------- 155

Query: 177 KDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETL 234
                          LV+D G +   + P++ G+   K+ ++  I G+F+  L+K+ +
Sbjct: 156 ---------------LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 42/105 (40%), Gaps = 1/105 (0%)

Query: 330 GIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPT-DWTCRISV 388
           G+ + +  S+      LR  L  N+V TGG  ++P              P+  +    + 
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 389 PKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGPDWLTKHKF 433
             +E +  SW       +  ++ +  + K+EY E G D L   +F
Sbjct: 444 HTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 89/238 (37%), Gaps = 61/238 (25%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKI-QEVSEVTLRRPHE 62
           + +V+D GSY    G S S+ P   L       YG        KK+  E S    R+ +E
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKLTADENSKKMFSEQSIGIPRKDYE 70

Query: 63  L------GQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMD 116
           L      G +  W+     W + L N    D      SG   L+ +EP     E  K   
Sbjct: 71  LKPIIENGLVIDWDTAQEQWQWALRNELYLDS----NSGIPALL-TEPVWNSMENRKKSL 125

Query: 117 QVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNL 176
           +V+ E  +F++ + APT+  + F              +G+ N                  
Sbjct: 126 EVLLEGMQFEACYLAPTSTCVSFA-------------AGRPNC----------------- 155

Query: 177 KDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETL 234
                          LV+D G +   + P++ G+   K+ ++  I G+F+  L+++ L
Sbjct: 156 ---------------LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 75/185 (40%), Gaps = 11/185 (5%)

Query: 250 NIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYD 309
           NIK+K    +  +  D   +KE T+   + P  + +      EN  + + +G  V     
Sbjct: 421 NIKDKENNNNGNNNNDE-TSKEHTADAILAPTNADTPSENINENGKRSIEDGENV----- 474

Query: 310 ELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFXXX 369
               VP+     +I  I+ PGI + +  +++     LR  L  N++ TGG   +P     
Sbjct: 475 ---DVPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADR 530

Query: 370 XXXXXXXXXPT-DWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGPDWL 428
                    P   +    S  ++E +  +W       +  ++ +  + K EY E GPD L
Sbjct: 531 LMYELNKKLPALKFRILSSGHRRERKYQAWLGGSILTSLGTFHQLWVGKREYEEVGPDRL 590

Query: 429 TKHKF 433
            K +F
Sbjct: 591 LKDRF 595

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 45/106 (42%), Gaps = 1/106 (0%)

Query: 329 PGIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPT-DWTCRIS 387
           PGIV+ I  S+      LR  L  NIV TGG   +P F            P   +    +
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLTT 454

Query: 388 VPKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGPDWLTKHKF 433
              +E +  +W      ++  ++ +  + K+EY E G D L K +F
Sbjct: 455 GQTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESGADRLLKDRF 500

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 56/259 (21%), Positives = 91/259 (35%), Gaps = 78/259 (30%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYL-----------------SNQM 46
           + +V+D GS+    G S ++ P   L  +    YG   L                 +N+ 
Sbjct: 15  SAVVIDPGSFTTNIGYSGTDCPQAILPSY----YGEISLKEVASEGNEEIEENSASNNKS 70

Query: 47  KKI-QEVSEVTLRRPHEL------GQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHL 99
           KKI  E S    R  +E+      G++  W+     WD+ L N        L  +     
Sbjct: 71  KKIFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKN-----ALYLESNSGIPA 125

Query: 100 IVSEPCMTLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKND 159
            ++EP     E  K   +V+ E  +F++ + +PT   I F              SG+ N 
Sbjct: 126 FLTEPIWNTVENRKKSLEVLLEGLQFEACYLSPTPTCISFA-------------SGRPNC 172

Query: 160 DDMIGQSENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKL 219
                                           LV+D G +   + P+I G+   K+  + 
Sbjct: 173 --------------------------------LVVDIGHDVASVSPVIDGMTLSKSSMRN 200

Query: 220 DIGGRFLTGLLKETLSFRH 238
            I GRF+   +KE L  R 
Sbjct: 201 FISGRFINEKIKEFLKPRE 219

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 44/105 (41%), Gaps = 1/105 (0%)

Query: 330 GIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPT-DWTCRISV 388
           G+ + I  S+      LR  L  N+V TGG+ ++P              P   +    S 
Sbjct: 375 GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTSG 434

Query: 389 PKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGPDWLTKHKF 433
             +E +  SW      A+  ++ +  + K+EY E G D L K +F
Sbjct: 435 QAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 75/368 (20%), Positives = 133/368 (36%), Gaps = 106/368 (28%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKK--IQEVSEVTLRRPH 61
           T +++D GS+    G S ++ P   L       YG  Y++++ K     E S    R+ +
Sbjct: 15  TAIIIDPGSFNTNIGYSGTDCPQAILPSC----YGQ-YINDEEKPSLFNEQSIGLPRKDY 69

Query: 62  EL------GQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNM 115
           E+      G++  W+     W++ + +   F+       G   L+ +EP     +  K  
Sbjct: 70  EIKEIVRSGEVVDWDKAQEQWEWAIKSVLLFES----NKGLPALL-TEPIWNSEDNRKKS 124

Query: 116 DQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDN 175
            +V+ E  +F++ +  PTA  + F +             G+                   
Sbjct: 125 LEVLLEGMDFEACYLTPTATAVSFAM-------------GRPTC---------------- 155

Query: 176 LKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLS 235
                           LV+D G + T + P+I G+   K+  +  I G  L  L++ +L 
Sbjct: 156 ----------------LVVDIGHDITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLK 199

Query: 236 FRH------------------YDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEY 277
            R                   +D      L+N       FV+   +F  FK       E 
Sbjct: 200 PREILPLFQVAKKRPEFVKRSFDYEIHPSLLN-------FVNERQFFQEFK-------ET 245

Query: 278 ILPDISSSYLGYTRE-----NKSKPLPEGSQVVKLYDELFSVPETFFHPEISR------I 326
           +L    +S   +  E      +S   P G  +V   +  F++ E  F PE ++      I
Sbjct: 246 MLQVAPTSLTKFKSELEQLSKRSIEAPWGEDLVFDSETRFNIAEQLFRPETAKFPEDWPI 305

Query: 327 LKPGIVET 334
            K G+VET
Sbjct: 306 SKDGVVET 313

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 44/105 (41%), Gaps = 1/105 (0%)

Query: 330 GIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPT-DWTCRISV 388
           GIV+ I +S+      LR  L  N+V TGG   +P              P   +    S 
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSG 474

Query: 389 PKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGPDWLTKHKF 433
             +E +   W      A+  ++ +  + +EEY E GP+ L K +F
Sbjct: 475 HLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 61/143 (42%), Gaps = 17/143 (11%)

Query: 192 LVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHY-----------D 240
           LV+D G + + + P+I G+   K+  +  + G++L  L+ + L  R             D
Sbjct: 156 LVVDIGHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREIVPIFQVLKKKPD 215

Query: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLG--YTRENKSKPL 298
            +  TL  +  +    F +   +F  FK     ++ +I P   SS+     T+  +S   
Sbjct: 216 FVKRTLSFDVNESVINFANERQFFQEFKE----TLLHIAPKSLSSFKDELATQTKRSLEA 271

Query: 299 PEGSQVVKLYDELFSVPETFFHP 321
           P G +++   D  +S  E  F P
Sbjct: 272 PWGEELIFDADTRYSFAEQLFRP 294

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 44/106 (41%), Gaps = 1/106 (0%)

Query: 329 PGIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPT-DWTCRIS 387
           PGIV+ I  S++     LR  L  N+V TGG   +P              P   +    +
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLAN 456

Query: 388 VPKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGPDWLTKHKF 433
              +E +  SW      ++  ++ +  + K+EY E G D L   +F
Sbjct: 457 GQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 59/143 (41%), Gaps = 11/143 (7%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNG-----FAVDKYGSAYLSNQMKKIQEVSEVTLR 58
           + +V+D GSY    G S ++ P   +        A  K G    ++Q   I    +  ++
Sbjct: 15  SAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQF-MIMPRPDFEIK 73

Query: 59  RPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQV 118
           R  E G +  WE     W + + +  +F+ F+          ++E      E  K   +V
Sbjct: 74  RILENGCVVDWEAAQEQWAWAIRDELKFESFK-----GTPAFLTEAIWNPEENRKKSLEV 128

Query: 119 IFEEYEFDSLFKAPTAGYIPFGV 141
           + E  EF++ + APTA    F +
Sbjct: 129 LLEGMEFEACYIAPTATCTSFAM 151

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 60/145 (41%), Gaps = 15/145 (10%)

Query: 4   TPLVLDNGSYEIKFGLSNSERP-------YRALNGFAVDKYGSAYLSNQMKKIQEVSEVT 56
           + +V+D GSY    G S ++ P       Y    G   +K G    ++Q   +    +  
Sbjct: 15  SAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGG--EKEGKKSFNDQFMGMAR-PDFE 71

Query: 57  LRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMD 116
           ++R  E G +  WE     W + + +  +F  F+          ++E      E  K   
Sbjct: 72  IKRILEDGCVVDWEAAQEQWTWAIRDELKFGSFK-----GTPAFLTEAIWNSEENRKKSL 126

Query: 117 QVIFEEYEFDSLFKAPTAGYIPFGV 141
           +V+ E  EF++ + APTA  + F +
Sbjct: 127 EVLLEGMEFEACYIAPTATCVSFAM 151

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 50/258 (19%), Positives = 93/258 (36%), Gaps = 80/258 (31%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQ-------------MKKIQ 50
           + +V+D GSY    G S ++ P+  L      +YGS   +N+              K+  
Sbjct: 15  SAVVIDPGSYSTNIGYSGTDCPHSIL----PSRYGSFKKTNKDSGDEDTKSDESATKRAH 70

Query: 51  EVSEVTLRRPH---------ELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHL-- 99
             SE +L  P          E G +T W+     W++ L N       EL     K +  
Sbjct: 71  IFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKN-------ELFLESTKGIPA 123

Query: 100 IVSEPCMTLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKND 159
           +++EP     +  K   + + E   F++ + APT+  + F              +G+ N 
Sbjct: 124 LLTEPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFA-------------TGRANC 170

Query: 160 DDMIGQSENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKL 219
                                           LV+D G +   + P++ G+   K+ ++ 
Sbjct: 171 --------------------------------LVVDIGHDTCSVSPVVDGMTLSKSTRRS 198

Query: 220 DIGGRFLTGLLKETLSFR 237
              G+++  L++  L  R
Sbjct: 199 FFAGKYINHLIENFLKPR 216

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 40/105 (38%), Gaps = 1/105 (0%)

Query: 330 GIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPT-DWTCRISV 388
           G+ + +  S+      LR  L  N+  TGG   +P              P   +    + 
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 389 PKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGPDWLTKHKF 433
            KKE E  SW       +  ++ +  + ++EY E G D L   +F
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 67/323 (20%), Positives = 113/323 (34%), Gaps = 85/323 (26%)

Query: 192 LVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRH------------- 238
           LV+D G +     P++ G+   ++ ++  I G+F+  L+ + L  R              
Sbjct: 164 LVVDVGHDTASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKYLQPREIIPLFEIAQRRPE 223

Query: 239 --------------YDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSV--------- 275
                         Y+  +E       KE    ++PT+  D FK + E++          
Sbjct: 224 FKKKNFEFNIDPSLYNFANERGFFQECKETLCQIAPTT-LDKFKPELESTAKRSIEAPWT 282

Query: 276 EYILPDISSSYLGYTRE---NKSKPLPEGSQVVKLYDELFS------VPETFFHPEISRI 326
           E I+ D  S Y G+  +    +S+ +PEG  V K  D +        VP     P  S+ 
Sbjct: 283 EEIVFDNPSRY-GFAEQLFYPQSEDIPEGWPVSK--DGIVETWHNDYVPLKRNKPSGSKP 339

Query: 327 LKP-----------------------------------GIVETILESLSMIPEILRPLLV 351
            KP                                   GI + +  S++     LR  L 
Sbjct: 340 EKPNGEETPSGEDQASTSETTNEHGKRPMEDSESSELAGISDLVHSSITSADVDLRATLA 399

Query: 352 ANIVCTGGNFNLPHFXXXXXXXXXXXXPT-DWTCRISVPKKECELFSWKSMCQFANTDSY 410
            NIV TGG+ ++P F            P   +    +   +E +  SW       +  S+
Sbjct: 400 HNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTGHLRERQYQSWLGGSILTSLGSF 459

Query: 411 KKTRISKEEYYEHGPDWLTKHKF 433
            +  + K EY E G + L   +F
Sbjct: 460 HQLWVGKREYEEVGAERLLNDRF 482

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 1/89 (1%)

Query: 346 LRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPT-DWTCRISVPKKECELFSWKSMCQF 404
           LR  L  NIV TGG  ++P F            P   +    +   +E +  +W      
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLRERQYQAWLGGSIL 450

Query: 405 ANTDSYKKTRISKEEYYEHGPDWLTKHKF 433
            +  S+ +  + K+EY E GPD L   +F
Sbjct: 451 TSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 55/142 (38%), Gaps = 8/142 (5%)

Query: 293 NKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVA 352
           N + PLPE S       +  +        +I R   PGIV+ I  S+S     +R  L  
Sbjct: 358 NTATPLPESSSTTNENGKRTA-------EDIKREELPGIVDLISSSISSCDVDIRASLAH 410

Query: 353 NIVCTGGNFNLPHFXXXXXXXXXXXXPT-DWTCRISVPKKECELFSWKSMCQFANTDSYK 411
           N+V TGG+  +P              P   +    +    E +  SW      ++  ++ 
Sbjct: 411 NLVITGGSSTIPGLSDRILNELNMKFPALKFRVLATGQSIERQYQSWLGGSILSSLGTFH 470

Query: 412 KTRISKEEYYEHGPDWLTKHKF 433
           +  I K+EY E G + L   + 
Sbjct: 471 QLWIGKKEYEEVGSERLLHDRL 492

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 42/105 (40%), Gaps = 1/105 (0%)

Query: 330 GIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPT-DWTCRISV 388
           G+ + I  S+      LR  L  N+V TGG  ++P              P   +    S 
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTSG 451

Query: 389 PKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGPDWLTKHKF 433
             KE +  SW      ++  ++ +  + K+EY E G   L K +F
Sbjct: 452 HLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 60/165 (36%), Gaps = 20/165 (12%)

Query: 270 KEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKP 329
           K+ T    + P I++  L  T EN  + +   S++ K                   +L  
Sbjct: 339 KDSTPQNSVEPSITAEPLDETNENGKRIIESSSEITK-----------------GSLL-- 379

Query: 330 GIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFXXXXXXXXXXXXPT-DWTCRISV 388
           G+ + +  S+      LR  L  N+V TGG   +P              P   +    + 
Sbjct: 380 GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPALKFRMITTG 439

Query: 389 PKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGPDWLTKHKF 433
             +E +  SW       +  ++ +  + KEEY + G D L   +F
Sbjct: 440 HTRERQYQSWLGGSVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 58/145 (40%), Gaps = 12/145 (8%)

Query: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKI-QEVSEVTLRRPHE 62
           + +V+D GSY    G S ++ P   L     D   +     + KK+  E S    R+ +E
Sbjct: 15  SAVVIDPGSYSTNIGYSGTDCPQAILPSCYGDYTNTDDPEGKKKKVFSEQSICIPRKDYE 74

Query: 63  L------GQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMD 116
           +      G +  W+     W + L N        L  +     +++EP     E  K   
Sbjct: 75  IKPIVENGVVIDWDAAQEQWSWALENQ-----LYLRSNSGIPALLTEPIWNTVENRKKSL 129

Query: 117 QVIFEEYEFDSLFKAPTAGYIPFGV 141
           +++ E  +F++ + A T   + FG 
Sbjct: 130 ELLLEGMDFEACYLASTPTCVSFGT 154

>KLLA0D13354g Chr4 (1148444..1150567) [2124 bp, 707 aa] {ON} weakly
           similar to uniprot|P38766 Saccharomyces cerevisiae
           YHR031C RRM3 DNA helicase involved in rDNA replication
           and Ty1 transposition structurally and functionally
           related to Pif1p
          Length = 707

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

Query: 274 SVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVE 333
           +V++I P+I+S+ L      K   L E +QV+ L +    + +T  +  + R+L      
Sbjct: 462 AVDFIPPNINSNILNNVMAEKEIKLKEDAQVMMLKN----IDDTLVNGSLGRVLFFCTSA 517

Query: 334 TILESLSMIPEILRPLLVANIVCTGGNFNLP 364
             LE+  + P++  P +V ++ C      +P
Sbjct: 518 LFLEASKIFPDLSDPEVVQDMRCVCRAIGVP 548

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 192 LVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRH 238
           LVID G   T +IP+++G       K+++ GGR     L + L+ ++
Sbjct: 183 LVIDCGNEETDVIPVVEGAGMLTDAKRINWGGRQAVDYLNDLLTLKY 229

>NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11
          Length = 330

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (70%)

Query: 103 EPCMTLPELSKNMDQVIFEEYEFD 126
           E C+ LP LSK++DQV   E EFD
Sbjct: 173 EICLNLPNLSKDIDQVESNENEFD 196

>TDEL0D01780 Chr4 complement(353592..354539) [948 bp, 315 aa] {ON}
          Anc_1.310 YJL066C
          Length = 315

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 12/66 (18%)

Query: 44 NQMKKIQEVSEVTLRRPHE------LGQLTS-----WELESCIWDYCLYNPDEFDGFELG 92
          N  K+++EV+E  L+   E      LG +T      W+  S +W + L NPD+F   +L 
Sbjct: 7  NNDKQVEEVNERILKDETEDPVSDKLGSITDSMSSIWKDSSSLWSHALDNPDKF-LTQLT 65

Query: 93 GSGKKH 98
          GS   H
Sbjct: 66 GSQNNH 71

>KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141C ARP8
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin- remodeling enzyme
           complexes
          Length = 775

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 61/147 (41%), Gaps = 27/147 (18%)

Query: 189 DYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETL-- 246
           D   V+D G   T I  + +G+    ++  LD GG  +T L  + L   ++   D  L  
Sbjct: 390 DSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNS 449

Query: 247 -----LVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEG 301
                L+  +KEK         + +F+            D++     + +   +KP  E 
Sbjct: 450 PEGWSLMEQLKEK---------YATFQDA----------DVTIQLYNFIKRIPNKPGAEK 490

Query: 302 SQVVKLYDELFSVPETFFHPEISRILK 328
            +  K++DE+ + P   F P I R+LK
Sbjct: 491 FEF-KVFDEVMTAPMGLFFPHILRLLK 516

>KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 aa]
           {ON} Anc_8.50 YLR054C
          Length = 730

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 70/153 (45%), Gaps = 27/153 (17%)

Query: 42  LSNQMKKIQEVSEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIV 101
           L N++  IQE+  ++  +  +  QL    LE   W       D         S K  L +
Sbjct: 176 LQNELVAIQELQNISKSKLLKFNQL----LEVAEWIKIKLESD---------SSKMSLKI 222

Query: 102 SEPCMTLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDD 161
            E    +P++S N+  +I+EE+++++L K P+   I   V  +    LLD    +   + 
Sbjct: 223 WESI--IPKISLNILSIIYEEFDYETLLKTPSTEAIFKSVVTE----LLDICHLQC--ES 274

Query: 162 MIGQSENV-TISTDNLKDDKKKFSNDYQDYELV 193
           MI Q E+  TIS D + +  K+     +D ELV
Sbjct: 275 MIEQFEDADTISFDRIIEYTKQ-----KDKELV 302

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 7/100 (7%)

Query: 154 SGKKNDDDMIGQSENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYY 213
           +GK   D ++ + EN +++T +L    K F  D     ++ D G    W   +IK VPY 
Sbjct: 287 TGKLFGDRILSRDENGSLTTKSLA---KLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYN 343

Query: 214 KAIKKLDIGGRFL----TGLLKETLSFRHYDLMDETLLVN 249
             +   DI   FL    TG+L+     R      + LL +
Sbjct: 344 FFVGVGDINSNFLPKQSTGMLQLGRKTRQKSQESQELLTD 383

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 55/291 (18%), Positives = 104/291 (35%), Gaps = 65/291 (22%)

Query: 188 QDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETL------------- 234
           ++  LV+D G +   + P+I G     A+ +    G FL   + E L             
Sbjct: 137 RNTSLVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDS 196

Query: 235 ----SFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYT 290
               SF++++       +++ K   L VSP S     +  ++T      P  +  Y  Y 
Sbjct: 197 KVPESFKYWE--SSRTWIHDFKATMLQVSP-SKIQELEGMQDTMAFSHNPLDNKKYFLYK 253

Query: 291 RENKSKPLPEGSQVVKLYDELFSVPETFFHPEISR---ILKPGIVETILESL-------- 339
           + NK+  L +         E + + E  F P+++      K G+ E +++++        
Sbjct: 254 KGNKTLTLEQ--------RECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAAVT 305

Query: 340 ------------------------SMIPEILRPLLVANIVCTGGNFNLPHFXXXXXXXXX 375
                                   +  PE +   L+ NIV TG    +P           
Sbjct: 306 TSNSGPAGGGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNELS 365

Query: 376 XXXPTDWTCRISVPKK-ECELFSWKSMCQFANTDSYK-KTRISKEEYYEHG 424
              P       + P   + +L SW+     +N  S++    I+++EY  +G
Sbjct: 366 YQFPQYKLSSFANPMVLDRKLQSWQGGVTMSNLPSWELGNWITRQEYDANG 416

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
            YHR158C (REAL)
          Length = 1169

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 68/145 (46%), Gaps = 27/145 (18%)

Query: 138  PFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDKKKFSNDYQDYELVIDSG 197
            P+G Q+   +V+++ ++ +   DD++ +S+ +TIS       K+K S++Y   ++   S 
Sbjct: 977  PYGDQSRHHRVVINKLTNRL--DDLLEKSQELTIS-------KEKLSSEYHALKMEHSSL 1027

Query: 198  FNCTWI----IPMIKGVPYYKAIKKLDIGGRFLTGLLKE-----TLSFRHYDLMDETLLV 248
                 +    I  I+   Y ++I  +D   + LT   +E     +LS +  D +DE    
Sbjct: 1028 SQDVLVKENEIKKIQS-DYKESISSMDSASKALTVSQRELEKYKSLSKKLIDELDELNFK 1086

Query: 249  NNIKEKCLFVSPTSYFDSFKAKEET 273
            NN+  K          D FK+ ++T
Sbjct: 1087 NNVGSKN--------SDGFKSADQT 1103

>NDAI0D02560 Chr4 (589972..593856) [3885 bp, 1294 aa] {ON} Anc_5.94
            YHR154W
          Length = 1294

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%)

Query: 228  GLLKETLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYL 287
             +LK+  +F   DLM      NN     L ++P +Y ++ + KE+ +VEY+L    SS +
Sbjct: 1137 NVLKKNTNFAKSDLMRNVQESNNGSIDMLRLNPRTYGENDEPKEQVNVEYLLIAQKSSQI 1196

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,839,328
Number of extensions: 2412799
Number of successful extensions: 8029
Number of sequences better than 10.0: 164
Number of HSP's gapped: 7985
Number of HSP's successfully gapped: 246
Length of query: 439
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 326
Effective length of database: 40,524,141
Effective search space: 13210869966
Effective search space used: 13210869966
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)