Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A065103.186ON71271228460.0
NCAS0I019103.186ON61365312621e-165
Smik_4.2213.186ON61964811691e-151
ZYRO0A04994g3.186ON60865111601e-150
YDL013W (SLX5)3.186ON61963711461e-148
Skud_4.2403.186ON61963711041e-141
Suva_4.2363.186ON6303769421e-117
SAKL0C07964g3.186ON6233738551e-104
KLTH0E15884g3.186ON5864988391e-102
Kwal_27.98243.186ON5853638163e-99
KAFR0A012203.186ON6473848204e-99
AER213C3.186ON5573627438e-89
TBLA0F007203.186ON6493637192e-84
KLLA0C04411g3.186ON6073756611e-76
KNAG0J012703.186ON5473796371e-73
TDEL0D043503.186ON5563846273e-72
Kpol_1036.523.186ON5913646191e-70
CAGL0K01881g3.186ON5062175053e-55
TPHA0A043703.186ON6642485038e-54
Smik_12.4074.139ON25983800.42
Suva_10.4184.139ON25982761.1
KLTH0G09130g2.232ON258545771.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A06510
         (712 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa] ...  1100   0.0  
NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {O...   490   e-165
Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W ...   454   e-151
ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {...   451   e-150
YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subuni...   446   e-148
Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W ...   429   e-141
Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W ...   367   e-117
SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} simila...   333   e-104
KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]...   327   e-102
Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W (...   318   3e-99
KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {O...   320   4e-99
AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}...   290   8e-89
TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.1...   281   2e-84
KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} simila...   259   1e-76
KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3....   249   1e-73
TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {O...   246   3e-72
Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa] ...   243   1e-70
CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakl...   199   3e-55
TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.1...   198   8e-54
Smik_12.407 Chr12 complement(716407..717186) [780 bp, 259 aa] {O...    35   0.42 
Suva_10.418 Chr10 complement(739402..740181) [780 bp, 259 aa] {O...    34   1.1  
KLTH0G09130g Chr7 complement(746572..754329) [7758 bp, 2585 aa] ...    34   1.4  

>NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa]
           {ON} Anc_3.186 YDL013W
          Length = 712

 Score = 1100 bits (2846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/712 (78%), Positives = 556/712 (78%)

Query: 1   MQEEQERHSSISSTATPILPSDNVAERNDDINTNENGTPSSSATSVDKXXXXXXXXXXXE 60
           MQEEQERHSSISSTATPILPSDNVAERNDDINTNENGTPSSSATSVDK           E
Sbjct: 1   MQEEQERHSSISSTATPILPSDNVAERNDDINTNENGTPSSSATSVDKNTATATHANNTE 60

Query: 61  GSXXXXXXXXXXXXXXSAILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISXX 120
           GS              SAILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFIS  
Sbjct: 61  GSNDDRGDDNDNDNNNSAILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISTN 120

Query: 121 XXXXXXXSRRDAQXXXXXXXXXXXXFAIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAE 180
                  SRRDAQ            FAIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAE
Sbjct: 121 PNNTNTTSRRDAQEENEENDENDDDFAIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAE 180

Query: 181 PEYITNSRPRTXXXXXXXXXXXXXXXXGDANXXXXXEVMILEERTSTPTVTLNLPGGERL 240
           PEYITNSRPRT                GDAN     EVMILEERTSTPTVTLNLPGGERL
Sbjct: 181 PEYITNSRPRTIIINNNSSNNNIENSNGDANDDDDDEVMILEERTSTPTVTLNLPGGERL 240

Query: 241 RINADPNERPTRSSFESLNENIVPLSXXXXXXXXXXXXXNSLFFHGXXXXXXXXXXXXVS 300
           RINADPNERPTRSSFESLNENIVPLS             NSLFFHG            VS
Sbjct: 241 RINADPNERPTRSSFESLNENIVPLSRRQLLRRATRRATNSLFFHGSDENESDNDTDEVS 300

Query: 301 LPASILXXXXXXXXXXXXXXXXXXXXXXXXHSAPDTSGNSVDNTSTNRNLINLRERIHTY 360
           LPASIL                        HSAPDTSGNSVDNTSTNRNLINLRERIHTY
Sbjct: 301 LPASILGMRQRARMMAMQERQRQRQGQGQGHSAPDTSGNSVDNTSTNRNLINLRERIHTY 360

Query: 361 PPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRRIRQSQ 420
           PPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRRIRQSQ
Sbjct: 361 PPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRRIRQSQ 420

Query: 421 RDNERLLRERHARVRSTIRANNRHFGSNLASFFLMNQLGLXXXXXXXXXXXXXXXXXXXX 480
           RDNERLLRERHARVRSTIRANNRHFGSNLASFFLMNQLGL                    
Sbjct: 421 RDNERLLRERHARVRSTIRANNRHFGSNLASFFLMNQLGLGYGDVGAADDEDDGDYGIGE 480

Query: 481 XXXXTGRAAGAYGYEYEDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRA 540
               TGRAAGAYGYEYEDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRA
Sbjct: 481 EDNDTGRAAGAYGYEYEDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRA 540

Query: 541 LALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIPK 600
           LALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIPK
Sbjct: 541 LALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIPK 600

Query: 601 DFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYVR 660
           DFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYVR
Sbjct: 601 DFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYVR 660

Query: 661 IDNXXXXXXXXXXXXXXXXGSSHPDNYGPKTCPGPSCKTLLRSRGRMREIYF 712
           IDN                GSSHPDNYGPKTCPGPSCKTLLRSRGRMREIYF
Sbjct: 661 IDNAKSKSKLPKKKLAELKGSSHPDNYGPKTCPGPSCKTLLRSRGRMREIYF 712

>NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {ON}
           Anc_3.186 YDL013W
          Length = 613

 Score =  490 bits (1262), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 284/653 (43%), Positives = 360/653 (55%), Gaps = 72/653 (11%)

Query: 79  ILIESDPEEDARIREESRQI-SLVPDRRIGRPRDALHRFISXXXXXXXXXSRRDA---QX 134
           I IESDPE+DARIR + +QI  L PD R  RPRD+++RF+          S  D      
Sbjct: 14  ITIESDPEDDARIRNDQQQIIRLYPDARTDRPRDSMNRFVDAQGSNRAIRSTPDLSHLND 73

Query: 135 XXXXXXXXXXXFAIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAEPEYITNSRPRTXXX 194
                        I+ EI++P    N   +  PI+P AE++DLD E  Y   + PR    
Sbjct: 74  DQDQDQDDDDDITIVREIVNP----NVARDDAPINPDAEFIDLDQEVPYANATIPRPRTI 129

Query: 195 XXXXXXXXXXXXXGDANXXXXXEVMILEERTSTPTVTLNLPGGERLRINADPNERPTRSS 254
                         D        ++I +ERT  PTVTLNLPGG+ L+++A P ++  RSS
Sbjct: 130 QIITPSPPQQQQDDD--------LVITQERTMRPTVTLNLPGGQTLQVDATPTDQLARSS 181

Query: 255 FESLNENIVPLSXXXXXXXXXXXXXNSLFFHGXXXXXXXXXXXXVSLPASILXXXXXXXX 314
           FE   ENI PL+             NSLFFH             V LP +++        
Sbjct: 182 FE-WQENI-PLARRQLLRRSTNRA-NSLFFHDDHESDNDNGS--VPLPPNVIRLRQRQQQ 236

Query: 315 XXXXXXXXXXXXXXXXHSAPDTSGNSVDNTSTNRNLINLRERIHTYPPDVRGAFDHAQSL 374
                               +           N  +  LR RI+TY PD++ AF+HA SL
Sbjct: 237 QNRE----------------EPPPPPPPQDDANPIMTRLRTRINTYSPDIQSAFNHAHSL 280

Query: 375 QEFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRRIR--------QSQRDNERL 426
            EFTSI+Q+VAP T  EC D+L+SLFTQYR Q+M +W  RR+R         + R     
Sbjct: 281 HEFTSILQNVAPLTLQECGDELLSLFTQYRSQLMVNWATRRVRSSQQNTSSSNHRQRNLR 340

Query: 427 LRERHARVRSTIRANNRHFGSNLASFFLMNQLGLXXXXXXXXXXXXXXXXXXXXXXXXTG 486
              R+  +R T  AN   F  NLA  FLMNQLG+                          
Sbjct: 341 NLRRNGALRVTPNANG--FNVNLARLFLMNQLGINNGNDEDQYF---------------- 382

Query: 487 RAAGAYGYE-------YEDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKR 539
              GAY  E        ++DD  TQNIINMIQRRE+ E D+RTK FM++TKPQQD FKKR
Sbjct: 383 --TGAYNSEDDADHNGDDEDDTQTQNIINMIQRREEQEHDTRTKSFMARTKPQQDAFKKR 440

Query: 540 ALALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIP 599
           A  LPE YS++F+TEP +K+ +KKNGK+ET+I+ED D AK +++VPAC LCGVELGVGIP
Sbjct: 441 ANELPENYSANFNTEPTMKLDIKKNGKEETIIVEDNDAAKNYIEVPACTLCGVELGVGIP 500

Query: 600 KDFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYV 659
           KDF G +D D G SFE LVSKY FHCPYQSL+KPSQLD+DLSQ+V++ASCGHTFCGRCY 
Sbjct: 501 KDFQGINDTDRGGSFESLVSKYKFHCPYQSLAKPSQLDKDLSQRVFMASCGHTFCGRCYA 560

Query: 660 RIDNXXXXXXXXXXXXXXXXGSSHPDNYGPKTCPGPSCKTLLRSRGRMREIYF 712
           RIDN                GSSHPDNYGP+ CP  SC++LLR + +MRE++F
Sbjct: 561 RIDNAKSKSKLPKKTLKQLKGSSHPDNYGPRVCPADSCRSLLRVKTKMREVFF 613

>Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  454 bits (1169), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 262/648 (40%), Positives = 348/648 (53%), Gaps = 63/648 (9%)

Query: 77  SAILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISXXXXXXXXXSRRDAQXXX 136
           + ILI+SD EEDA IRE +  + L PDRR+GR RDAL+RF+            R+AQ   
Sbjct: 23  AVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSRN------RNAQRIH 76

Query: 137 XXXXXXXXXFAIMDEIIDPTHNNNNINEI----------GPIDPTAEYVDLDAEPEYITN 186
                         E  +   NN+++  I          GPIDP+A YVDLD EP   T 
Sbjct: 77  TTTTS---------EYSNTQGNNDDVTIIREVGRFFGDEGPIDPSAHYVDLDEEPGSETL 127

Query: 187 SRPRTXXXXXXXXXXXXXXXXGDANXXXXXEVMILEERTSTPTVTLNLPGGERLRINADP 246
             PRT                 + +      + I+EERT+ P +TLNLPGGERL +NA  
Sbjct: 128 EAPRTIRVDNANGYLNDSHDDNENDDG----LTIVEERTTRPRITLNLPGGERLEVNATT 183

Query: 247 NERPTRSSFESLNENIVPLSXXXXXXXXXXXXXNSLFFHGXXXXXXXXXXXXVSLPASIL 306
            + P R SFE   E++   +              SLF                SLP +I 
Sbjct: 184 TDIPIRRSFE-FQEDLA--ASRRQLLRRSATRARSLFVDRSDENDEDWTEHTHSLPETIQ 240

Query: 307 XXXXXXXXXXXXXXXXXXXXXXXXHSAPDTSGNSVDNTSTNRNLINLRERIHTYPPDVRG 366
                                     + D      +NTST+  L ++RERI +Y PDVR 
Sbjct: 241 RARRESHMRMNRRIAERQLMAQQQRISRD------ENTSTSFRLQSIRERIQSYTPDVRS 294

Query: 367 AFDHAQSLQEFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRRIRQSQRDNERL 426
           AF HA+SL EF SI+Q+VAP T  EC ++L++LFT++R Q++ +W + R+R +Q +  RL
Sbjct: 295 AFHHAESLHEFRSILQNVAPVTLQECEEELMALFTEFRNQLLQNWAIERVRNTQEEALRL 354

Query: 427 LRERHARV-RSTIRANNRH-FGSNLASFFLMNQLGLXXXXXXXXXXXXXXXXXXXXXXXX 484
            RE   R  R+T R  +R  F  ++A++   N                            
Sbjct: 355 HREALERQGRTTGRNFHRGVFRESIANYLNFN-----------------------GDDGF 391

Query: 485 TGRAAGAYGYEYEDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRALALP 544
             R          D++ HTQNII+MIQ RE+ ERD   K  M+KTK QQ+ F+ RA +LP
Sbjct: 392 LSRLWSGSVLNDADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQEEFEARAASLP 451

Query: 545 EGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIPKDFVG 604
           EGYS+SF T PK+K+ + KNGK+ET+I+ D DLAK   D+P C LCG ELGVGIP DF G
Sbjct: 452 EGYSASFDTTPKMKLDIMKNGKEETIIVTDDDLAKTLDDIPVCCLCGAELGVGIPDDFTG 511

Query: 605 TSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYVRIDNX 664
            S +D G+SFE LVSKY FHCPYQ+L++PS LDRDLS++ ++ASCGH +CGRC+ RIDN 
Sbjct: 512 MSQRDRGISFEGLVSKYKFHCPYQTLARPSVLDRDLSKRTFIASCGHAYCGRCFARIDNA 571

Query: 665 XXXXXXXXXXXXXXXGSSHPDNYGPKTCPGPSCKTLLRSRGRMREIYF 712
                          GS+HPDNYGPK CP  SCK L+RSRG+++E+YF
Sbjct: 572 KKKSKTPKKKLAQLKGSAHPDNYGPKLCPAESCKKLIRSRGKLKEVYF 619

>ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {ON}
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 608

 Score =  451 bits (1160), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 261/651 (40%), Positives = 352/651 (54%), Gaps = 84/651 (12%)

Query: 79  ILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISXXXXXXXXXSRRDAQXXXXX 138
           I+IESD EED RIR+++R I L PD RI RPRD L+RF++           +D       
Sbjct: 25  IIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFVNSEGTNVATTRSQD------- 77

Query: 139 XXXXXXXFAIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAE--PEYITNSRPRTXXXXX 196
                   AI+ EI     NN   NE GPI   AEYVDLDA+  P+ I            
Sbjct: 78  NGGSDDEVAIVGEI-----NNTRGNEEGPIGSDAEYVDLDADNGPQVI------------ 120

Query: 197 XXXXXXXXXXXGDANXXXXXEVMILEERTSTPTVTLNLPGGERLRINADPNERPTRSSFE 256
                       +        ++I++ERT+ P VTLNLPGGE L+I+A P +RP R SFE
Sbjct: 121 ----EVNDNNRNNNENSDDDGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFE 176

Query: 257 SLNENIVPLSXXXXXXXXXXXXXNSLFFHGXXXXXXXXXXXXVS---LPASILXXXXXXX 313
              ++                  + L FH             V    LP S+L       
Sbjct: 177 WQQQD----RTRRQAMERSARRASRLLFHTSDDDDDDSGNGTVENGRLPPSVLQLRRQEE 232

Query: 314 XXXXXXXXXXXXXXXXXHSAPDTSGNSVDNTSTNRNLINLRERIHTYPPDVRGAFDHAQS 373
                             +     GN V        L+ LRERI ++PPDVR AF HAQS
Sbjct: 233 ERSRLRNITRRRDQMRSDA---MQGNPV--------LMRLRERIDSFPPDVRSAFVHAQS 281

Query: 374 LQEFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRRIRQSQRDNERLLRERHAR 433
           L EF SI+QSVAP T  EC ++L+ LFT+YR +++ +W   R++ +Q+++ RL  E H R
Sbjct: 282 LYEFRSILQSVAPLTLQECDNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHER 341

Query: 434 VRSTIRANNRHF----------GSNLASFFLMNQLGLXXXXXXXXXXXXXXXXXXXXXXX 483
            R  +  N RHF          G +LA++ LMN  G+                       
Sbjct: 342 QRR-LWHNRRHFRIHMGVGGGFGESLANYILMNANGMG---------------------- 378

Query: 484 XTGRAAGAY-GYEYE-DDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRAL 541
            +  AA  Y GY  + D++  TQ+I++MIQ RE+ E DSRTK +M KT+ QQ  + +RA+
Sbjct: 379 -SNDAAWLYNGYVGDMDEEESTQSIVSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRAM 437

Query: 542 ALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIPKD 601
            LP+GYS+SF TEPK+K+ + ++GK+ETV+++D  ++  W +VP C LCGVELGVGIP +
Sbjct: 438 ELPDGYSASFDTEPKIKLDIVRDGKEETVVVKDDSVSDQWQEVPVCTLCGVELGVGIPDE 497

Query: 602 FVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYVRI 661
           F G +  D GVSFE LV KY FHCPYQ+L++PSQLDRDLS++ +VA CGHT+CGRC+ RI
Sbjct: 498 FEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQLDRDLSRRTFVAPCGHTYCGRCFARI 557

Query: 662 DNXXXXXXXXXXXXXXXXGSSHPDNYGPKTCPGPSCKTLLRSRGRMREIYF 712
           DN                GS+HPDNYGPK CP   CK+ +R+RG+MRE +F
Sbjct: 558 DNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGCKSPIRTRGKMREAFF 608

>YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subunit
           of the Slx5-Slx8 SUMO-targeted ubiquitin ligase (STUbL)
           complex, stimulated by SUMO-modified substrates;
           contains a RING domain and two SIMs (SUMO-interacting
           motifs); forms SUMO-dependent nuclear foci, including
           DNA repair centers
          Length = 619

 Score =  446 bits (1146), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 257/637 (40%), Positives = 337/637 (52%), Gaps = 41/637 (6%)

Query: 77  SAILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISXXXXXXXXXSRRDAQXXX 136
           + ILI+SD EEDA IRE +  + L PDRR+GR RDAL+RF+            R++Q   
Sbjct: 23  TVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSRS------RNSQRTH 76

Query: 137 XXXXXXXXXF-AIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAEPEYITNSRPRTXXXX 195
                    F A  D+I           + GPIDP+A YVDLD EP   T   PRT    
Sbjct: 77  ITASSERPDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQEPGSETLETPRTIQVD 136

Query: 196 XXXXXXXXXXXXGDANXXXXXEVMILEERTSTPTVTLNLPGGERLRINADPNERPTRSSF 255
                        +++      + I+EERT+ P VTLNLPGGERL + A   + P R SF
Sbjct: 137 NTNGYLNDNGNNNESDDG----LTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSF 192

Query: 256 ESLNENIVPLSXXXXXXXXXXXXXNSLFFHGXXXXXXXXXXXXVSLPASILXXXXXXXXX 315
           E   E++   +              +LF                +LP +I          
Sbjct: 193 E-FQEDLG--ASRRQLLRRSATRARNLFVDRSDENDEDWTDDTHNLPEAIQRARRESRMR 249

Query: 316 XXXXXXXXXXXXXXXHSAPDTSGNSVDNTSTNRNLINLRERIHTYPPDVRGAFDHAQSLQ 375
                            + D      +N ST+  L ++RERI +Y PD+R AF  A+SL 
Sbjct: 250 MSRRIAERQRRVQQQRVSSD------ENISTSIRLQSIRERIQSYTPDIRSAFHRAESLH 303

Query: 376 EFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRRIRQSQRDNERLLRERHARVR 435
           EF SI+Q+VAP T  EC ++L++LFT++R Q++ +W + R+R +Q +  RL RE   R  
Sbjct: 304 EFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWAIDRVRNTQEEALRLHREALERQE 363

Query: 436 STIRANNRHFGSNLASFFLMNQLGLXXXXXXXXXXXXXXXXXXXXXXXXTGRAAGAYGYE 495
              R   R F        + N L                            R        
Sbjct: 364 ---RTAGRVFHRGTLRESITNYLNFNGEDGF------------------LSRLWSGPALS 402

Query: 496 YEDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEP 555
             D++ HTQNII+MIQ RE+ ERD   K  M+KT+ QQ+ F+ RA +LPEGYS+SF T P
Sbjct: 403 DADEERHTQNIIDMIQEREERERDVVMKNLMNKTRAQQEEFEARAASLPEGYSASFDTTP 462

Query: 556 KVKMTVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFE 615
           K+K+ + KNGK+ET+I+ D DLAK   D+P C LCG ELGVGIP DF G S KD GVSFE
Sbjct: 463 KMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFE 522

Query: 616 FLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYVRIDNXXXXXXXXXXXX 675
            LVSKY FHCPYQ+L++PS LDRDLS++ ++ASCGH FCGRC+ RIDN            
Sbjct: 523 GLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAKKKSKMPKKKL 582

Query: 676 XXXXGSSHPDNYGPKTCPGPSCKTLLRSRGRMREIYF 712
               GS+HPDNYGPK CP  SCK L+RSRGR++E+YF
Sbjct: 583 AQLKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619

>Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  429 bits (1104), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 254/637 (39%), Positives = 332/637 (52%), Gaps = 40/637 (6%)

Query: 77  SAILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFI-SXXXXXXXXXSRRDAQXX 135
           S ILIESD EEDA IRE +  + L PDRR+GR RDAL+RF+ S             A+  
Sbjct: 22  SVILIESDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSVGINPQRIHTTARPN 81

Query: 136 XXXXXXXXXXFAIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAEPEYITNSRPRTXXXX 195
                       I+ E+           + GPIDP+A +VDLD EP+  T   P T    
Sbjct: 82  RSDPQNDNDDVTIVREV------GRFFGDDGPIDPSAHFVDLDHEPDSETLETPTTLQVD 135

Query: 196 XXXXXXXXXXXXGDANXXXXXEVMILEERTSTPTVTLNLPGGERLRINADPNERPTRSSF 255
                        D N      + I+EERT+ P VTLNLPGGERL +NA   + P R SF
Sbjct: 136 NINGYLNDNFNDNDNNDDG---LTIVEERTTRPRVTLNLPGGERLEVNATTTDMPIRRSF 192

Query: 256 ESLNENIVPLSXXXXXXXXXXXXXNSLFFHGXXXXXXXXXXXXVSLPASILXXXXXXXXX 315
           E  ++  V                 +LF                ++P +I          
Sbjct: 193 EFQDDLAV---SRRQLLRRSAARARTLFVDRSDENDEEWTEDTDNVPEAIQRARRESHMR 249

Query: 316 XXXXXXXXXXXXXXXHSAPDTSGNSVDNTSTNRNLINLRERIHTYPPDVRGAFDHAQSLQ 375
                            A      S +N +T+    ++RERI  Y PD+R AF HA+SL 
Sbjct: 250 MSRRIAERQLRAQQHRMA------SNENMNTSIRFQSIRERIQAYAPDIRSAFYHAESLH 303

Query: 376 EFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRRIRQSQRDNERLLRERHARVR 435
           EF SI+Q+VAP T  EC  +L++LFT++R Q++ DW + R+R +Q +  RL RE   R  
Sbjct: 304 EFRSILQNVAPVTLQECEGELMALFTEFRNQLLQDWAIDRVRNTQEEALRLHREALERQE 363

Query: 436 STIRANNRHFGSNLASFFLMNQLGLXXXXXXXXXXXXXXXXXXXXXXXXTGRAAGAYGYE 495
              RA  R F        + N L                            R  G+    
Sbjct: 364 ---RATGRVFHRGPFRESITNYLNFSGENGFLT------------------RLWGSPVLN 402

Query: 496 YEDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEP 555
             D++ HTQNII+MIQ RE+ ERD   K  MSKTK QQ+ F+ RA  LPEGYS+SF T P
Sbjct: 403 DADEERHTQNIIDMIQEREERERDVVMKNLMSKTKAQQEEFEDRAARLPEGYSASFDTTP 462

Query: 556 KVKMTVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFE 615
           K+K+ + KN K+ET+ + D DLA+    +P C LCGVELGVGIP DF+G + KD G+SFE
Sbjct: 463 KMKLDIMKNDKEETITVTDDDLARTLEVIPVCCLCGVELGVGIPDDFIGMNQKDRGISFE 522

Query: 616 FLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYVRIDNXXXXXXXXXXXX 675
            LVSKY FHCPYQ+L++PS LDRDLS++ ++A+CGH +CGRC+ RIDN            
Sbjct: 523 GLVSKYKFHCPYQTLARPSMLDRDLSRRTFIAACGHAYCGRCFARIDNAKKKSKTPKKKL 582

Query: 676 XXXXGSSHPDNYGPKTCPGPSCKTLLRSRGRMREIYF 712
               GS+HPDNYGPK CP  SCK  +RSRGR++E+YF
Sbjct: 583 ASLRGSAHPDNYGPKFCPAESCKKPIRSRGRLKEVYF 619

>Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W
           (REAL)
          Length = 630

 Score =  367 bits (942), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 235/376 (62%), Gaps = 27/376 (7%)

Query: 340 SVDNTSTNRNLINLRERIHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDDLISL 399
           S +N  T   L ++RERI  Y PD+R AF HA+SL EF SI+Q+VAP T  EC  +L++L
Sbjct: 279 SNENMGTAIRLQSIRERIQAYVPDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELMAL 338

Query: 400 FTQYRGQVMADWTLRRIRQSQRDNERLLRERHARVRSTIRANNRHFG---SNLASFFLMN 456
           FT++R Q++ +W + R+R +Q +  RL RE     +  +     H G    +++S+   N
Sbjct: 339 FTEFRNQLLQNWAIDRVRNTQEEALRLHRE-ALEGQERVAGGALHHGPYRESISSYLNFN 397

Query: 457 QLGLXXXXXXXXXXXXXXXXXXXXXXXXTGRAAGAYGYEYEDDDAHTQNIINMIQRREDA 516
                                         R  G       D++ HTQNII+MIQ RE+ 
Sbjct: 398 -----------------------GEDGFLTRLWGGPVLNEADEERHTQNIIDMIQEREER 434

Query: 517 ERDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVD 576
           ERD   K  M+KTK QQD F++RA  LPEGYS+SF T PK+K+ + KNGK+ET+ + D D
Sbjct: 435 ERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKLDIMKNGKEETITVLDDD 494

Query: 577 LAKYWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQL 636
           LAK   DV  C LCGVELGVGIP DFVG S KD G+SFE LVS+Y FHCPYQ+L++PS L
Sbjct: 495 LAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYKFHCPYQTLARPSVL 554

Query: 637 DRDLSQKVYVASCGHTFCGRCYVRIDNXXXXXXXXXXXXXXXXGSSHPDNYGPKTCPGPS 696
           DRDLS++ +VASCGHT+CGRCY RIDN                GS+HPDNYGPK CP  S
Sbjct: 555 DRDLSKRTFVASCGHTYCGRCYARIDNAKKKSKSPKKKLAELKGSAHPDNYGPKLCPADS 614

Query: 697 CKTLLRSRGRMREIYF 712
           CK L+RSRGR++E+YF
Sbjct: 615 CKKLIRSRGRLKEVYF 630

 Score =  100 bits (249), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 90/185 (48%), Gaps = 13/185 (7%)

Query: 77  SAILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISXXXXXXXXXSRRDAQXXX 136
           S ILI+SD EEDA IRE +  + L PDRR+GR RDAL+RFI             DA    
Sbjct: 23  SVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFIRSDTT--------DATPQR 74

Query: 137 XXXXXXXXXFAIMDEIIDPT---HNNNNINEIGPIDPTAEYVDLDAEPEYITNSRPRTXX 193
                        ++I D T          + GPIDP+A YVDLD EP   T   PR   
Sbjct: 75  IGTTLRSDGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQEPGSETVETPRIIQ 134

Query: 194 XXXXXXXXXXXXXXGDANXXXXXE--VMILEERTSTPTVTLNLPGGERLRINADPNERPT 251
                          + +     +  + I+EERT+ P +TLNLPGGERL +NA P + P 
Sbjct: 135 VNNTNGYLNENSNENNNDNDNDNDDGLTIVEERTARPRITLNLPGGERLEVNATPRDIPI 194

Query: 252 RSSFE 256
           R SFE
Sbjct: 195 RRSFE 199

>SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 623

 Score =  333 bits (855), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 169/373 (45%), Positives = 218/373 (58%), Gaps = 38/373 (10%)

Query: 346 TNRNLINLRERIHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDDLISLFTQYRG 405
            N  L  LR RI+ YP D++ AFDHAQSL EF  I+QSV P        +L  L+++YRG
Sbjct: 283 ANAELTALRSRINGYPLDIQSAFDHAQSLYEFEGIIQSVEPRMNENRKQELRELYSRYRG 342

Query: 406 QVMADWTLRRIR----QSQRDNERLLRERHARVRSTIRA--NNRHFGSNLASFFLMNQLG 459
            VM  W   R R    Q+ R  +   RE+  R R       +NRH   +L  F +    G
Sbjct: 343 HVMHSWAQNRRRTYREQAARAQQTRAREQEQRQRELENQVFHNRH---SLTEFLIARAFG 399

Query: 460 LXXXXXXXXXXXXXXXXXXXXXXXXTGRAAGAYGYEYEDDDAHTQNIINMIQRREDAERD 519
                                           +G +  D++  TQNII MIQ RE+ E+D
Sbjct: 400 PFH-----------------------------WGGQQADEEIETQNIIEMIQAREEREQD 430

Query: 520 SRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAK 579
           +R K +M  TK QQ GF +RA  +PEGYS+SF T PK+K+ + +NG++E V + D   AK
Sbjct: 431 TRKKRYMEDTKFQQQGFLRRAEGVPEGYSASFDTAPKMKIAMTRNGREEEVTVTDDHAAK 490

Query: 580 YWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRD 639
            + DVPAC LCG+ELGVGIP +F G + +D GVSFE LV+KY FHCPYQSL++PS  DRD
Sbjct: 491 QYEDVPACCLCGIELGVGIPDEFSGITKEDRGVSFESLVAKYGFHCPYQSLARPSVADRD 550

Query: 640 LSQKVYVASCGHTFCGRCYVRIDNXXXXXXXXXXXXXXXXGSSHPDNYGPKTCPGPSCKT 699
           LS++ YVASCGHTFCGRC+ R+DN                G+SHPDNYGPKTCP   C  
Sbjct: 551 LSKRTYVASCGHTFCGRCFARVDNARAYSRASKKKLAGLQGASHPDNYGPKTCPAEGCSM 610

Query: 700 LLRSRGRMREIYF 712
            LRS+GRM+E++F
Sbjct: 611 QLRSKGRMKEVFF 623

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 83/180 (46%), Gaps = 14/180 (7%)

Query: 79  ILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISXXXXXXXXXSRRDAQXXXXX 138
           I IESDPEED RIR++ RQ  LV DRRI RPRD+L+RF++         +R         
Sbjct: 30  IEIESDPEEDERIRQQYRQQRLVGDRRINRPRDSLNRFLN-----SQGENRNTRAALEPD 84

Query: 139 XXXXXXXFAIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAEPEYITNSRPRTXXXXXXX 198
                    ++ E +   H        GPI   A++VDL +     T S           
Sbjct: 85  DDEDDDDLQVVGETMLDRH--------GPIGEDADFVDLSSFGGGDTGSGGSGDNRNGVP 136

Query: 199 XXXXXXXXXGDANXX-XXXEVMILEERTSTPTVTLNLPGGERLRINADPNERPTRSSFES 257
                      AN      ++ ILEERT+ P   LNLPGGE LRI+    ++P R SF++
Sbjct: 137 TRTAIIRHSTGANGSDRGDDIEILEERTTAPNFVLNLPGGESLRISGTTADQPVRRSFQN 196

>KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]
           {ON} similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 586

 Score =  327 bits (839), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/498 (37%), Positives = 264/498 (53%), Gaps = 32/498 (6%)

Query: 217 EVMILEERTSTPTVTLNLPGGERLRINADPNERPTRSSFESL-NENIVPLSXXXXXXXXX 275
           +++ILEER ++P+  LNLPGGE L+I+  P ++P R SF++  N +    +         
Sbjct: 119 DLVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNSANGRRRLLRRT 178

Query: 276 XXXXNSLFFHGXXXXXXXXXXXXVSL-PASILXXXXXXXXXXXXXXXXXXXXXXXXHSAP 334
               +SLF H               L P  +                             
Sbjct: 179 ARRASSLFLHPSDEEDEGFAYENTDLLPTGVRLRRQRNSMMQRRPNPPRRQLLG------ 232

Query: 335 DTSGNSVDNTSTNRNLINLRERIHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSD 394
             +G+ VD+      L++L  +I+++P +VR AFDHAQS+ EF SI+QSV   ++ +  D
Sbjct: 233 --TGDDVDDPE----LLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQD 286

Query: 395 DLISLFTQYRGQVMADWTLRRIRQSQRDNERLLRERHARVRSTIRANNRHFGSNLASFFL 454
           +L  LFT YRG VM  W   R+R++ RD    +  R      T +A+N  +   LA    
Sbjct: 287 ELTHLFTVYRGHVMRSWANDRLRRA-RDAASGMNTR--TTDRTSQAHNLRYSPTLAGII- 342

Query: 455 MNQLGLXXXXXXXXXXXXXXXXXXXXXXXXTGRAAGAYGYEYEDDDAHTQNIINMIQRRE 514
                                          G   G   Y   D++  TQNII MIQ RE
Sbjct: 343 --------------ARTFNPILGHMHMAYEPGLGTGMAAYNDADEERQTQNIIQMIQERE 388

Query: 515 DAERDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEPKVKMTVKKNGKDETVIMED 574
           + E +SR + +M  TKP+Q G+ ++A  LP+GYS+SF T P++ +++ KNG++E + + D
Sbjct: 389 EREFESRKRKYMEDTKPKQSGYLQKAAKLPDGYSASFDTTPRMNISIMKNGQNEELTVVD 448

Query: 575 VDLAKYWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPS 634
                 +MD+PAC LCGVELGVGIP  F G  ++D GVSFE L +KY+FHCPYQ+LSKPS
Sbjct: 449 DHADALYMDIPACCLCGVELGVGIPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPS 508

Query: 635 QLDRDLSQKVYVASCGHTFCGRCYVRIDNXXXXXXXXXXXXXXXXGSSHPDNYGPKTCPG 694
             DRDLS++ YVA CGH+FCGRC+ RIDN                G+S+PDNYGPK CP 
Sbjct: 509 VADRDLSRRTYVAQCGHSFCGRCFARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPA 568

Query: 695 PSCKTLLRSRGRMREIYF 712
             C   LRSRG+MRE+YF
Sbjct: 569 KDCNNRLRSRGKMREVYF 586

>Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W
           (HEX3) - involved in hexose metabolism [contig 43] FULL
          Length = 585

 Score =  318 bits (816), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 162/363 (44%), Positives = 218/363 (60%), Gaps = 19/363 (5%)

Query: 350 LINLRERIHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMA 409
           L  L  +I+  PP+VR AFDHAQS+ EF SI+QS+    + +  DDL SLF++YR  ++ 
Sbjct: 242 LSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYRANLLR 301

Query: 410 DWTLRRIRQSQRDNERLLRERHARVRSTIRANNRHFGSNLASFFLMNQLGLXXXXXXXXX 469
             + +RIR   R  ER             R ++R  G + ++  L     L         
Sbjct: 302 SRSNQRIR---RPGER------------SRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFN 346

Query: 470 XXXXXXXXXXXXXXXTGRAAGAYGYEYEDDDAHTQNIINMIQRREDAERDSRTKGFMSKT 529
                               G  GY   D++  TQNII MIQ RE+ E ++R + +M  T
Sbjct: 347 PVLGRMHMGYDARTH----GGIMGYGEVDEEQQTQNIIQMIQEREEQEYEARKRKYMEDT 402

Query: 530 KPQQDGFKKRALALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAKYWMDVPACIL 589
           K +Q G+ ++A+ LPEGYSSSF T PK+ +T+KKNGK+E + + D   A ++MD+P+C L
Sbjct: 403 KSKQLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSL 462

Query: 590 CGVELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASC 649
           CGVELGVGIP +F G S +D GVSFE L +KY+FHCPYQ+LSKPS +DRDLS++ YVA+C
Sbjct: 463 CGVELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAAC 522

Query: 650 GHTFCGRCYVRIDNXXXXXXXXXXXXXXXXGSSHPDNYGPKTCPGPSCKTLLRSRGRMRE 709
           GH+FCGRC+ RIDN                G+SHPDNYGPK CP   C   LR+RG+MRE
Sbjct: 523 GHSFCGRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMRE 582

Query: 710 IYF 712
           +YF
Sbjct: 583 VYF 585

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 45/89 (50%), Gaps = 21/89 (23%)

Query: 170 PTAEYVDLDAEPE-YITNSRPRTXXXXXXXXXXXXXXXXGDANXXXXXEVMILEERTSTP 228
           P  EYVDLD   E  +   RP+                          +++ILEERTS+P
Sbjct: 90  PETEYVDLDRSGEGSLGQRRPQAASSEE--------------------DLVILEERTSSP 129

Query: 229 TVTLNLPGGERLRINADPNERPTRSSFES 257
           +  LNLPGGE LRIN  P ++P R SF++
Sbjct: 130 SFVLNLPGGEYLRINGSPLDQPVRRSFQA 158

>KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {ON}
           Anc_3.186 YDL013W
          Length = 647

 Score =  320 bits (820), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 168/384 (43%), Positives = 229/384 (59%), Gaps = 19/384 (4%)

Query: 345 STNRNLINLRERIHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDDLISLFTQYR 404
           S N     +R RI+ Y PD+R AFDHAQ++ EF SI++++AP T  +C  +LISL+T+YR
Sbjct: 267 SGNPRFDEIRNRINAYSPDIRSAFDHAQTIHEFKSILENIAPVTLQDCGAELISLYTEYR 326

Query: 405 GQVMADWTLRRIRQS-------------QRDNERLLRERHARVRSTIRANNRHF-GSNLA 450
             ++ +W  RR++ S             +    R   +R AR+R  + +N      +NLA
Sbjct: 327 SYLLQNWATRRVQNSAAPATAGRARTDGRDRRRRTRNQRLARLRFDMESNEGGLTANNLA 386

Query: 451 SFFLMNQLGLXXXXXXXXXXXXXXXXXXXXXXXXTGRAAGAYGYEYEDDDAH-TQNIINM 509
             FL N  G                              G +G E ED++A  TQNIINM
Sbjct: 387 RIFLANN-GFQNVFDGGDIRDDEDGDYYGYMNEYDD-YMGEHG-ENEDEEAQRTQNIINM 443

Query: 510 IQRREDAERDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEPKVKMTVKKNGKDET 569
           IQ RE+ E DSRTKGFM+ TK Q++   K+A  LP+GYS++F + PK  +   KNGK+E 
Sbjct: 444 IQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDSTPKTVVKAMKNGKEEE 503

Query: 570 VIMED-VDLAKYWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQ 628
           +I++D V +    M+VP C LCG ELG+GIP DF G  ++D G+SF+FLVSKY  +CPYQ
Sbjct: 504 IIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRGLSFQFLVSKYKSYCPYQ 563

Query: 629 SLSKPSQLDRDLSQKVYVASCGHTFCGRCYVRIDNXXXXXXXXXXXXXXXXGSSHPDNYG 688
           SL+KPS++DR LS++ +VA CGH +CGRC  RI N                GSSHP+NYG
Sbjct: 564 SLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKPKKELAKLIGSSHPENYG 623

Query: 689 PKTCPGPSCKTLLRSRGRMREIYF 712
           PK CP  +CK LLRSRG++ E+YF
Sbjct: 624 PKKCPADNCKGLLRSRGKLSEVYF 647

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 96/186 (51%), Gaps = 25/186 (13%)

Query: 77  SAILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISXXXXXXXXXSRRDAQXXX 136
           S ILIE+D EED RIR+E+R   LVPDRRIGRPRD L+RF+S         +        
Sbjct: 22  SVILIETDEEEDERIRDENRYRRLVPDRRIGRPRDILNRFVSTRDPGDDNETTTHV-SQE 80

Query: 137 XXXXXXXXXFAIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAEPEYITN----SRPRTX 192
                      I+  I  P   N      GPIDP AEY+DLD E +Y +     + PR  
Sbjct: 81  GDNNDDDDDVEIVGAIEAPRDPN------GPIDPGAEYIDLDTEDQYASGHHGFNTPRIV 134

Query: 193 XXXXXXXXXXXXXXXGDANXXXXXE--VMILEERTSTPTVTLNLPGGERLRINADPNERP 250
                          GD+N     +  + I+EERT+ PTVTLNLPGGE L+INA  ++RP
Sbjct: 135 VIN------------GDSNNGNNEDDGLEIIEERTTRPTVTLNLPGGESLQINASDSDRP 182

Query: 251 TRSSFE 256
              SFE
Sbjct: 183 AHRSFE 188

>AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL013W
           (HEX3)
          Length = 557

 Score =  290 bits (743), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 149/362 (41%), Positives = 206/362 (56%), Gaps = 33/362 (9%)

Query: 356 RIHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRR 415
           ++    P++R  F HA++L E  +++ +    T A    DL+ L+ Q+R + + +W  +R
Sbjct: 224 QVDALAPELRSIFYHAETLHEVRTMLNASGLGTSAAAMQDLLQLYMQFRSRQINNWARQR 283

Query: 416 IRQ----SQRDNERLLRERHARVRSTIRANNRHFGSNLASFFLMNQLGLXXXXXXXXXXX 471
            ++    S R+ +    +  +R R    A N    ++  S+ L   LG            
Sbjct: 284 AQEFRHGSAREADHAQDDSASRARLRNPALNAQRRNSFTSYVLARSLG------------ 331

Query: 472 XXXXXXXXXXXXXTGRAAGAYGYEY-EDDDAHTQNIINMIQRREDAERDSRTKGFMSKTK 530
                             G +  ++  DDD  TQNII++IQ RE+ + DSR + +M  TK
Sbjct: 332 ----------------GFGVWPNDFFGDDDEVTQNIIDIIQAREERDLDSRKRKYMEDTK 375

Query: 531 PQQDGFKKRALALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAKYWMDVPACILC 590
            QQ  F  RA  LPEGY +SF   PK+KMT++KNGK E V++ D   AK +++VP C LC
Sbjct: 376 SQQQAFVARAQRLPEGYYASFDPTPKMKMTLEKNGKTEEVVVADDLAAKSYVEVPVCCLC 435

Query: 591 GVELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCG 650
           GVELG+GIP DF G S  D GVSFE LVSKYDFHCPYQ+L+ PS  DRDLS+K +VA CG
Sbjct: 436 GVELGLGIPDDFAGISAVDRGVSFESLVSKYDFHCPYQALAHPSIADRDLSRKTFVAHCG 495

Query: 651 HTFCGRCYVRIDNXXXXXXXXXXXXXXXXGSSHPDNYGPKTCPGPSCKTLLRSRGRMREI 710
           HTFCGRC+ RI+N                G SHPDNYGP+ CP   C+  LR+RG+MRE+
Sbjct: 496 HTFCGRCFARINNAKRFSKISKKRLAELHGPSHPDNYGPRVCPAEGCRGQLRTRGKMREV 555

Query: 711 YF 712
           +F
Sbjct: 556 FF 557

 Score = 92.4 bits (228), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 87/181 (48%), Gaps = 39/181 (21%)

Query: 77  SAILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISXXXXXXXXXSRRDAQXXX 136
           + I IESDPEED RI  + RQ  LVPDRR+ RPRDA +RF+S            D +   
Sbjct: 10  AVIEIESDPEEDQRIINQYRQTRLVPDRRLNRPRDAANRFVSVSGRVAAAAGEGDDEV-- 67

Query: 137 XXXXXXXXXFAIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAEPEYITNSRPRTXXXXX 196
                         EI++  +    +++ GPID TA++VDLD +                
Sbjct: 68  --------------EIVNEVY----LDDEGPIDSTADFVDLDEQ-------------QGP 96

Query: 197 XXXXXXXXXXXGDANXXXXXEVMILEERTSTPTVTLNLPGGERLRINADPNERPTRSSFE 256
                      GD       +V I+EERT+ PT  LNLP G+ LRI+   ++RP R SFE
Sbjct: 97  SSSMVINHDGGGD------DDVAIIEERTTHPTFLLNLPNGQTLRISGSVHDRPLRRSFE 150

Query: 257 S 257
           +
Sbjct: 151 T 151

>TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.186
           YDL013W
          Length = 649

 Score =  281 bits (719), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 201/363 (55%), Gaps = 35/363 (9%)

Query: 350 LINLRERIHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMA 409
           +  LR RI+ YPPDVR  FDHA +L EF +++QS AP T  +   DLI +FT YRG +  
Sbjct: 322 MAELRRRINAYPPDVRSIFDHATTLNEFLALMQSTAPITLEDNRTDLIDIFTLYRGNLTQ 381

Query: 410 DWTLRRIRQSQRDNERLLRERHARVRSTIRANNRHFGSNLASFFLMNQLGLXXXXXXXXX 469
           +W + R+  S RDN        AR  S+    N    +     FL + +GL         
Sbjct: 382 NWMINRM-NSSRDNS-------ARTASSTPMRNMPAHTRFVQGFLHSIMGLGGDF----- 428

Query: 470 XXXXXXXXXXXXXXXTGRAAGAYGYEYEDDDAHTQNIINMIQRREDAERDSRTKGFMSKT 529
                                 YG    D++A TQNII MI+ RE  ERDS+ K  M KT
Sbjct: 429 ---------------------PYGGTESDEEATTQNIIRMIEEREANERDSKVKQLMKKT 467

Query: 530 KPQQDGFKKRALALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAKYWMDVPACIL 589
           K QQ+ F+ +A  LP+G+S+SFS  PK  +++  +     ++ ++  LA+ + ++P C L
Sbjct: 468 KKQQEDFENKAKYLPKGFSASFSLVPKKIISIDGDDSKREIVTDEF-LAEEYEELPVCCL 526

Query: 590 CGVELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASC 649
           CGVELGVGIP  F G + ++  VSF+ LV KY+  CPY +LS P  +DRDLS++ YVASC
Sbjct: 527 CGVELGVGIPDSFRGITPEESKVSFDSLVKKYNIPCPYNALSAPGDIDRDLSRRTYVASC 586

Query: 650 GHTFCGRCYVRIDNXXXXXXXXXXXXXXXXGSSHPDNYGPKTCPGPSCKTLLRSRGRMRE 709
           GH+FCGRC  RI++                G  +PD YGPKTCP   C   LR +G+MRE
Sbjct: 587 GHSFCGRCVRRINHAKESGKISKQKLKELVGPENPDIYGPKTCPATDCTGKLRRKGQMRE 646

Query: 710 IYF 712
           +YF
Sbjct: 647 VYF 649

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 51/90 (56%), Gaps = 2/90 (2%)

Query: 166 GPIDPTAEYVDLDAEPEYITNSRPRTXXXXXXXXXXXXXXXXGDANXXXXXEVMILEERT 225
           GP++P+ EYVDLD E EY +N+                     D N     +++I++ERT
Sbjct: 147 GPLNPSTEYVDLDNEAEYSSNNNYGHSRTLIVDGDNDNADVIDDGNGAD--DLVIVQERT 204

Query: 226 STPTVTLNLPGGERLRINADPNERPTRSSF 255
           S PTVTL LPG   ++INA P +RP RSSF
Sbjct: 205 SAPTVTLTLPGNRSIQINAAPTDRPVRSSF 234

>KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 607

 Score =  259 bits (661), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 152/375 (40%), Positives = 201/375 (53%), Gaps = 23/375 (6%)

Query: 355 ERIHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECS-DDLISLFTQYRGQVMADWTL 413
           E I +  PD+R  F  +QSL +F    + +A   F     + L+  +  +R + M  W  
Sbjct: 239 ETIDSLDPDLRSLFFESQSLSQFR---EGLARFNFPPARLEQLLGQYRDFRARAMQSWAE 295

Query: 414 -RRIRQSQRDNERLLRERHARVRSTIRANNRHFGSNLAS---------FFLM-----NQL 458
            RR R     N   LR +  R RS  + N+   GSN  S          F M     N  
Sbjct: 296 GRRTRSMSYQNRNSLRPQ--RTRSGTQQNHSR-GSNGDSRDNALYQQMLFGMPDDDENMD 352

Query: 459 GLXXXXXXXXXXXXXXXXXXXXXXXXTGRAAGAYG-YEYEDDDAHTQNIINMIQRREDAE 517
           G                                +G YE  DD A+T+ II MIQ RE+ +
Sbjct: 353 GNNFTGTTQSLQRIISNTMNRRFGNLPFGVGPEFGFYEDGDDAANTELIIRMIQEREERD 412

Query: 518 RDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDL 577
             +RTK     TK QQ  +  +A +LPEGYS+SF+T P + MT++  G++ETV++ D   
Sbjct: 413 ASTRTKKLNEVTKSQQQKYIDKANSLPEGYSASFNTAPLMSMTMENEGREETVMVTDDVA 472

Query: 578 AKYWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLD 637
           AK ++DVP C+LCGVELGVGIP D+ G S++D GVSFE L S Y FHCPYQ+L++P+ +D
Sbjct: 473 AKTYIDVPVCVLCGVELGVGIPDDWKGVSEEDKGVSFEALQSHYKFHCPYQTLARPTLVD 532

Query: 638 RDLSQKVYVASCGHTFCGRCYVRIDNXXXXXXXXXXXXXXXXGSSHPDNYGPKTCPGPSC 697
           RDLS++ YV+SCGHTFCGRC VRI N                G SHPDNYGPK CP   C
Sbjct: 533 RDLSRRTYVSSCGHTFCGRCQVRIKNARDISAKEKNKLKNSQGPSHPDNYGPKKCPAEGC 592

Query: 698 KTLLRSRGRMREIYF 712
            + LR +G MRE+YF
Sbjct: 593 NSNLRKKGIMREVYF 607

 Score = 38.1 bits (87), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 77/182 (42%), Gaps = 32/182 (17%)

Query: 78  AILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISXXXXXXXXXSRRDAQXXXX 137
            I I+SDPE DA+IREE     L+PDRR  RPRD L RF+S             A     
Sbjct: 7   VIEIDSDPELDAQIREEYAPRRLIPDRRRNRPRDHLSRFVSNAEDRNVAPI---APATDL 63

Query: 138 XXXXXXXXFAIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAEPEYITNSRPRTXXXXXX 197
                     I  E+        ++   GPI+  AEY++LD       N R         
Sbjct: 64  PVSTDGEDLEITAEV--------SLRPDGPINDDAEYINLD-------NYR------ASN 102

Query: 198 XXXXXXXXXXGDANXXXXXEVMILEERT--STPTVTLNLPGGERLRINADPNERPTRSSF 255
                     GD       ++M++EER   S   V L LP G+ L+++A  NE P   SF
Sbjct: 103 NGTVVVDHREGD------DDLMLVEERIQESGRPVLLQLPAGQTLQVDASWNELPVGRSF 156

Query: 256 ES 257
           ++
Sbjct: 157 QN 158

>KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3.186
           YDL013W
          Length = 547

 Score =  249 bits (637), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 139/379 (36%), Positives = 194/379 (51%), Gaps = 29/379 (7%)

Query: 336 TSGNSVDNTSTNRNLINLRERIHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDD 395
           TSGN       +     +R RI++YPP+++  F +AQSL EFT IVQ+  P TFAEC DD
Sbjct: 196 TSGNHPAALDEDPQRRRIRARINSYPPNIQSTFHYAQSLPEFTYIVQNTDPITFAECRDD 255

Query: 396 LISLFTQYRGQVMADWTLRRIRQSQRDNERLLRERHARVRSTIRANNRHFGSNLASFFLM 455
           L +LF+QY+     D      +Q  R +E      +++  +   +NNR+F      +   
Sbjct: 256 LTNLFSQYQSMQHDDRMRNVGQQGSRQSEPRHGTNYSQRSAVSHSNNRYFYPEFNQY--- 312

Query: 456 NQLGLXXXXXXXXXXXXXXXXXXXXXXXXTGRAAGAYGYEYEDDDAHTQNIINMIQRRED 515
                                                GY  +D++  TQNII+MIQ RED
Sbjct: 313 --------------ESDEARAQSLLPRIHDFLQMRLMGYPNDDEETTTQNIISMIQERED 358

Query: 516 AERDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSFS--TEPKVKMTVKKNGKDETVIME 573
            ERD+R K F  K+KP      K A +LP  YS+SF   + P  K  +      ET   E
Sbjct: 359 TERDTRVKNFTDKSKPLLKSILKEAKSLPSNYSASFHYPSSPS-KPQIPGGSTSETAESE 417

Query: 574 DVDLAKYWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKP 633
           +V           C+LCG ELGVGIP  F+G S +D  + F  L+SKY F CPYQSL +P
Sbjct: 418 EVS---------CCVLCGSELGVGIPDSFIGRSAEDRDLDFSSLISKYSFPCPYQSLIRP 468

Query: 634 SQLDRDLSQKVYVASCGHTFCGRCYVRIDNXXXXXXXXXXXXXXXXGSSHPDNYGPKTCP 693
           +QLDRDLS++ +++ CGH +CGRC+ RIDN                G S+P+ YGP+ C 
Sbjct: 469 NQLDRDLSKRTFMSKCGHVYCGRCFARIDNAKAKSKISKKELASLKGCSNPNIYGPRICV 528

Query: 694 GPSCKTLLRSRGRMREIYF 712
              C  ++R++ R+RE+YF
Sbjct: 529 ADGCTAVIRAKARLRELYF 547

>TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {ON}
           Anc_3.186 YDL013W
          Length = 556

 Score =  246 bits (627), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 139/384 (36%), Positives = 199/384 (51%), Gaps = 37/384 (9%)

Query: 345 STNRNLIN-------LRERIHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDDLI 397
           ++NRN IN       ++ R+ +YP D+R AF HAQ++ EF+SI+++V P T+ +C  DL 
Sbjct: 194 TSNRNQINYDPEFAAIQRRLDSYPLDIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLE 253

Query: 398 SLFTQYRGQVMADWTLRRIRQSQRDNERLLRERHARVRSTIRANNRHFGSNLASFFLMNQ 457
            LF  YR                    R++  R A++   +            +  L+ +
Sbjct: 254 RLFMDYR--------------------RMMARRAAQIGQNMPGYRSPPNRTQGNADLLRR 293

Query: 458 LGLXXXXXXXXXXXXXXXXXXXXXXXXTGRAA-------GAYGYEYEDDDAHTQNIINMI 510
           LG                          G  +       G +    E++ A TQ+I+N I
Sbjct: 294 LGPLGVRIGIGTGMGESLTHYILEPGIFGYGSFRMIGNPGGFDDGMEEE-ARTQSILNAI 352

Query: 511 QRREDAERDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEP-KVKMTVKKNGKDET 569
           Q RE+ ERD++TK  M KT+ Q++ F ++   LPEGYS+SF T P  V++    +G  + 
Sbjct: 353 QEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTTVRLEPLNDGNKQA 412

Query: 570 VIMEDVDLAKYWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQS 629
           +++ED      W ++  C LCGVELGVG+P DF G S  D  +SF+ LV+KY  HCPYQS
Sbjct: 413 IVVEDESAIAEWEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFDELVTKYCSHCPYQS 472

Query: 630 LSKPSQLDRDLSQKVYVASCGHTFCGRCYVRIDNXXXXXXXXXXXXXXXXGSSHPDNYGP 689
           L+  +  +R LS K +VASCGHTFCGRC VRI+N                G  HPDNYGP
Sbjct: 473 LTSANGTERALSMKTFVASCGHTFCGRCVVRIENARTHSKSSKKELSKFKGPLHPDNYGP 532

Query: 690 KTCPGPSCKTLLR-SRGRMREIYF 712
           + CP   CK  +R  R +MRE +F
Sbjct: 533 RLCPATGCKQNIRLGRTKMREAFF 556

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 42/101 (41%), Gaps = 10/101 (9%)

Query: 161 NINEIGPIDPTAEYVDLDAEPEYITNSRPRTXXXXXXXXXXXXXXXXGDANXXXXXEVMI 220
           N + + P+  TAEY+DL+ EP                                   E++ 
Sbjct: 67  NADSVSPMGSTAEYIDLEMEP----------AGNEEQDDMIVYDERLSTPRDAEDDELIF 116

Query: 221 LEERTSTPTVTLNLPGGERLRINADPNERPTRSSFESLNEN 261
           ++E+T   T+ LNLPG   +RI A   +RP R SFE    N
Sbjct: 117 VQEQTRPSTIQLNLPGRNPMRITATEYDRPARRSFEQQASN 157

>Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa]
           {ON} complement(140685..142460) [1776 nt, 592 aa]
          Length = 591

 Score =  243 bits (619), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 143/364 (39%), Positives = 189/364 (51%), Gaps = 38/364 (10%)

Query: 357 IHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRRI 416
           I  Y  ++R AF HA S  EF +I++ VAP      +DDL+ L+ +          L  +
Sbjct: 258 ISLYHTNIRSAFIHANSFNEFMAIIE-VAPR--LGITDDLVDLYLR----------LEDL 304

Query: 417 RQSQRDNERLLRERHARVRSTIRANNRHFGSNLASFFLMNQLGLXXXXXXXXXXXXXXXX 476
           R        L       + S         G N  +  + N+                   
Sbjct: 305 RNRTHQANSLFVPDIDNISSNSETTRYDEGWNPVTHPVTNRF-----------------I 347

Query: 477 XXXXXXXXTGRAAGAYG------YEYEDDDAHTQNIINMIQRREDAERDSRTKGFMSKTK 530
                     R  G YG      Y+ +D++  TQ+II MIQ RE+ E+D RTK +   TK
Sbjct: 348 EDSFHSPMIRRIFGNYGGRHHQDYDDDDEEGRTQSIITMIQEREEVEKDLRTKKYSESTK 407

Query: 531 PQQDGFKKRALALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAKYWMDVPACILC 590
            +QD F++RA  LP+GYSSSF+TEPK K+ + KNG + +V + D  +A+ W ++P C LC
Sbjct: 408 EKQDEFERRATELPDGYSSSFNTEPKAKVDMTKNGVNGSVSVVDDTMAEDWEEIPICCLC 467

Query: 591 GVELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCG 650
           GV L  GIP +F G S++D  + FE L  KYD  CPYQ L +PSQ DRD S++VYVA+CG
Sbjct: 468 GVTLSEGIPDEFQGMSNEDRFLPFEELKEKYDSFCPYQCLIRPSQSDRDFSKRVYVANCG 527

Query: 651 HTFCGRCYVRIDNXXXXXXXXXXXXXXXXGSSHPDNYGPKTCPGPSCKTLLR-SRG-RMR 708
           HT+CGRCY RI N                G+ HPDNYGPK CP  SC  LLR SRG   R
Sbjct: 528 HTYCGRCYRRIQNSKEKSKLPKSQLAKLKGACHPDNYGPKKCPVTSCNRLLRISRGVAFR 587

Query: 709 EIYF 712
           E YF
Sbjct: 588 EAYF 591

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 39/93 (41%), Gaps = 7/93 (7%)

Query: 171 TAEYVDLDAEPEYITNSRPRTXXXXXXXXXXXXXXXXGDANXXXXXEVMILEERTSTPT- 229
             EYVDLD EPE +                        D N     +++I+ E+   P+ 
Sbjct: 120 VTEYVDLDHEPEDVEP----IGTSNLDGRSSGSNVNDRDRNNSNIDDLIIISEQHPQPSA 175

Query: 230 --VTLNLPGGERLRINADPNERPTRSSFESLNE 260
             + L +PG + + +     + PTRSSFE  N+
Sbjct: 176 NSIFLTIPGRQLMELQVASTDIPTRSSFEYQND 208

>CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013w Hexose metabolism-related protein
          Length = 506

 Score =  199 bits (505), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 136/217 (62%), Gaps = 11/217 (5%)

Query: 497 EDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEPK 556
           +D++A TQ+II++IQ+RE++ERD R K +  K++ Q+  F + A  LP GYS+SF+T   
Sbjct: 300 DDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATPEV 359

Query: 557 VKMTVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFEF 616
           ++    ++  +     + +           C LCGVELG+GIP++F G S +D  +SF  
Sbjct: 360 IRENDDEDNSNNDDDEDMI----------VCNLCGVELGIGIPEEFTGISKEDFALSFAE 409

Query: 617 LVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYVRIDNX-XXXXXXXXXXX 675
           L+ KY   CPYQSL KPS+LDRDLS++ YV++CGH FCGRC+ R  N             
Sbjct: 410 LMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGKSL 469

Query: 676 XXXXGSSHPDNYGPKTCPGPSCKTLLRSRGRMREIYF 712
               G+SHPDN+ PK CP  +CK  +RS+G+MRE+YF
Sbjct: 470 NVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 28/44 (63%)

Query: 218 VMILEERTSTPTVTLNLPGGERLRINADPNERPTRSSFESLNEN 261
           V +LEER +   V LNLPGG R+ +NA   E P RSSFE L  N
Sbjct: 118 VTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFERLMRN 161

>TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.186
           YDL013W
          Length = 664

 Score =  198 bits (503), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 101/248 (40%), Positives = 144/248 (58%), Gaps = 28/248 (11%)

Query: 492 YGYEYEDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSF 551
           +GY  +  +  TQ++I MIQ RE+ E D RT+ F  K +  Q   +++A  +PEGYSSSF
Sbjct: 418 FGYA-QAGEQETQDLIAMIQEREEREHDIRTRKFTKKNEKLQQLIREKAKTIPEGYSSSF 476

Query: 552 STEPKVKMTVKKNGKDETVIM---EDVDLAKYW--------MDVPACILCGVELGVGIPK 600
           STE  VK+  K++     VIM   + V++   +        ++VP C LCGVELG+GIP+
Sbjct: 477 STEVPVKLIDKQDKNGNNVIMLEEQQVEVDDEFGNKKNESVIEVPVCCLCGVELGIGIPE 536

Query: 601 DFVGTSDKDHGVS-FEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYV 659
            F G S +D  +  F+ + +KY F CPYQ++ +P++LDRDLS++ ++++CGH FCGRCY 
Sbjct: 537 TFAGISAEDKKLECFKDIATKYGFSCPYQTMVRPTELDRDLSRRTFISNCGHAFCGRCYN 596

Query: 660 RID---------------NXXXXXXXXXXXXXXXXGSSHPDNYGPKTCPGPSCKTLLRSR 704
           RI                N                GS +PDNYGPK CPG  CK  +R+R
Sbjct: 597 RIHLAKAETKKNNGRDITNKLTRLSQSNRISPVILGSLNPDNYGPKICPGSDCKYQIRAR 656

Query: 705 GRMREIYF 712
            +MRE YF
Sbjct: 657 TKMREAYF 664

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 50/104 (48%), Gaps = 25/104 (24%)

Query: 156 THNNNNINEIGPIDPTAEYVDLDAEPEYITNSRPRTXXXXXXXXXXXXXXXXGDANXXXX 215
           T NN+N++++  I+   E VDLD EPE IT+                       AN    
Sbjct: 77  TANNDNMDDLSVIN-EREVVDLDREPE-ITSV----------------------ANNTND 112

Query: 216 XEVMIL-EERTSTPTVTLNLPGGERLRINADPNERPTRSSFESL 258
            ++MI+ E+    P + LNLPGG    ++   N+ P RSSFE L
Sbjct: 113 DDLMIVGEQVIENPHILLNLPGGRTFELSTTTNDLPFRSSFEML 156

>Smik_12.407 Chr12 complement(716407..717186) [780 bp, 259 aa] {ON}
           YLR323C (REAL)
          Length = 259

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 20/83 (24%)

Query: 598 IPKDFVGTSDKDHGVSFEFLVSKYDFHCPY---------QSLSKPSQLDRD-------LS 641
           + KDF  T    +G S +FL S+ DF   +         +  SK + LD D       L 
Sbjct: 143 VCKDFKQTGYCGYGDSCKFLHSRDDFKTGWKLNQDWNAEEEDSKTATLDLDKIPFKCTLC 202

Query: 642 QKVY----VASCGHTFCGRCYVR 660
           ++ Y    V SCGH FC  C+ +
Sbjct: 203 KEDYKSPVVTSCGHYFCASCFAK 225

>Suva_10.418 Chr10 complement(739402..740181) [780 bp, 259 aa] {ON}
           YLR323C (REAL)
          Length = 259

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 20/82 (24%)

Query: 598 IPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQ---------SLSKPSQLDRD-------LS 641
           + KDF  T    +G S +FL S+ DF   ++           S+ + LD D       + 
Sbjct: 143 VCKDFKQTGFCGYGDSCKFLHSRDDFKTGWKLNQEWNVDNEDSRKNALDLDKIPFKCVIC 202

Query: 642 QKVY----VASCGHTFCGRCYV 659
           +K Y    V +CGH FCG C+ 
Sbjct: 203 KKDYKSPVVTNCGHYFCGSCFA 224

>KLTH0G09130g Chr7 complement(746572..754329) [7758 bp, 2585 aa] {ON}
            similar to uniprot|P40468 Saccharomyces cerevisiae
            YIL129C TAO3 Identified in a hunt for mutants that
            activate OCH1 transcription Transcriptional Activator of
            OCH1
          Length = 2585

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 25/45 (55%)

Query: 410  DWTLRRIRQSQRDNERLLRERHARVRSTIRANNRHFGSNLASFFL 454
            +W LR++ Q  +D ++ L E+  +     +    +F S L+SF+L
Sbjct: 1193 EWILRKVSQYLKDAKKFLEEKEVQTSFNYQQLRSYFASLLSSFYL 1237

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,367,104
Number of extensions: 2242378
Number of successful extensions: 8819
Number of sequences better than 10.0: 28
Number of HSP's gapped: 8966
Number of HSP's successfully gapped: 64
Length of query: 712
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 595
Effective length of database: 40,065,477
Effective search space: 23838958815
Effective search space used: 23838958815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)