Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A019507.341ON1221225264e-70
NCAS0A140807.341ON78901674e-16
TDEL0C020607.341ON88881554e-14
ZYRO0F11528g7.341ON1211011559e-14
TPHA0F029107.341ON1081021496e-13
Kpol_530.377.341ON88891451e-12
Kwal_YGOB_Anc_7.3417.341ON86891442e-12
CAGL0I03432g7.341ON149901482e-12
KLLA0C16709g7.341ON79841371e-11
Skud_4.957.341ON79811362e-11
Suva_4.847.341ON81901353e-11
TBLA0E004707.341ON1161061373e-11
KLTH0H01452g7.341ON86891345e-11
Smik_4.767.341ON80851338e-11
YDL160C-A (MHF2)7.341ON80851321e-10
SAKL0F10956g7.341ON86851284e-10
KNAG0C038107.341ON82851284e-10
ACL158W7.341ON95881279e-10
Ecym_45207.341ON91951172e-08
KAFR0B009007.341ON7891952e-05
SAKL0G03586g5.476ON85336671.0
KAFR0A041308.725ON42955651.6
SAKL0H10098g8.539ON55574609.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A01950
         (122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...   207   4e-70
NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}               69   4e-16
TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...    64   4e-14
ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...    64   9e-14
TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...    62   6e-13
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    60   1e-12
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...    60   2e-12
CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...    62   2e-12
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    57   1e-11
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...    57   2e-11
Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...    57   3e-11
TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...    57   3e-11
KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...    56   5e-11
Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...    56   8e-11
YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...    55   1e-10
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...    54   4e-10
KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...    54   4e-10
ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...    54   9e-10
Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...    50   2e-08
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    41   2e-05
SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some s...    30   1.0  
KAFR0A04130 Chr1 (831244..832533) [1290 bp, 429 aa] {ON} Anc_8.7...    30   1.6  
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    28   9.0  

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score =  207 bits (526), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 109/122 (89%)

Query: 1   MLHGLGLGLEVSEAILSSFLLETNALRNIQADMTILLETIEKILRSESFQNKDTTITKET 60
           MLHGLGLGLEVSEAILSSFLLETNALRNIQADMTILLETIEKILRSESFQNKDTTITKET
Sbjct: 1   MLHGLGLGLEVSEAILSSFLLETNALRNIQADMTILLETIEKILRSESFQNKDTTITKET 60

Query: 61  ILMIQRYMDLFIKEAVIRSYENKVATQVXXXXXXXXXXXXXKTIELTHLDLERIVGLLLM 120
           ILMIQRYMDLFIKEAVIRSYENKVATQV             KTIELTHLDLERIVGLLLM
Sbjct: 61  ILMIQRYMDLFIKEAVIRSYENKVATQVEDFDDEEDADEEDKTIELTHLDLERIVGLLLM 120

Query: 121 EL 122
           EL
Sbjct: 121 EL 122

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score = 68.9 bits (167), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 12/90 (13%)

Query: 33  MTILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXX 92
           M I  ETI +IL+ E+F+N DT +T+ET+ MIQRYM+LFI+EA+ RS +NK         
Sbjct: 1   MAIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNK--------- 51

Query: 93  XXXXXXXXXKTIELTHLDLERIVGLLLMEL 122
                      I +   DLER+VGLLL+++
Sbjct: 52  ---EKELGQTDIVIDEKDLERVVGLLLLDM 78

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 88

 Score = 64.3 bits (155), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 53/88 (60%), Gaps = 4/88 (4%)

Query: 35  ILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXXXX 94
           I  ETI +  +  +F+N+ T IT ET+ M+Q+YM++F++EAV+RS  NK   +V      
Sbjct: 5   IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKV----EH 60

Query: 95  XXXXXXXKTIELTHLDLERIVGLLLMEL 122
                    I LTH DLE I GLLL+++
Sbjct: 61  SGAQRNSNEIVLTHEDLENITGLLLLDM 88

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score = 64.3 bits (155), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 66/101 (65%), Gaps = 10/101 (9%)

Query: 24  NALRNI-QADMTILL-ETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYE 81
           + ++NI   DM+++  ETI +IL+ ++F+++ TTIT+ET+ M+Q+Y+++F++EAV RS  
Sbjct: 29  HKIQNIGHVDMSMVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVA 88

Query: 82  NKVATQVXXXXXXXXXXXXXKTIELTHLDLERIVGLLLMEL 122
           NK +                  I+L H DLE+I G+LL+++
Sbjct: 89  NKDS--------QGSHGDGDGEIQLNHEDLEKITGMLLLDM 121

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score = 62.0 bits (149), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (55%), Gaps = 12/102 (11%)

Query: 32  DMTILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXX 91
           D  I  +TI +IL+ ESF  ++T I+ E++ ++Q+YM+LF++EAV+RS EN+   Q    
Sbjct: 7   DGPIPKDTIARILQLESF-GEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIE 65

Query: 92  XXXXXXXXXXKT-----------IELTHLDLERIVGLLLMEL 122
                                  IELTH DLE I GLLL+++
Sbjct: 66  ALKKAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
           complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 60.5 bits (145), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (59%), Gaps = 7/89 (7%)

Query: 34  TILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXXX 93
            I  ETI ++L + SF++  T IT++ +  +Q+YM+LF++EA++RS E K   +      
Sbjct: 6   PIPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIETKAKLEEENSFT 65

Query: 94  XXXXXXXXKTIELTHLDLERIVGLLLMEL 122
                     +ELTH DLE I GLLL+++
Sbjct: 66  GVR-------VELTHTDLEEIAGLLLLDM 87

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 86

 Score = 60.1 bits (144), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 55/89 (61%), Gaps = 6/89 (6%)

Query: 34  TILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXXX 93
           ++  +TI +I ++ SFQN  T IT+ T+ ++  Y+++F++EA++RS ENK   QV     
Sbjct: 4   SVPKDTIARIFQTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENK--DQVKDEHQ 61

Query: 94  XXXXXXXXKTIELTHLDLERIVGLLLMEL 122
                     + LTH DLER+ GLLL+++
Sbjct: 62  DQLGSQ----VVLTHKDLERVSGLLLLDM 86

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score = 61.6 bits (148), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 54/90 (60%), Gaps = 8/90 (8%)

Query: 33  MTILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXX 92
           M +  +TI ++L+  +F++K T I  + +  +QRY+D+F +EAV+RS E+  A+Q     
Sbjct: 68  MDVPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQ----- 122

Query: 93  XXXXXXXXXKTIELTHLDLERIVGLLLMEL 122
                    +  E+TH DLE I GLLL+++
Sbjct: 123 ---EGLEQEQDKEITHTDLENIAGLLLLDM 149

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conserved
           hypothetical protein
          Length = 79

 Score = 57.4 bits (137), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 51/84 (60%), Gaps = 14/84 (16%)

Query: 39  TIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXXXXXXXX 98
           TI +IL++E FQ+ +T IT+E + +++ Y++LF++E V+RS ENK               
Sbjct: 9   TIARILQTEGFQDSNTRITEECMQLLEPYIELFVREGVLRSLENKA------------DM 56

Query: 99  XXXKTIELTHLDLERIVGLLLMEL 122
              KT++   +DLE + GLLLM+ 
Sbjct: 57  LADKTVDF--VDLEAVAGLLLMDF 78

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
           YDL160C-A (REAL)
          Length = 79

 Score = 57.0 bits (136), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 48/81 (59%), Gaps = 10/81 (12%)

Query: 42  KILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXXXXXXXXXXX 101
           KIL   +F+ KD  I  + + MIQ Y+D+FI+EA +RS +++                  
Sbjct: 9   KILSQNNFR-KDIKIDDKVLPMIQNYLDIFIEEAALRSLQSQKDAS---------GGHRD 58

Query: 102 KTIELTHLDLERIVGLLLMEL 122
             +EL+HLDLERIVGLLLM++
Sbjct: 59  GPLELSHLDLERIVGLLLMDM 79

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
           YDL160C-A (REAL)
          Length = 81

 Score = 56.6 bits (135), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 54/90 (60%), Gaps = 9/90 (10%)

Query: 33  MTILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXX 92
           M +  E I KIL S++  +K+  I  + I MIQ+Y+++FI+EA +RS ++   +      
Sbjct: 1   MILPKEAIIKIL-SQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSS----- 54

Query: 93  XXXXXXXXXKTIELTHLDLERIVGLLLMEL 122
                      +EL+HLDLERIVGLLLM++
Sbjct: 55  ---GAHDGDGPLELSHLDLERIVGLLLMDM 81

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score = 57.4 bits (137), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 56/106 (52%), Gaps = 13/106 (12%)

Query: 30  QADMTILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVX 89
           + D+ +   TI +IL++ SF +++T ITK T+  +Q+YM+LFI+EA +RS ENK      
Sbjct: 11  ETDVKLPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISN 70

Query: 90  XXXXXXXXXXXXKT-------------IELTHLDLERIVGLLLMEL 122
                        T             IEL+H  LE I GLLL+++
Sbjct: 71  EKSAVKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
           weakly similar to uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160c-a
          Length = 86

 Score = 56.2 bits (134), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 54/89 (60%), Gaps = 6/89 (6%)

Query: 34  TILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXXX 93
           +I  +TI +I ++ SF++  T IT+ T+ ++  Y+++F++EA++RS ENK   +      
Sbjct: 4   SIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVK------ 57

Query: 94  XXXXXXXXKTIELTHLDLERIVGLLLMEL 122
                     + LTH DLER+ GLLL+++
Sbjct: 58  SEHQDQLGDQVVLTHKDLERVSGLLLLDM 86

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
           YDL160C-A (REAL)
          Length = 80

 Score = 55.8 bits (133), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 50/85 (58%), Gaps = 9/85 (10%)

Query: 38  ETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXXXXXXX 97
           E + KIL S++   KD  I+ E I MIQ+Y+D+FI+EA +RS ++               
Sbjct: 5   EALVKIL-SQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSH--------KDINKE 55

Query: 98  XXXXKTIELTHLDLERIVGLLLMEL 122
                 +EL+H DLER+VG+LLM++
Sbjct: 56  HDKKDPLELSHQDLERVVGVLLMDM 80

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
           MHF2Protein of unknown function; ortholog of human MHF2,
           and component of the heterotetrameric MHF histone-fold
           complex that in humans interacts with both DNA and Mph1p
           ortholog FANCM to stabilize and remodel blocked
           replication forks and repair damaged DNA; mhf2 srs2
           double mutants are MMS hypersensitive
          Length = 80

 Score = 55.5 bits (132), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 9/85 (10%)

Query: 38  ETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXXXXXXX 97
           E + KIL S++    D  I  E + MIQ+Y+D+FI EAV+RS ++               
Sbjct: 5   EALIKIL-SQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDIN--------GE 55

Query: 98  XXXXKTIELTHLDLERIVGLLLMEL 122
                 +EL+H DLERIVGLLLM++
Sbjct: 56  RGDKSPLELSHQDLERIVGLLLMDM 80

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
           similar to uniprot|Q3E829 Saccharomyces cerevisiae
           YDL160C-A Putative protein of unknown function
          Length = 86

 Score = 53.9 bits (128), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (57%), Gaps = 7/85 (8%)

Query: 38  ETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXXXXXXX 97
           +TI +I ++ SF    T IT++T+ +  +Y++LF++EAV+RS ENK   +          
Sbjct: 9   DTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKEKVKPETESLDNGT 68

Query: 98  XXXXKTIELTHLDLERIVGLLLMEL 122
                   L+H DLE I GLLL+++
Sbjct: 69  V-------LSHEDLEEISGLLLLDM 86

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 82

 Score = 53.9 bits (128), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 15/85 (17%)

Query: 38  ETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXXXXXXX 97
           ET+ +IL ++SF+NK TTI  + +  +Q+Y++ +++E ++RS ENK              
Sbjct: 12  ETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENK-------------- 56

Query: 98  XXXXKTIELTHLDLERIVGLLLMEL 122
                  ELT  D+ERI+GLLL+++
Sbjct: 57  DLGVNPAELTERDIERILGLLLLDM 81

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL161CX; YDL161CX was
           overlooked in Saccharomyces cerevisiae
          Length = 95

 Score = 53.5 bits (127), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 5/88 (5%)

Query: 35  ILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXXXXX 94
           I  +TI ++  + SF    T IT++ + +++RYM LFI+EAV+RS ENK   +       
Sbjct: 13  IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADS 72

Query: 95  XXXXXXXKTIELTHLDLERIVGLLLMEL 122
                      L H DLE I G+L+++ 
Sbjct: 73  FAEGPV-----LQHTDLEEISGVLILDF 95

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
           Ashbya gossypii ACL158W
          Length = 91

 Score = 49.7 bits (117), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 5/95 (5%)

Query: 28  NIQADMTILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQ 87
           N   +  +  +TI +I +  SF    T IT++TI + ++Y+ LF++EAV+RS ENK   +
Sbjct: 2   NHSQEPVVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVK 61

Query: 88  VXXXXXXXXXXXXXKTIELTHLDLERIVGLLLMEL 122
                             L H DLE I G+LL++ 
Sbjct: 62  KEDGKGSLIEGPV-----LHHTDLEEISGILLLDF 91

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 78

 Score = 41.2 bits (95), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 14/91 (15%)

Query: 33  MTILLETIEKILRSESFQNKDT-TITKETILMIQRYMDLFIKEAVIRSYENKVATQVXXX 91
           M+I  ETI +IL ++  +N +  +I  ET+  + +Y D+ I+E V+RS ENK        
Sbjct: 1   MSIPKETISRILLNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLENK-------- 52

Query: 92  XXXXXXXXXXKTIELTHLDLERIVGLLLMEL 122
                      T  L   DLE+I+GLLL+++
Sbjct: 53  -----ENIAEATPTLDVDDLEKIIGLLLLDM 78

>SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 853

 Score = 30.4 bits (67), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 18/36 (50%)

Query: 26  LRNIQADMTILLETIEKILRSESFQNKDTTITKETI 61
           LR    DM  LLE IEK     S QN  T+ T E I
Sbjct: 273 LRTTNMDMIRLLELIEKWFFLSSTQNTGTSTTNEAI 308

>KAFR0A04130 Chr1 (831244..832533) [1290 bp, 429 aa] {ON} Anc_8.725
           YOR274W
          Length = 429

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 9   LEVSEAILSSFLLETNALRNIQADMTILLETIEKILRSESFQNKDTTITKETILM 63
           +E+   I   +    N  R +Q  + I   T  KI  SE+FQN+DTT+  +T+ +
Sbjct: 144 IEIDPEIAKRY--HPNDNRRVQRMLEIYYRT--KIRPSEAFQNQDTTLKYDTLFL 194

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 27.7 bits (60), Expect = 9.0,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 6/74 (8%)

Query: 12  SEAILSSFLLETNAL-RNIQADMTILLETIEKI-----LRSESFQNKDTTITKETILMIQ 65
           SE + S F +  N   R    D T+  +TI        +   + +N+D+T+T E + + +
Sbjct: 397 SELVKSLFTIRRNGFDREFTQDATMRTDTIALAPAAIEIHDINRKNEDSTLTGEDLKLYE 456

Query: 66  RYMDLFIKEAVIRS 79
           +  DL +K A  +S
Sbjct: 457 KLNDLSLKNATPKS 470

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,765,680
Number of extensions: 260348
Number of successful extensions: 1177
Number of sequences better than 10.0: 36
Number of HSP's gapped: 1159
Number of HSP's successfully gapped: 36
Length of query: 122
Length of database: 53,481,399
Length adjustment: 91
Effective length of query: 31
Effective length of database: 43,046,793
Effective search space: 1334450583
Effective search space used: 1334450583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)