Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A019407.343ON76576535980.0
NCAS0A141107.343ON75361126980.0
TDEL0C020407.343ON70572025750.0
CAGL0I03410g7.343ON72461325510.0
Smik_4.747.343ON84560825430.0
KNAG0C037407.343ON72761225360.0
Suva_4.827.343ON75560825340.0
YDL164C (CDC9)7.343ON75560825240.0
Skud_4.937.343ON75562125150.0
KAFR0B008307.343ON71062425110.0
Kpol_2001.717.343ON72673324240.0
SAKL0F10912g7.343ON69360224140.0
ZYRO0F11572g7.343ON73160623920.0
Kwal_56.246167.343ON71561523260.0
KLTH0H01408g7.343ON72362622780.0
KLLA0D12496g7.343ON70060822440.0
TPHA0D045707.343ON73662422010.0
ACL155W7.343ON69760821610.0
TBLA0E020507.343ON72062921300.0
TBLA0G010406.18ON9722442754e-24
NCAS0D026506.18ON9502442736e-24
TPHA0M002606.18ON9664212711e-23
TDEL0G045106.18ON9694142711e-23
Smik_15.1746.18ON9454162665e-23
CAGL0E02695g6.18ON9463902648e-23
KNAG0F028706.18ON9542792603e-22
ACR008W6.18ON9814112603e-22
ZYRO0C07854g6.18ON9444072541e-21
KLTH0C11286g6.18ON9513922532e-21
Suva_15.1806.18ON9484582532e-21
Kwal_56.224146.18ON9633972479e-21
KLLA0D01089g6.18ON9073722405e-20
Skud_15.1666.18ON9474222406e-20
YOR005C (DNL4)6.18ON9444212407e-20
KAFR0A050506.18ON9482792371e-19
NDAI0I022606.18ON9672692319e-19
Kpol_1032.76.18ON9652242192e-17
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A01940
         (765 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...  1390   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...  1043   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   996   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   987   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   984   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   981   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   980   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   976   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   973   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   971   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   938   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   934   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   926   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   900   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   882   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   868   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   852   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   837   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   825   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   110   4e-24
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   109   6e-24
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   108   1e-23
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   108   1e-23
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   107   5e-23
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   106   8e-23
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   104   3e-22
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   104   3e-22
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   102   1e-21
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   102   2e-21
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...   102   2e-21
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   100   9e-21
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...    97   5e-20
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...    97   6e-20
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...    97   7e-20
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    96   1e-19
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    94   9e-19
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    89   2e-17

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score = 1390 bits (3598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/765 (89%), Positives = 688/765 (89%)

Query: 1   MLRQLGTTRILLPNLRPIRYITMPPATPXXXXXXXXXXARENNVSKGRKQQATLGRFFSS 60
           MLRQLGTTRILLPNLRPIRYITMPPATP          ARENNVSKGRKQQATLGRFFSS
Sbjct: 1   MLRQLGTTRILLPNLRPIRYITMPPATPSSSSSSSSSSARENNVSKGRKQQATLGRFFSS 60

Query: 61  INHKKPTKDTALXXXXXXXXXXXXXXXXXXIPRKKIRLXXXXXXXXIMAESKPKSPIKLN 120
           INHKKPTKDTAL                  IPRKKIRL        IMAESKPKSPIKLN
Sbjct: 61  INHKKPTKDTALKNESKEETKEENKDDSDSIPRKKIRLSTSSSSPSIMAESKPKSPIKLN 120

Query: 121 TERXXXXXXXXXXXXXXXIVADHTLDPKTAVSKPFLCAIPYKEVCQLFQEIETTSSRLSI 180
           TER               IVADHTLDPKTAVSKPFLCAIPYKEVCQLFQEIETTSSRLSI
Sbjct: 121 TERSSSPASASASTTPTPIVADHTLDPKTAVSKPFLCAIPYKEVCQLFQEIETTSSRLSI 180

Query: 181 IKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSLT 240
           IKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEP           MKTISESCGKSLT
Sbjct: 181 IKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSLT 240

Query: 241 QIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVFNNLKMIAKAAGKDSQTKKIKLI 300
           QIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVFNNLKMIAKAAGKDSQTKKIKLI
Sbjct: 241 QIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVFNNLKMIAKAAGKDSQTKKIKLI 300

Query: 301 KRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVKEFDANKDFDMELLETA 360
           KRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVKEFDANKDFDMELLETA
Sbjct: 301 KRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVKEFDANKDFDMELLETA 360

Query: 361 EGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAINEILDRFQ 420
           EGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAINEILDRFQ
Sbjct: 361 EGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAINEILDRFQ 420

Query: 421 GETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIGDFVKDRNETKTLILD 480
           GETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIGDFVKDRNETKTLILD
Sbjct: 421 GETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIGDFVKDRNETKTLILD 480

Query: 481 CEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCLFAFDILCHNSNKLINYSLKERR 540
           CEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCLFAFDILCHNSNKLINYSLKERR
Sbjct: 481 CEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCLFAFDILCHNSNKLINYSLKERR 540

Query: 541 EILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKR 600
           EILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKR
Sbjct: 541 EILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKR 600

Query: 601 SRNWLKLKKDYLEGIGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNDNTGEFETCCKIGT 660
           SRNWLKLKKDYLEGIGDSLDLCVL               FLLGCYNDNTGEFETCCKIGT
Sbjct: 601 SRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNDNTGEFETCCKIGT 660

Query: 661 GFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWFEPSLLFEVLTADLSLSPIYKAG 720
           GFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWFEPSLLFEVLTADLSLSPIYKAG
Sbjct: 661 GFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWFEPSLLFEVLTADLSLSPIYKAG 720

Query: 721 SSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHRSS 765
           SSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHRSS
Sbjct: 721 SSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHRSS 765

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 1043 bits (2698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/611 (82%), Positives = 539/611 (88%), Gaps = 1/611 (0%)

Query: 152 SKPFLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLG 211
           +KP+  +IPY+EVC LFQEIE+TSSRL+IIKLCSDF IKIMK++PQNLIPVTYLFINKLG
Sbjct: 142 TKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLG 201

Query: 212 PDYEPXXXXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKP 271
           PDYEP           MKTISESCGKSL Q+R +YRELGDLGQIA++ARNVQPTMFKPKP
Sbjct: 202 PDYEPGLELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKP 261

Query: 272 LTVGEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEK 331
           LTVGEVF NL++IAK+ GKDSQT+KIKLIKRMLTACE G EAKFLIRSLESKLRIGLAEK
Sbjct: 262 LTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACE-GTEAKFLIRSLESKLRIGLAEK 320

Query: 332 TVLISLSKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNE 391
           TVLISLSKALLV E   NKDFDMELLETAE KIRDAFCQVPNYEIVINSCL+YGIM L  
Sbjct: 321 TVLISLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELET 380

Query: 392 HCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRN 451
           HCSLRPGIPLKPMLAKPTKAINEILDRFQGE FTSEYKYDGERAQVHLL DGTMRIYSRN
Sbjct: 381 HCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSRN 440

Query: 452 GENMTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKD 511
           GENMTERYPEIHI DF+ D   T TLILDCEAVAWD EQ KILPFQVLSTRKRKDV  KD
Sbjct: 441 GENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVDLKD 500

Query: 512 VKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKF 571
           VKV+VCLFAFDILCHN  KLIN SL+ERR+IL  VT    GEFQYATE+T+SNLDELQKF
Sbjct: 501 VKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKF 560

Query: 572 LDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXXXX 631
           LDQSV+DSCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCV+       
Sbjct: 561 LDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRG 620

Query: 632 XXXXXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSS 691
                   FLLGCYN +TGEFETCCKIGTGFSDEMLQQL+ +L  TV+DGPKAT++YDSS
Sbjct: 621 KRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSS 680

Query: 692 AEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSE 751
           AEPDVWFEP+LLFEVLTADLSLSPIYKAGSS YDKG+SLRFPRFIR REDKGVEDATSSE
Sbjct: 681 AEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSE 740

Query: 752 QIIELYENQSH 762
           QIIELYENQ+H
Sbjct: 741 QIIELYENQAH 751

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  996 bits (2575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/720 (69%), Positives = 558/720 (77%), Gaps = 33/720 (4%)

Query: 43  NVSKGRKQQATLGRFFSSINHKKPTKDTALXXXXXXXXXXXXXXXXXXIPRKKIRLXXXX 102
            +S G+KQ ATL RFFS++  K  TK+                         KI      
Sbjct: 17  GMSSGKKQ-ATLARFFSAV-QKDDTKEKVNGDV-------------------KIIESRDN 55

Query: 103 XXXXIMAESKPKSPIKLNTERXXXXXXXXXXXXXXXIVADHTLDPKTAVSKPFLCAIPYK 162
               +  + K  SP+KL T                    D  + P    SK     +PY 
Sbjct: 56  QDEPVTKKFKSSSPVKLQTSSLSPVKSAGVES------GDKPVSPDLYYSK-----VPYS 104

Query: 163 EVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPXXXXXX 222
           +VC +FQEIE TSSRLSIIK+CS+F  +IMK +PQNLIP TYLFIN+LGPDYEP      
Sbjct: 105 DVCNVFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPGLELGL 164

Query: 223 XXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVFNNLK 282
                MKTISE+CGKSL Q++ +YRE+GDLGQIALEARNVQPTMFKPKPLTVGEVF NL+
Sbjct: 165 GEGLLMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLR 224

Query: 283 MIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLSKALL 342
            IA + GKDSQT+KIKLIKRMLTACE GVEAKFLIRSLESKLRIGLAEKTVLISLSKALL
Sbjct: 225 AIAHSQGKDSQTRKIKLIKRMLTACE-GVEAKFLIRSLESKLRIGLAEKTVLISLSKALL 283

Query: 343 VKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLK 402
             E +  K+  MEL+E AE KIRDAFCQVPNYEIVIN+CL YGIM L++HC LRPGIPLK
Sbjct: 284 TNEGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLK 343

Query: 403 PMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEI 462
           PMLAKPTK+I E+LDRFQG+TFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEI
Sbjct: 344 PMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEI 403

Query: 463 HIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCLFAFD 522
            I DFV D   TKTLILDCEAVAWDK QQKILPFQVLSTRKRKDV AKDVKVRVCLFAFD
Sbjct: 404 SIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFD 463

Query: 523 ILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEG 582
           I+CHN  + IN SL+ERRE+L +VT P  GEFQYA ELTTS+++ELQKFLDQSV DSCEG
Sbjct: 464 IICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEG 523

Query: 583 LMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXXXXXXXXXXXXFLL 642
           LMVKML+G ESHYEPSKRSRNWLKLKKDYL+G+GDSLDLCVL               FLL
Sbjct: 524 LMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLL 583

Query: 643 GCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWFEPSL 702
           GCYN ++GEFETCCKIGTGFSDEMLQQL+E+   T +DGPKATY++DSSAEPDVWFEP+ 
Sbjct: 584 GCYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTT 643

Query: 703 LFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSH 762
           LFEVLTADLSLSP+YKAG+S YDKGVSLRFPRF+R+R+DK VEDATSS QI+ELY++QSH
Sbjct: 644 LFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSH 703

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  987 bits (2551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/613 (76%), Positives = 529/613 (86%), Gaps = 2/613 (0%)

Query: 151 VSKPFLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKL 210
           V   F C +PY ++C LF+EIE TSSRL+IIKLCSDF IKIMK+DPQNLIPVTYLFINKL
Sbjct: 110 VDSKFFCKVPYSDLCNLFEEIEGTSSRLAIIKLCSDFFIKIMKEDPQNLIPVTYLFINKL 169

Query: 211 GPDYEPXXXXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPK 270
           GPDYEP           MKTISESCGKS+ QI+ QYRE+GDLGQIALEARNVQPTMFKPK
Sbjct: 170 GPDYEPGLELGLGENLLMKTISESCGKSMQQIKNQYREIGDLGQIALEARNVQPTMFKPK 229

Query: 271 PLTVGEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAE 330
           PL VGEVF NLK IAK+ GKDSQTKK+KLIKRMLTAC+ G EAKFLIRSLESKLRIGLAE
Sbjct: 230 PLVVGEVFENLKTIAKSQGKDSQTKKMKLIKRMLTACQ-GTEAKFLIRSLESKLRIGLAE 288

Query: 331 KTVLISLSKALLVK-EFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNL 389
           KTVLI+LSKALL+  E  +NK+  M+++E AE KIRDAFCQVPNYE+VIN+CL YGIM L
Sbjct: 289 KTVLIALSKALLIHDEKYSNKEPSMDVVEQAEQKIRDAFCQVPNYELVINACLDYGIMKL 348

Query: 390 NEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYS 449
           +EHC+++PGIPLKPMLAKPTKAINE+LDRFQG+TFTSEYKYDGERAQVHLL+DGTMRIYS
Sbjct: 349 DEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDGTMRIYS 408

Query: 450 RNGENMTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLA 509
           RNGENMTERYPEI I DF+ D   T +LILDCEAVAWDKEQ KILPFQVL+TRKRKDV  
Sbjct: 409 RNGENMTERYPEIQIKDFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVNI 468

Query: 510 KDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQ 569
            +VKVRVCLFAFDIL HN  +LIN  L +RRE+LH VT P  GEFQYAT++TTSNLDELQ
Sbjct: 469 NEVKVRVCLFAFDILLHNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQ 528

Query: 570 KFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXX 629
           KFLD+SV +SCEGLMVKM++G ES+YEPSKRSRNWLKLKKDYLEG+GDSLDLCVL     
Sbjct: 529 KFLDESVKNSCEGLMVKMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFG 588

Query: 630 XXXXXXXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYD 689
                     FLLGCYN ++ +FETCCKIGTGFS+EMLQ L+EKL  TVIDGPK TY++D
Sbjct: 589 RGKRTGTYGGFLLGCYNADSEDFETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFD 648

Query: 690 SSAEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATS 749
           SSAEPDVWFEP++LFEVLTADLSLSPIYKAGSS YDKG+SLRFPRF+RIR+DK VEDATS
Sbjct: 649 SSAEPDVWFEPTMLFEVLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATS 708

Query: 750 SEQIIELYENQSH 762
           SEQIIE+Y+NQSH
Sbjct: 709 SEQIIEMYQNQSH 721

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  984 bits (2543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/608 (77%), Positives = 527/608 (86%), Gaps = 5/608 (0%)

Query: 159 IPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPXX 218
           IPY +VC++F +IE  SSRL II++CSDF IK+MKQ  +NLIP TYLFIN+LGPDYE   
Sbjct: 236 IPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYEAGL 295

Query: 219 XXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVF 278
                    MKTISESCGKS++QI+ +Y+E+GDLG+IA+ ARNVQPTMFKPKPLTVGEVF
Sbjct: 296 ELGLGENLLMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVF 355

Query: 279 NNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLS 338
            NL+ IAK  GKDSQ +KIKLIKRMLTAC+ GVEAKFLIRSLESKLRIGLAEKTVLISLS
Sbjct: 356 KNLRTIAKTQGKDSQLRKIKLIKRMLTACQ-GVEAKFLIRSLESKLRIGLAEKTVLISLS 414

Query: 339 KALLV----KEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCS 394
           KALL+    +E  A+KD  M++LE+A+ KIRDAFCQVPNYEIVINSCL++GIMNL+++C+
Sbjct: 415 KALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCT 474

Query: 395 LRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGEN 454
           LRPGIPLKPMLAKPTKAINE+LDRFQGETFTSEYKYDGERAQVHLL DGTMRIYSRNGEN
Sbjct: 475 LRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGEN 534

Query: 455 MTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKV 514
           MTERYPEI I DF++D + TK LILDCEAVAWDK+Q KILPFQVLSTRKRKDV   DVKV
Sbjct: 535 MTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKV 594

Query: 515 RVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQ 574
           RVCLFAFDILCHN  +LIN SL+ERRE L +VT   PGEFQYAT++ T+NLDELQKFLD+
Sbjct: 595 RVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDE 654

Query: 575 SVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXXXXXXX 634
           SVN SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCVL          
Sbjct: 655 SVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRT 714

Query: 635 XXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEP 694
                FLLGCYN +TGEFETCCKIGTGFSDEMLQ LH +L  T+IDGPKATY++DSSAEP
Sbjct: 715 GTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAEP 774

Query: 695 DVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQII 754
           DVWFEP+ LFEVLTADLSLSPIYKAGS+ +DKGVSLRFPRF+RIREDKGVEDATSS+QI+
Sbjct: 775 DVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIV 834

Query: 755 ELYENQSH 762
           ELYENQSH
Sbjct: 835 ELYENQSH 842

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  981 bits (2536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/612 (76%), Positives = 529/612 (86%), Gaps = 2/612 (0%)

Query: 152 SKPFLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLG 211
           +K F   +PY ++C LFQEIE  SSRL+IIKLCS FLI +MK DP+NLIP+TYLFINKLG
Sbjct: 114 TKEFYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLG 173

Query: 212 PDYEPXXXXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKP 271
           PDY P           +KTI+ESCG+SL QI+ +Y E+GDLGQIALEAR VQPTMFKPKP
Sbjct: 174 PDYMPGLELGLGENLLIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKP 233

Query: 272 LTVGEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEK 331
           LTVGEVF NLK IA + GKDSQTKKIKLIKRMLT+C+ GVEAKFLIRSLESKLRIGLAEK
Sbjct: 234 LTVGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQ-GVEAKFLIRSLESKLRIGLAEK 292

Query: 332 TVLISLSKALLVKEF-DANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLN 390
           TVLISLSKALLV E+ +++KD DME +E AE KIRDAFCQVPNYE+VI+SCL++GIMNL+
Sbjct: 293 TVLISLSKALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLD 352

Query: 391 EHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSR 450
           +HCSLRP IPLKPMLAKPTK+I+EI DRFQ + FT EYKYDGERAQVHLLEDGTMRIYSR
Sbjct: 353 QHCSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSR 412

Query: 451 NGENMTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAK 510
           NGENMTERYPEIHI DFV D + TK+LILDCEAVAWDKEQ KILPFQVLSTRKRKDV   
Sbjct: 413 NGENMTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDIN 472

Query: 511 DVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQK 570
           ++KVRVCLFAFDIL HN  KLIN SL+ERR+ILH +T    GEFQ+ATE+TT+NL+ELQ 
Sbjct: 473 EIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQS 532

Query: 571 FLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXXX 630
           FLDQSV +SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYL G+GDSLDLCVL      
Sbjct: 533 FLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGR 592

Query: 631 XXXXXXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDS 690
                    FLLGCYN +TGEFET CKIGTGFSDE+LQQLHE+LK+TVID PKATY++D 
Sbjct: 593 GKRTGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDP 652

Query: 691 SAEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSS 750
           SAEPDVWFEP+LLFEVLTADLSLSP+YKAGSS YDKGVSLRFPRF+R+REDKGVEDATSS
Sbjct: 653 SAEPDVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSS 712

Query: 751 EQIIELYENQSH 762
           EQI+E+YENQ++
Sbjct: 713 EQIVEMYENQAN 724

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  980 bits (2534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/608 (77%), Positives = 522/608 (85%), Gaps = 5/608 (0%)

Query: 159 IPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPXX 218
           IPY EVC++F EIE  SSRL II++CSDF IKIMKQ  +NLIP TYLFIN+LGPDYEP  
Sbjct: 146 IPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEPGL 205

Query: 219 XXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVF 278
                    MKTISESCGKS+ QI+ +Y+E+GDLG+IA+ ARNVQPTMFKPKPLTVGEVF
Sbjct: 206 ELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVF 265

Query: 279 NNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLS 338
            NL+ IAK  GKDSQ +K+KLIKRMLTAC+ GVEAKFLIRSLESKLRIGLAEKTVLISLS
Sbjct: 266 KNLRSIAKTQGKDSQLRKMKLIKRMLTACQ-GVEAKFLIRSLESKLRIGLAEKTVLISLS 324

Query: 339 KALLVKEFDANK----DFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCS 394
           KALL+   +       D  M++LE+A+ KIRDAFCQVPNYEIVINSCL++GIMNL++ C+
Sbjct: 325 KALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCT 384

Query: 395 LRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGEN 454
           L+PGIPLKPMLAKPTKAINE+LDRFQGETFTSEYKYDGERAQVHLL+DGTMRIYSRNGEN
Sbjct: 385 LKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGEN 444

Query: 455 MTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKV 514
           MTERYPEI I DF++D + TK LILDCEAVAWDKEQ KILPFQVLSTRKRKDV   DVKV
Sbjct: 445 MTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKV 504

Query: 515 RVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQ 574
           RVCLFAFD+LCHN  +LIN SL+ERRE L +VT   PGEFQYAT++ T NLDELQKFLD+
Sbjct: 505 RVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDE 564

Query: 575 SVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXXXXXXX 634
           SVN SCEGLMVKMLEG ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCVL          
Sbjct: 565 SVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRT 624

Query: 635 XXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEP 694
                FLLGCYN +TGEFETCCKIGTGFSDE LQQLHE+L  T+IDGPKAT+++DSSAEP
Sbjct: 625 GTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEP 684

Query: 695 DVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQII 754
           DVWFEP+ LFEVLTADLSLSPIYKAGS+ + KGVSLRFPRF+RIREDKGVEDATSSEQI+
Sbjct: 685 DVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIV 744

Query: 755 ELYENQSH 762
           ELYENQSH
Sbjct: 745 ELYENQSH 752

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  976 bits (2524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/608 (76%), Positives = 529/608 (87%), Gaps = 5/608 (0%)

Query: 159 IPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPXX 218
           IPY EVC++F +IE  SSRL II++CSDF IKIMKQ  +NLIP TYLFIN+LGPDYE   
Sbjct: 146 IPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEAGL 205

Query: 219 XXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVF 278
                    MKTISE+CGKS++QI+ +Y+++GDLG+IA+ ARNVQPTMFKPKPLTVGEVF
Sbjct: 206 ELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVF 265

Query: 279 NNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLS 338
            NL+ IAK  GKDSQ KK+KLIKRMLTAC+ G+EAKFLIRSLESKLRIGLAEKTVLISLS
Sbjct: 266 KNLRAIAKTQGKDSQLKKMKLIKRMLTACK-GIEAKFLIRSLESKLRIGLAEKTVLISLS 324

Query: 339 KALLV----KEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCS 394
           KALL+    +E   +KD  M++LE+A+ KIRDAFCQVPNYEIVINSCL++GIMNL+++C+
Sbjct: 325 KALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCT 384

Query: 395 LRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGEN 454
           LRPGIPLKPMLAKPTKAINE+LDRFQGETFTSEYKYDGERAQVHLL DGTMRIYSRNGEN
Sbjct: 385 LRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGEN 444

Query: 455 MTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKV 514
           MTERYPEI+I DF++D + TK LILDCEAVAWDK+Q KILPFQVLSTRKRKDV   DVKV
Sbjct: 445 MTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKV 504

Query: 515 RVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQ 574
           +VCLFAFDILC+N  +LIN SLKERRE L +VT   PGEFQYAT++TT+NLDELQKFLD+
Sbjct: 505 KVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDE 564

Query: 575 SVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXXXXXXX 634
           SVN SCEGLMVKMLEG ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCVL          
Sbjct: 565 SVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRT 624

Query: 635 XXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEP 694
                FLLGCYN +TGEFETCCKIGTGFSDEMLQ LH++L  T+IDGPKAT+++DSSAEP
Sbjct: 625 GTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEP 684

Query: 695 DVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQII 754
           DVWFEP+ LFEVLTADLSLSPIYKAGS+ +DKGVSLRFPRF+RIREDKGVEDATSS+QI+
Sbjct: 685 DVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIV 744

Query: 755 ELYENQSH 762
           ELYENQSH
Sbjct: 745 ELYENQSH 752

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/621 (75%), Positives = 531/621 (85%), Gaps = 5/621 (0%)

Query: 146 DPKTAVSKPFLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYL 205
           +P +  +  +   IPY EVC++F +IE  SSRL II++CSDF IKIM Q  +NLIP TYL
Sbjct: 133 EPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYL 192

Query: 206 FINKLGPDYEPXXXXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPT 265
           FIN+LGPDYE            MKTISESCGKS++QI+ +Y+E+GDLG+IA+ ARNVQPT
Sbjct: 193 FINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPT 252

Query: 266 MFKPKPLTVGEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLR 325
           MFKPK LTVGEVF NL+ IAK  GKDSQ +K+KLIKRMLTAC+ GVEAKFLIRSLESKLR
Sbjct: 253 MFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQ-GVEAKFLIRSLESKLR 311

Query: 326 IGLAEKTVLISLSKALLV----KEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSC 381
           IGLAEKTVLISLSKALL+    KE   +K+  M++LE+A+ +IRDAFCQVPNYEIVINSC
Sbjct: 312 IGLAEKTVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSC 371

Query: 382 LQYGIMNLNEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLE 441
           L +GIMNL+++C+LRPGIPLKPMLAKPTKAINE+LDRFQGETFTSEYKYDGERAQVHLL 
Sbjct: 372 LNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLN 431

Query: 442 DGTMRIYSRNGENMTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLST 501
           DGTMRIYSRNGENMTERYPEI I DF++D N TK LILDCEAVAWDKEQ+KILPFQ+LST
Sbjct: 432 DGTMRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILST 491

Query: 502 RKRKDVLAKDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELT 561
           RKRKDV   DVKV+VCLFAFDILC+N  +LIN SL+ERRE L +VT   PGEFQYAT++ 
Sbjct: 492 RKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQII 551

Query: 562 TSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDL 621
           T+NLDELQKFLD+SVN+SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEG+GDSLDL
Sbjct: 552 TNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 611

Query: 622 CVLXXXXXXXXXXXXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDG 681
           CVL               FLLGCYN +TGEFETCCKIGTGFSDEMLQ LHE+L  T+IDG
Sbjct: 612 CVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDG 671

Query: 682 PKATYIYDSSAEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIRED 741
           PKAT+++D+SAEPDVWFEP+ LFEVLTADLSLSPIYKAGS+ +DKGVSLRFPRF+RIRED
Sbjct: 672 PKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIRED 731

Query: 742 KGVEDATSSEQIIELYENQSH 762
           KGVEDATSS+QIIELYENQSH
Sbjct: 732 KGVEDATSSDQIIELYENQSH 752

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/624 (74%), Positives = 530/624 (84%), Gaps = 1/624 (0%)

Query: 139 IVADHTLDPKTAVSKPFLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQN 198
           I +  T   +T V + F+C IPY +VC LFQEIE  SSRL IIKLCS+F  K MKQ+  N
Sbjct: 85  IESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMKQNTAN 144

Query: 199 LIPVTYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALE 258
           LIP+TYLFINKLGPDYE            MKTISESCGKSL Q++  Y+++GDLG IA+ 
Sbjct: 145 LIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQQVKLDYKDIGDLGTIAMN 204

Query: 259 ARNVQPTMFKPKPLTVGEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIR 318
           ARNVQPTMFKPKPLTVG VF NLK+IAK++GKDSQ KKI+LIK++LTAC+ G+EAK+LIR
Sbjct: 205 ARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLTACK-GIEAKYLIR 263

Query: 319 SLESKLRIGLAEKTVLISLSKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVI 378
           SLESKLRIGLAEK+VLISLSKALL+ E++   D DMEL+E AE KIRDAFCQ+PNYEIVI
Sbjct: 264 SLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRDAFCQIPNYEIVI 323

Query: 379 NSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVH 438
           NSCL+YGIMNL+EHCSLRPGIPLKPMLAKPTK I E+ DRFQ   FTSEYKYDGERAQVH
Sbjct: 324 NSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVH 383

Query: 439 LLEDGTMRIYSRNGENMTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQV 498
           L+ DG+MRIYSRNGENMTERYPEI++ DF+KD N TK+LI+DCEAVAWD+E++KILPFQV
Sbjct: 384 LMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQV 443

Query: 499 LSTRKRKDVLAKDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYAT 558
           LSTRKRKDV  KD+KVR+CLFAFDILCHN  KLIN SL+ERREILH VT    GEF YA 
Sbjct: 444 LSTRKRKDVDIKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAK 503

Query: 559 ELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDS 618
           EL+T+NLDELQ FLDQSV DSCEGLMVK+L+GE+SHYEPSKRSRNWLKLKKDYL+G+GDS
Sbjct: 504 ELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDS 563

Query: 619 LDLCVLXXXXXXXXXXXXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATV 678
           LDLCVL               FLLGCYN +TGEFET CKIGTGFSDE+LQ L+++LK+T 
Sbjct: 564 LDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDRLKSTT 623

Query: 679 IDGPKATYIYDSSAEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRI 738
           IDGPKATYIYDSSA+PDVWFEP+LLFEVLTADLS+SPIYKAG+S Y KG+SLRFPRFIR+
Sbjct: 624 IDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFPRFIRL 683

Query: 739 REDKGVEDATSSEQIIELYENQSH 762
           REDK VE+ATSSEQIIELYENQSH
Sbjct: 684 REDKSVEEATSSEQIIELYENQSH 707

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  938 bits (2424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/733 (64%), Positives = 546/733 (74%), Gaps = 45/733 (6%)

Query: 47  GRKQQATLGRFFSSINHKKPTKDTALXXXXXXXXXXXXXXXXXXIPRKKIRLXXXXXXXX 106
           G K+QATL RFFSS+                              P++KI          
Sbjct: 25  GAKKQATLARFFSSM------------------------------PKRKIDDDSSTDSTT 54

Query: 107 IMAE--SKPKSPIKLNTERXXXXXXXXXXXXXXXIVADHTLDPKTAVSK--------PFL 156
           I  +  S     IKLN++                 +      P    +K         F 
Sbjct: 55  INKDDDSDTSKKIKLNSDETPTTSAGSVTSKDEPSLTSSPQKPIVTPAKVPSNTKPVKFF 114

Query: 157 CAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEP 216
             +PY ++C++FQE+E+TSSRLSIIK+CSDFLIK+MKQDPQNL+P+TYLFINKLGPDYEP
Sbjct: 115 STVPYADLCEVFQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEP 174

Query: 217 XXXXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGE 276
                      MKTISESCGKS+ Q++ QYRE+GDLGQIA +ARNVQPTMFKPKPLTVGE
Sbjct: 175 GLELGLGEGLLMKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGE 234

Query: 277 VFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLIS 336
           VF NLK IA++ GKDSQ +K++LIKRMLTAC+ GVEAKFLIRSLESKLRIGLAEKTVLIS
Sbjct: 235 VFQNLKDIAQSQGKDSQQRKMRLIKRMLTACK-GVEAKFLIRSLESKLRIGLAEKTVLIS 293

Query: 337 LSKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLR 396
           LSKALL+ E++ +KD  MEL+ETAE KIRDAFCQVPNYEI+I SCL  GIM L+ +C LR
Sbjct: 294 LSKALLLNEYETSKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLR 353

Query: 397 PGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMT 456
           PGIPLKPMLAKPTKAINE+LD FQGE FT EYKYDGER QVHLL +G MRIYSRNGENMT
Sbjct: 354 PGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMT 413

Query: 457 ERYPEIHIGDF-VKDRNETK---TLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDV 512
           ERYPE+HI DF VKD + T    +LILDCE VAWD EQ KILPFQVLSTRKRK V  KDV
Sbjct: 414 ERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDV 473

Query: 513 KVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFL 572
           KVRVCLFAFDIL +N   LI  +L+ERR+ILH VT   PGEFQYAT L T+ LDE+QKFL
Sbjct: 474 KVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFL 533

Query: 573 DQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXXXXX 632
           DQ++ DSCEGLMVK+L+GEES YEPSKRSRNWLKLKKDYL G+GDSLDLCV+        
Sbjct: 534 DQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGK 593

Query: 633 XXXXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSA 692
                  FLLGCYN ++GE+ETCCKIGTGFSDEML +L+E  +   I+ PK+ Y +DSSA
Sbjct: 594 RTGTYGGFLLGCYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSA 653

Query: 693 EPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQ 752
           EPD+WFEP +LFEVLTADLSLSPIYKAGS+ YDKG+SLRFPRF+RIR+DK VEDATSS+Q
Sbjct: 654 EPDIWFEPKVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQ 713

Query: 753 IIELYENQSHRSS 765
           IIE+YENQSH  S
Sbjct: 714 IIEMYENQSHIQS 726

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/602 (73%), Positives = 511/602 (84%), Gaps = 2/602 (0%)

Query: 159 IPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPXX 218
           IPY +VC +F EIE+TSSRLSI+K+CS+F   ++KQ+P NL+P+TYLFIN+LGPDYEP  
Sbjct: 89  IPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDYEPGL 148

Query: 219 XXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVF 278
                    MKTI+ESCGKSL Q+RA+YRE+GDLG++A EAR VQPTMFKPKPLTVGEVF
Sbjct: 149 ELGLGEGLLMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTVGEVF 208

Query: 279 NNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLS 338
           NNLK IAK+ GKDSQT+KI+LIKRMLTAC+ GVEAKFLIRSLESKLRIGLAEKTVLISLS
Sbjct: 209 NNLKSIAKSQGKDSQTRKIQLIKRMLTACQ-GVEAKFLIRSLESKLRIGLAEKTVLISLS 267

Query: 339 KALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPG 398
           KALL  E D  +    EL+E AE ++RDAFCQVPNYEIVIN+CL++GIM +N+HC L+PG
Sbjct: 268 KALLSYEHDGEEP-SSELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPG 326

Query: 399 IPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTER 458
           IPLKPMLAKP+K+I E+LDRF GE FT EYKYDGERAQVHLL DG+M IYSRNGENMTER
Sbjct: 327 IPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENMTER 386

Query: 459 YPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCL 518
           YPE+HI D++ D   T +LILDCEAVAWD EQ KILPFQ+LSTRKRK V AKDVKVRVCL
Sbjct: 387 YPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCL 446

Query: 519 FAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVND 578
           FAFD+LC+N   LIN SL ERRE L RV  P  G+FQ+A EL +SNL+++QK+L+QSV D
Sbjct: 447 FAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKD 506

Query: 579 SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXXXXXXXXXXX 638
           +CEGLMVK+LEGEESHYEPSKRSRNWLKLKKDYL+G+GDSLDLCVL              
Sbjct: 507 ACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYG 566

Query: 639 XFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWF 698
            FLLGCYN +TGEFETCCKIGTGFSDEML  L+EKLK + ++ PKA Y+YDSSAEPDVWF
Sbjct: 567 GFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWF 626

Query: 699 EPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYE 758
           EP++LFEVLTADLSLSPIYKAG+SAY KG+SLRFPRFIRIR+DK VEDATSSEQI+ELYE
Sbjct: 627 EPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYE 686

Query: 759 NQ 760
           +Q
Sbjct: 687 SQ 688

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/606 (72%), Positives = 510/606 (84%), Gaps = 2/606 (0%)

Query: 159 IPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPXX 218
           +PY +VC +FQEIE+TSSRLSIIK+CSDF  +I+K+D +NL+P TYLFINKLGPDYEP  
Sbjct: 128 VPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPGM 187

Query: 219 XXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVF 278
                    MKTISESCGKSL Q++ +YRE+GDLGQIA+EARNVQPTMFKPKPLTVGEVF
Sbjct: 188 ELGLGEGLLMKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVF 247

Query: 279 NNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLS 338
            NL+ IA A GKDSQ KKIKLIKRMLTAC+ GVEAKFLIRSLESKLRIGLAEKTVLISLS
Sbjct: 248 VNLRNIANAQGKDSQNKKIKLIKRMLTACQ-GVEAKFLIRSLESKLRIGLAEKTVLISLS 306

Query: 339 KALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPG 398
            ALL  E   + +   E ++ AE  IRDAFCQVPNYEIVIN+CL++GI  L++HC L PG
Sbjct: 307 NALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPG 366

Query: 399 IPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTER 458
           IPLKPMLAKPTKAI E+LDRFQG+ F SEYKYDGERAQ+HLL DGTMRIYSRNGENMTER
Sbjct: 367 IPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTER 426

Query: 459 YPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCL 518
           YPEI I DF+ D + T++LILDCEAVAWDKEQ KILPFQVLSTRKRKDV AKDVKVRVCL
Sbjct: 427 YPEIDIRDFLSDPS-TESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVRVCL 485

Query: 519 FAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVND 578
           FAFD+LCHN   LIN SL+ER++ L +VT P  GEF+YA +L T+N++ELQ FLDQSV D
Sbjct: 486 FAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKD 545

Query: 579 SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXXXXXXXXXXX 638
           SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYL G+GDSLDLCVL              
Sbjct: 546 SCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYG 605

Query: 639 XFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWF 698
            FLLGCYN +TGE+ETCCKIGTGFS+E+LQQL+++LK T ++ P A Y+YDS+ +PDVWF
Sbjct: 606 GFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWF 665

Query: 699 EPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYE 758
           EP+LLFEVL ADLSLSP+YKAGS+ YDKG+SLRFPRF+RIR+DK VE+ATSSEQ+++LYE
Sbjct: 666 EPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYE 725

Query: 759 NQSHRS 764
            Q+H S
Sbjct: 726 AQAHLS 731

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/615 (70%), Positives = 502/615 (81%), Gaps = 2/615 (0%)

Query: 148 KTAVSKPFLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFI 207
           K  +S P    + Y E+C +F EIE TSSRL I+KLCSDFL  ++ +  ++L+P+TYL I
Sbjct: 101 KIGISAPKDSNVMYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLI 160

Query: 208 NKLGPDYEPXXXXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMF 267
           NKLGPDY+P           MKTISESCGKSL Q++A+YRELGDLG+IA EAR+VQPTMF
Sbjct: 161 NKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMF 220

Query: 268 KPKPLTVGEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIG 327
           KPKPLT G VF NL+ IA+A GKDSQ +K++LIK+MLTACE GVEAKFLIRSLESKLRIG
Sbjct: 221 KPKPLTTGMVFANLQDIARAQGKDSQLRKVQLIKKMLTACE-GVEAKFLIRSLESKLRIG 279

Query: 328 LAEKTVLISLSKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIM 387
           LAEK+VL++LSKA+L  E    K+   +L++ AE KIRDAFCQVPNYEIVIN+ L++GIM
Sbjct: 280 LAEKSVLVALSKAILTHEH-GGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIM 338

Query: 388 NLNEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRI 447
            L +HC L PGIPLKPMLAKP+K+I+E+LDRFQG+ FT EYKYDGERAQVHLL DG+MRI
Sbjct: 339 ELEKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRI 398

Query: 448 YSRNGENMTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDV 507
           YSRNGENMTERYPEI+I DFV   +ET TLILDCEAVAWDK++  ILPFQVLSTRKRK V
Sbjct: 399 YSRNGENMTERYPEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGV 458

Query: 508 LAKDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDE 567
           +A+DVKVRVCLFAFDILC+N   LIN SL ERR  L R+  P PGE Q A+E+TT +LDE
Sbjct: 459 VAEDVKVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDE 518

Query: 568 LQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXX 627
           +Q +LDQSV D CEGLMVK+L+GEESHYEPSKRSRNWLKLKKDYL+G+GDSLDLCVL   
Sbjct: 519 MQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAY 578

Query: 628 XXXXXXXXXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYI 687
                       FLLGCYN +TGEFETCCKIGTGFSDEMLQ L+EKL  T I  PKA Y+
Sbjct: 579 YGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYV 638

Query: 688 YDSSAEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDA 747
           Y  SA+PDVW EPS+LFEVLTADLSLSP+YKAG S+Y KG+SLRFPRFIRIR+DK VEDA
Sbjct: 639 YSESAQPDVWLEPSMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDA 698

Query: 748 TSSEQIIELYENQSH 762
           TSSEQ+IE YE+QSH
Sbjct: 699 TSSEQVIEFYESQSH 713

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  882 bits (2278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/626 (68%), Positives = 500/626 (79%), Gaps = 3/626 (0%)

Query: 140 VADHTLDP-KTAVSKPFLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQN 198
           VA    DP K   S P    I Y E+C +F EIE TSSRL I+KLC DFL  ++ +  ++
Sbjct: 100 VAATKGDPAKLGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKD 159

Query: 199 LIPVTYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALE 258
           ++P+TYL INKLGPDY+P           MKTISESCGKSL QI+A+YRELGDLG+IA E
Sbjct: 160 IVPITYLLINKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQE 219

Query: 259 ARNVQPTMFKPKPLTVGEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIR 318
           AR VQPTMFKPKPLT GEVF+NL+ IA++ GKDSQ +K++LIKRMLTAC+ G+EAKFLIR
Sbjct: 220 ARAVQPTMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQ-GLEAKFLIR 278

Query: 319 SLESKLRIGLAEKTVLISLSKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVI 378
           SLESKLRIGLAEK+VL++LSKALL  E +  K+   EL++TAE KIRDAFCQVPNY+IVI
Sbjct: 279 SLESKLRIGLAEKSVLVALSKALLTYEHNG-KEPSSELVDTAEQKIRDAFCQVPNYQIVI 337

Query: 379 NSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVH 438
            + L++GIM L++HC L PGIPLKPMLAKP+K+I+E+LDRFQG+ FT EYKYDGERAQVH
Sbjct: 338 ETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVH 397

Query: 439 LLEDGTMRIYSRNGENMTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQV 498
           LL DG+MRIYSRNGENMTERYPEI I DF+ D   T TLILDCEAVAWDKE+  ILPFQV
Sbjct: 398 LLPDGSMRIYSRNGENMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQV 457

Query: 499 LSTRKRKDVLAKDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYAT 558
           LSTRKRK V  +DVKVRVCLFAFDILC+N   LI   L ERR  L R   P PGE Q A+
Sbjct: 458 LSTRKRKGVAVEDVKVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLAS 517

Query: 559 ELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDS 618
           E+TT +LDELQ +LDQ+V D CEGLMVK+LEGEESHYEPSKRSRNWLKLKKDYL+G+GDS
Sbjct: 518 EVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDS 577

Query: 619 LDLCVLXXXXXXXXXXXXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATV 678
           LDLCVL               FLLGCYN ++GE+ETCCKIGTGFS+EMLQ L ++L  T 
Sbjct: 578 LDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTA 637

Query: 679 IDGPKATYIYDSSAEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRI 738
           I  PKA Y++  SA PDVWFEP+LLFEVLTADLSLSP+YKAG+S+Y KG+SLRFPRFIR+
Sbjct: 638 IPTPKAFYVHSESAPPDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRL 697

Query: 739 REDKGVEDATSSEQIIELYENQSHRS 764
           R+DK  E+ATSSEQ++E YE+QSH S
Sbjct: 698 RDDKTPEEATSSEQVVEFYESQSHVS 723

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/608 (68%), Positives = 488/608 (80%), Gaps = 2/608 (0%)

Query: 155 FLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDY 214
           F   IP+ E+C  FQ IE TSSRL+I  +CS FL  ++++DP++L+P+TYLFI+KLGPDY
Sbjct: 93  FHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKLGPDY 152

Query: 215 EPXXXXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTV 274
           EP           +KTISE+CGKS+ QIR +YRE+GDLG+IA++ARNVQPTMFKPKPLTV
Sbjct: 153 EPGLELGLGESLLIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTV 212

Query: 275 GEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVL 334
           GEVFNNL  IAK+ GKDSQ++K  LIK+MLTAC+ G EAKFLIRSLESKLRIGLAEKTVL
Sbjct: 213 GEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACK-GYEAKFLIRSLESKLRIGLAEKTVL 271

Query: 335 ISLSKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCS 394
           IS+SKA+L  E +  +    E++E AE  IRDAFCQVPNYE++IN  LQYGIMNLN+H  
Sbjct: 272 ISVSKAILTHEHNGQEP-STEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQHIK 330

Query: 395 LRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGEN 454
           LRPGIPL+PMLAKPTK+I+E+LDRFQG  FT EYKYDGERAQVHL  DG+M+IYSRNGE+
Sbjct: 331 LRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGED 390

Query: 455 MTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKV 514
           MTERYPEI +  +VKD   TK+ I+D EAVAWD+EQ KILPFQVLSTRKRK V  KDVKV
Sbjct: 391 MTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKV 450

Query: 515 RVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQ 574
           RVCL+AFDILC N   LIN S  ERR+IL        G+F +A ELTT+N DELQK+LDQ
Sbjct: 451 RVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQ 510

Query: 575 SVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXXXXXXX 634
           SV DSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEG+GDSLDL VL          
Sbjct: 511 SVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRGKRT 570

Query: 635 XXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEP 694
                FLLGCYN ++ EFETCCKIGTGFSDEMLQ L+ KLK T ++ P    IYDSSA  
Sbjct: 571 GTYGGFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPA 630

Query: 695 DVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQII 754
           DVWFEPS+LFEVLTADLSLSP+YKAG  A+ KG+SLRFPRF+RIR+DK V DATSS+Q+I
Sbjct: 631 DVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVI 690

Query: 755 ELYENQSH 762
           E YE+Q+H
Sbjct: 691 EFYESQAH 698

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/624 (67%), Positives = 492/624 (78%), Gaps = 23/624 (3%)

Query: 161 YKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPXXXX 220
           Y EVC LFQ+IE TSSRL+IIKLCS+F I+++K +P ++I V YLFIN+LGPDYEP    
Sbjct: 111 YSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRLGPDYEPGLEL 170

Query: 221 XXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVFNN 280
                  +KTISE+ GKS+ QI+ + +E GDLG IA +ARN+QPTMFKPKPLT+ +VFNN
Sbjct: 171 GLGENLLIKTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNN 230

Query: 281 LKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLSKA 340
           LK IA A GKDSQ +KIKLIK+ML+A + G+EAKFLIRSLESKLRIGLAEKTVLISLSKA
Sbjct: 231 LKKIASATGKDSQLRKIKLIKQMLSASK-GLEAKFLIRSLESKLRIGLAEKTVLISLSKA 289

Query: 341 LLVKE---------FDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNE 391
           LL+ E         FD      M+L+E AE K+R+A CQVPNYEIVIN CLQ GI+N+++
Sbjct: 290 LLLHEHWKEKGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDK 349

Query: 392 HCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRN 451
            C+LRPGIPLKPMLAKPTKAI E+L+ FQG+ F SEYKYDGERAQVHLLE G MRIYSRN
Sbjct: 350 TCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRN 409

Query: 452 GENMTERYPEIHIGDF------VKDRNE-------TKTLILDCEAVAWDKEQQKILPFQV 498
           GENMTERYPE+ + DF      + +  E        K +ILDCE VAWD EQ+KILPFQV
Sbjct: 410 GENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQV 469

Query: 499 LSTRKRKDVLAKDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYAT 558
           L+TRKRK+V  KDVKVRVCLFAFD+L  N+  +IN SL+ER+EIL +VT   PGEFQYAT
Sbjct: 470 LTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYAT 529

Query: 559 ELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDS 618
            L TS++DELQ FLDQ+V +SCEGLMVKML+GEESHYEPSKRSRNWLKLKKDYL+G+GDS
Sbjct: 530 SLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDS 589

Query: 619 LDLCVLXXXXXXXXXXXXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATV 678
           LDL V+               FLLGCYN++T EFETCCKIGTGFSDEML  LH  L+ T 
Sbjct: 590 LDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTE 649

Query: 679 IDGPKATYIYDSSAEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRI 738
           ID P  TYIYDSSAEPDVWF+  +LFEVLTADLSLSP+YKAG+S YDKG+SLRFPRF+RI
Sbjct: 650 IDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRI 709

Query: 739 REDKGVEDATSSEQIIELYENQSH 762
           REDK V D T+SE IIE YE+QSH
Sbjct: 710 REDKDVTDGTTSEDIIEFYESQSH 733

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/608 (65%), Positives = 479/608 (78%), Gaps = 2/608 (0%)

Query: 158 AIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPX 217
           ++ Y ++C +F+ +E TSSRLSI KLC+DF+  ++K DP +LIPVTYLFIN+LGPDYEP 
Sbjct: 92  SVMYADLCAVFEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPG 151

Query: 218 XXXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEV 277
                     +KTIS++CGKS  Q+R+ YRE GDLG +A +AR VQPTMFKPKPLTV +V
Sbjct: 152 LELGLGEGILIKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDV 211

Query: 278 FNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISL 337
           F+ L+ IA+A GKDSQ KKI+LIK+MLTAC+ G+EAK+LIRSLESKLRIGLAEKTVL++L
Sbjct: 212 FSTLQAIAQAEGKDSQGKKIRLIKKMLTACQ-GMEAKYLIRSLESKLRIGLAEKTVLVAL 270

Query: 338 SKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRP 397
           SKA+L  E D  K+   E ++ AE  +RD FCQVPNYE++IN+ LQYGIMNL +HC L P
Sbjct: 271 SKAILTHEHD-GKEPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTP 329

Query: 398 GIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTE 457
           GIPLKPMLAKPTK+I E+LDRFQG+ FT EYKYDGERAQVHL+EDGT+RIYSRN ENMTE
Sbjct: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTE 389

Query: 458 RYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVC 517
           RYPEI    F+ +   T++LI+DCEAVAWD E+QKILPFQVLSTRKRK V  KDVKVRVC
Sbjct: 390 RYPEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVC 449

Query: 518 LFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVN 577
           LFAFD+L  N   L+  SL +RR+ L+ V    PGE Q+A E+TT  L ELQ +L+QSV+
Sbjct: 450 LFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVS 509

Query: 578 DSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXXXXXXXXXX 637
            SCEGLMVKML+GEES YEPSKRSRNWLKLKKDYLEG+GDSLDL VL             
Sbjct: 510 ASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTY 569

Query: 638 XXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVW 697
             FLLGCYN +  EFETCCKIGTGFS+E+LQ LH +LK TVI  P+    YD S+ PDVW
Sbjct: 570 GGFLLGCYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDSSPPDVW 629

Query: 698 FEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELY 757
           FEP++LFEVLTADLSLSP+YKAG   Y KG+SLRFPRF+RIREDK V DATSS+QI+E Y
Sbjct: 630 FEPAMLFEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFY 689

Query: 758 ENQSHRSS 765
           + Q++ S 
Sbjct: 690 QRQANSSG 697

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/629 (63%), Positives = 485/629 (77%), Gaps = 6/629 (0%)

Query: 140 VADHTLDPK-TAVSKPFLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQN 198
           V   T  P+ T  SKP   ++PY ++CQLF+ IE+ SSRL+I  LC+ F  + ++ DP  
Sbjct: 95  VTTSTQTPRPTKKSKPATSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQLDPSL 154

Query: 199 LIPVTYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSLTQIRAQYRELGDLGQIALE 258
           L+PVTYL INKLGPDY             +K I  +CG S  Q++ QYR+LGDLGQ+A+ 
Sbjct: 155 LVPVTYLCINKLGPDYS-GVELGLGEGLLLKAIGSACGVSQQQLKLQYRKLGDLGQLAMS 213

Query: 259 ARNVQPT--MFKPKPLTVGEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFL 316
            R +QPT  MFK +PLT+ +VF+ L  IA + GKDSQ +KI +IKR+LT+C+ GVEAKFL
Sbjct: 214 TRVLQPTITMFKLEPLTITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQ-GVEAKFL 272

Query: 317 IRSLESKLRIGLAEKTVLISLSKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEI 376
           IRSLESKLRIGLAEKTVL SL++AL++ E   N +   +    AE  I+D+FCQ+PNYEI
Sbjct: 273 IRSLESKLRIGLAEKTVLTSLARALVIHE-KGNDNIQDDDYSNAEQIIKDSFCQIPNYEI 331

Query: 377 VINSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQ 436
           +I + LQYG+  L  H  L PGIPLKPMLAKPTK+I+E+LD FQ   FTSEYKYDGERAQ
Sbjct: 332 IITTSLQYGVSQLASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQ 391

Query: 437 VHLLEDGTMRIYSRNGENMTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPF 496
           VHLL DG+MRIYSRNGE+MT+RYPE++I D++ D   T  LILDCEAVAWD E QKILPF
Sbjct: 392 VHLLPDGSMRIYSRNGEDMTQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPF 451

Query: 497 QVLSTRKRKDVLAKDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQY 556
           QVLSTRKRK V  KD+KVRVCLFAFDIL HN++ LIN +L+ERR+ILH +T P PG+FQ+
Sbjct: 452 QVLSTRKRKSVDLKDIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQF 511

Query: 557 ATELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIG 616
           ATELTTSNLDELQ FLD+++ DSCEGLMVK L+G +SHYEPSKRSRNWLKLKKDYL+G+G
Sbjct: 512 ATELTTSNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMG 571

Query: 617 DSLDLCVLXXXXXXXXXXXXXXXFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKA 676
           DSLDLCVL               FLL CYN +T EFETCCKIGTGFSDEMLQ L+  LK 
Sbjct: 572 DSLDLCVLGAYYGRGKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLYNGLKE 631

Query: 677 TVIDGPKATYIYDSSAEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFI 736
           T I+ P+A +++DSSAEPDVWF P+++FEVLTADLSLSPIYKAGS+ Y KG+SLRFPRFI
Sbjct: 632 TAIESPRANFVFDSSAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLRFPRFI 691

Query: 737 RIREDKGVEDATSSEQIIELYENQSHRSS 765
           RIR DK V DATSSEQ+I+ YENQSH  S
Sbjct: 692 RIRTDKSVNDATSSEQVIDFYENQSHLQS 720

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 125/244 (51%), Gaps = 13/244 (5%)

Query: 390 NEHCSLRPGIPLKPMLAKPTK-AINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRI 447
           N   S++ G    P LAK    + + I +R   + F  E K DGER Q+H +  G T++ 
Sbjct: 264 NSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKF 322

Query: 448 YSRNGENMTERYPEIH----IGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRK 503
           +SR+G + T  Y        I  F++     K  +LD E V +D   +K+LPF ++ +  
Sbjct: 323 FSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSA 382

Query: 504 RKDVLAKDV---KVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATEL 560
              +  KD+           FDIL  N + LI+  L +R+E L+ V TP     +  + +
Sbjct: 383 SSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSI 442

Query: 561 TTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLD 620
             ++  +++K LD +++   EG+++K      S Y P+ R  NW+K+K +YLE  G+++D
Sbjct: 443 RCTDSIQIKKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMD 499

Query: 621 LCVL 624
           L V+
Sbjct: 500 LIVI 503

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  109 bits (273), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 122/244 (50%), Gaps = 13/244 (5%)

Query: 390 NEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIY 448
           N    + PG    P LAK      E +       F  E K DGER Q+H  + G  ++ +
Sbjct: 251 NNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFF 310

Query: 449 SRNGENMTERYPE-IH---IGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKR 504
           SR G + T  Y E IH   IG  +K   + K  ILD E + +DK Q  ILPF ++ +  R
Sbjct: 311 SRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSAR 370

Query: 505 KDVLAKDVKV----RVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATEL 560
             +L KD  +    +     FD++  N   L N  L  R+E L+ + TP P   +  +  
Sbjct: 371 S-MLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSY 429

Query: 561 TTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLD 620
              N D ++K L+ +++   EG+++K     +S Y  + R+ +W+K+K +YLE  G+++D
Sbjct: 430 HRFNEDSIRKSLELAISMGSEGIVLKRY---DSRYTVASRNDDWIKVKPEYLEQFGENMD 486

Query: 621 LCVL 624
           L V+
Sbjct: 487 LIVI 490

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 108/421 (25%), Positives = 177/421 (42%), Gaps = 69/421 (16%)

Query: 401 LKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY 459
            +P LAK      E+L R     FT E K DGER Q+H ++ G  ++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 460 PE----IHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVR 515
            +      I  +++   + K  ILD E V++DK +  ILPF ++ +     +    ++  
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 516 VC---LFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFL 572
           +C      FD+L  N + L N  L +R+E L  + TP     +        + + ++  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 573 DQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXXXXX 632
             +++   EG+++K     +S Y    R+ +W+K+K +YLE  G++LDL V+        
Sbjct: 444 QAAISVGSEGIVLKKY---DSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGRDPGKKD 500

Query: 633 XXXXXXXFL----------------LGCYNDNT---------------GEFETCCKIGTG 661
                   L                L   +D++                +F + C I  G
Sbjct: 501 SLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISFCVIANG 560

Query: 662 FSDEMLQQLHEK----LKATVIDGPKATYIYDSSAEPDVWFEP--SLLFEV----LTADL 711
            S+E  +++  K     K    + P   Y+   +  P  W  P  S++ EV    L  + 
Sbjct: 561 ISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEVKARSLENNE 620

Query: 712 SLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDA-TSSEQII---------ELYENQS 761
           +L   +K G + Y  G   R     RIR DK   D  T S+ +I         ELY N S
Sbjct: 621 ALRDKFKTGYTLY--GAYCR-----RIRTDKDFNDCYTFSDLVIATNKKRSSSELYGNHS 673

Query: 762 H 762
           H
Sbjct: 674 H 674

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 100/414 (24%), Positives = 177/414 (42%), Gaps = 51/414 (12%)

Query: 394 SLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGT-MRIYSRNG 452
           S+  G    P LAK      E +       F  E K DGER QVH ++ G  +R  SR G
Sbjct: 264 SINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRG 323

Query: 453 ENMTERYPEI----HIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVL 508
            + T+ Y E      + +++   +  +  +LD E + +D ++  +LPF ++ +  R+ + 
Sbjct: 324 VDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALS 383

Query: 509 AKDV---KVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNL 565
            + +     R  L   D++  N   LI   L +R+E L+RV  P P   +    +  S  
Sbjct: 384 TEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEH 443

Query: 566 DELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLX 625
             ++K L++S++   EG+++K     ++ YE   R+  W+K+K +YLE  G++LDL ++ 
Sbjct: 444 TAIRKSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIG 500

Query: 626 XXXXXXXXXXXXXXFLLGCYN---------------DNTGE-------------FETCCK 657
                            G  +               D+ G+             F + C 
Sbjct: 501 RTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCV 560

Query: 658 IGTGFSDEMLQQLHEKLKATVIDG----PKATYIYDSSAEPDVWFEP--SLLFEVLTADL 711
           I  G S +  +++  K +   +      P A  +   S  P+ W +P  S++ EV    L
Sbjct: 561 IANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSL 620

Query: 712 SLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHRSS 765
             +   ++    +  G +L      RIR+DK   D T      EL++ + H+SS
Sbjct: 621 DNT---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLHKSS 668

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 109/416 (26%), Positives = 171/416 (41%), Gaps = 55/416 (13%)

Query: 390 NEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIY 448
           N+  +++ G    P LAK      E + R     F  E K DGER QVH +  G ++R Y
Sbjct: 243 NDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFY 302

Query: 449 SRNGENMTERYPEI-------HIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLST 501
           SR G + T  Y          H  DF  +  E    +LD E V +D  ++ ILPF ++  
Sbjct: 303 SRRGIDYTYLYGASLSSGTISHHLDFTDNVREC---VLDGEMVTFDARRKVILPFGLVKG 359

Query: 502 RKRKDVLA----KDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYA 557
              KD L+     +V        FD+L  N   L    L +R+E L  + TP     +  
Sbjct: 360 SA-KDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMV 418

Query: 558 TELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGD 617
                 N++ ++K L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G+
Sbjct: 419 RTSRCYNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGE 475

Query: 618 SLDLCVLXXXXXXXXXXXXXXXFL-------------LGCYNDNTGE-----------FE 653
           +LDL ++                L              G  N++  E             
Sbjct: 476 NLDLVIIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKIL 535

Query: 654 TCCKIGTGFSDEMLQQLHEK----LKATVIDGPKATYIYDSSAEPDVWFEP--SLLFEVL 707
           + C +  G S E  +++  K     K T    P A+     S  P  W EP  S++ E+ 
Sbjct: 536 SFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIK 595

Query: 708 TADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHR 763
           +  L  +   +     Y    +L      RIR DK   D T    + ELY+++S R
Sbjct: 596 SRSLDNT---ETNMQKYATSCTLYGGYCKRIRFDK---DWTDCFTLNELYDSRSAR 645

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  106 bits (264), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 97/390 (24%), Positives = 169/390 (43%), Gaps = 50/390 (12%)

Query: 390 NEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGT-MRIY 448
           N+   +  G+   P LA       + +    G  F  E K DGER Q+H    G+ ++ Y
Sbjct: 258 NQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFY 317

Query: 449 SRNGENMTERYPEI----HIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKR 504
           SR   + T  Y        + +F+      K  +LDCE V +D   + +LPF ++ +   
Sbjct: 318 SRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSA- 376

Query: 505 KDVLAKD----VKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATEL 560
           K++L++D          L  FD+L  N   L++    +RRE L ++ TP     +    +
Sbjct: 377 KNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSI 436

Query: 561 TTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLD 620
             ++   ++K L+++++   EG+++K     +S Y  + RS +W+K+K +YLE  G+++D
Sbjct: 437 RANDEQMIKKSLEKALSVGSEGIILKRY---DSRYVIASRSDDWIKIKPEYLEQFGENMD 493

Query: 621 LCVLXXXXXXXXXXXXXXXFLLGC-------------YNDNTGE--------FETCCKIG 659
           L ++                +LG               N  + E        F + C I 
Sbjct: 494 LVLM------GRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIA 547

Query: 660 TGFSDEMLQQLHEKLKATVIDG---PKATYIYDSSAEPDVWFEP--SLLFEVLTADLSLS 714
            G S+E  +++  K K    D    P   Y+   S  P  W +P  SL+ E+    L  +
Sbjct: 548 NGISNEEYKEIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT 607

Query: 715 PIYKAGSSAYDKGVSLRFPRFIR-IREDKG 743
              ++    +  G +L F  + R IREDK 
Sbjct: 608 ---RSSERKFAAGCTL-FGGYCRQIREDKN 633

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 134/279 (48%), Gaps = 13/279 (4%)

Query: 355 ELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAINE 414
           +LL        D F  V +   V     +  +   NE  +L+ G    P LAK      E
Sbjct: 209 KLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYE 268

Query: 415 ILDRFQGETFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERY----PEIHIGDFVK 469
            + +  G  F+ E K DGER Q+H ++ G  ++  SR G + T  Y        I  ++K
Sbjct: 269 KILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLK 328

Query: 470 DRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDV----KVRVCLFAFDILC 525
                K  ILD E V +D+E+Q ILPF ++ +   K+ L+K+            AFD++ 
Sbjct: 329 LNENVKECILDGEMVTYDQEKQMILPFGLVKSSA-KNFLSKESISNGSYHPLFMAFDLVY 387

Query: 526 HNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMV 585
            N   L++  L +R++ L ++ T   G     +    +NL+ + K L  +++   EG+++
Sbjct: 388 LNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIIL 447

Query: 586 KMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVL 624
           K L    S Y  + R+ +W+K+K  YL+  G+++DL ++
Sbjct: 448 KKL---NSRYMVASRNDSWIKIKPQYLKQFGENMDLIII 483

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 103/411 (25%), Positives = 167/411 (40%), Gaps = 52/411 (12%)

Query: 394 SLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIYSRNG 452
           S+R G    P +A+  K   E +    G  F  E K DG+R QVH ++ G ++  +SRNG
Sbjct: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346

Query: 453 ENMTERYPEIH----IGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVL 508
            N T  Y E      I + +K     K  ILD E V++DKE Q ILPF +  +     V 
Sbjct: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406

Query: 509 AKDV-----KVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTS 563
            +         R     FD+L  N   L N  + +R+E L ++  P+       +    S
Sbjct: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466

Query: 564 NLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCV 623
           + + +   L  +V    EG+++K      S Y   KR  +W+K+K +YLE  G+++DL V
Sbjct: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523

Query: 624 LXXXXXXXXXXXXXXXFLLGCYNDNTG----------------------EFETCCKIGTG 661
           +                      +N                        +F + C I  G
Sbjct: 524 IGRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISFCSIANG 583

Query: 662 FSDEMLQQLHEKLKATVI----DGPKATYIYDSSAEPDVWFEP--SLLFEV----LTADL 711
            S+E  +++    +          P   ++   +  P  W +P  S++ EV    +  + 
Sbjct: 584 ISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEE 643

Query: 712 SLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSH 762
           S S +YK GS+ Y+           RIR DK    A++  +     E +S+
Sbjct: 644 SKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAEYDTAREARSY 687

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 102/407 (25%), Positives = 175/407 (42%), Gaps = 47/407 (11%)

Query: 390 NEHCSLRPGIPLKPMLAKPTK-AINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRI 447
           N+   +  G+P  P LAK    + +++  R + + +  E K DGER Q+H ++ G  ++ 
Sbjct: 245 NDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEE-KMDGERIQLHYMDYGRKLKW 303

Query: 448 YSRNGENMTERYPE-IHIGDFVKDRN---ETKTLILDCEAVAWDKEQQKILPFQVLSTRK 503
           +SR G + T  Y E I  G   K      + +  +LD E +++D E+  +LPF ++ +  
Sbjct: 304 FSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSA 363

Query: 504 RKDVLAKDV---KVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATEL 560
           R  + A+ +     R      D L  N   LIN  L  R++ L  +  P P   +    +
Sbjct: 364 RDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSM 423

Query: 561 TTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLD 620
              +   ++  L++++    EG+++K  +   S YE   R+ NW+K+K +YLE  G++LD
Sbjct: 424 HCYDDTSIKSSLEKAIMMGSEGIILKHFK---SKYEIGARTDNWIKIKPEYLEQFGENLD 480

Query: 621 LCVLXXXXXXXXXXXXXXXFLLG-----------CYNDNTGE----------FETCCKIG 659
           L V+                L G             N ++ E          F + C I 
Sbjct: 481 LLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIA 540

Query: 660 TGFSDEMLQQLHE----KLKATVIDGPKATYIYDSSAEPDVWFEP--SLLFEVLTADLSL 713
            G S E  +Q+      K K T    P     + S   P+ W  P  S++ EV    L  
Sbjct: 541 NGISQEEFKQIERKTAGKWKNTEDHKPPKILEFGSKL-PEEWIYPEDSVVLEVKARSLDN 599

Query: 714 SPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQ 760
           +   ++    +  G +L      RIREDK   + T    + EL++ +
Sbjct: 600 T---ESSGRKFKVGCTLHGGYCRRIREDK---NWTECYTLYELWQER 640

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 95/392 (24%), Positives = 169/392 (43%), Gaps = 43/392 (10%)

Query: 394 SLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGT-MRIYSRNG 452
           S+  G    P LAK      E +       F  E K DGER Q+H +  G+ ++  SR G
Sbjct: 258 SINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRG 317

Query: 453 ENMTERY-PEIH---IGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVL 508
            + +  Y  E+    I  ++K +++ +  +LD E V++DK+++ ILPF ++ +    +++
Sbjct: 318 IDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELI 377

Query: 509 AKDVK-----VRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTS 563
             +V       R     FD++  N   L    L  R+E L  + +P P   +    +   
Sbjct: 378 NSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRAC 437

Query: 564 NLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCV 623
           +   ++ F+ +++    EG++VK      S YE   R+ +W+K+K +Y E +G+++DL V
Sbjct: 438 DAKAIKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVV 494

Query: 624 L-----XXXXXXXXXXXXXXXFLLGCYNDNTGEFE------------TCCKIGTGFSDEM 666
           +                     +L    +N G  E            + C +  G SDE 
Sbjct: 495 IGRDPGKKDSLMCGLLVSDSEHIL----ENFGPIEHGKEGDPIIKCVSFCNVANGVSDEE 550

Query: 667 LQQLHEKLKATVID----GPKATYIYDSSAEPDVWFEP--SLLFEVLTADLSLSPIYKAG 720
            ++++ K + + +      P  + +   S  P  W +P  S++ EV    +  S   +  
Sbjct: 551 FKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYS 607

Query: 721 SSAYDKGVSLRFPRFIRIREDKGVEDATSSEQ 752
           S  Y  G +L      RIR DK     TS  Q
Sbjct: 608 SKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 110/458 (24%), Positives = 185/458 (40%), Gaps = 60/458 (13%)

Query: 353 DMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAI 412
           + +LL       +D    V +  +V +      I   N+  S++ G    P LAK     
Sbjct: 206 EHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAKKVNLS 265

Query: 413 NEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERYP----EIHIGDF 467
            E +       F  E K DGER QVH +  G +++ +SR G + T  Y        I  +
Sbjct: 266 YEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGVNLLSGTISQY 325

Query: 468 VKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVK---VRVCLFAFDIL 524
           +K  +  K  +LD E V +D  ++ ILPF ++    ++ +   D+           FD+L
Sbjct: 326 LKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNNDFHPLYMVFDLL 385

Query: 525 CHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLM 584
             N   L    L +R+E L  +  P+    +        + + ++K L+ +++   EG++
Sbjct: 386 YLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAESVKKSLEVAISLGSEGVV 445

Query: 585 VKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXXXXXXXXXXXXFLLG- 643
           +K      S Y  + R+ NW+K+K +YLE  G++LDL ++               F+LG 
Sbjct: 446 LKHYS---SSYNVASRNNNWIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGL 496

Query: 644 ------------------CYNDNTGEFE------------TCCKIGTGFSDEMLQQLHEK 673
                               ND++ E              + C I  G S E  +++  K
Sbjct: 497 LVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQEEFKEIDRK 556

Query: 674 ----LKATVIDGPKATYIYDSSAEPDVWFEP--SLLFEVLTADLSLSPIYKAGSSAYDKG 727
                K T    P  + +   S  P  W EP  S++ E+ +  L  +   +     Y   
Sbjct: 557 TRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNT---ETNMQKYATN 613

Query: 728 VSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHRSS 765
            +L      RIR DK   D T    + ELYEN+  +S+
Sbjct: 614 CTLYGGYCRRIRYDK---DWTECYTLDELYENRRTKSN 648

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 99.8 bits (247), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 99/397 (24%), Positives = 172/397 (43%), Gaps = 45/397 (11%)

Query: 377 VINSCLQYGIMNLNEH-CSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERA 435
           V++  L    M L ++  S+  G    P LAK      E +     + F  E K DGER 
Sbjct: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313

Query: 436 QVHLLEDGT-MRIYSRNGENMTERYPEI--H--IGDFVKDRNETKTLILDCEAVAWDKEQ 490
           Q+H +E G  +R  SR G + T  Y +   H  I   +K +N+ +  +LD E V++DKE+
Sbjct: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373

Query: 491 QKILPFQVLSTRKRKDVLAKDVKV-----RVCLFAFDILCHNSNKLINYSLKERREILHR 545
             +LPF ++ +   ++++  D KV     R     FD++  N   L    L  R+  L  
Sbjct: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433

Query: 546 VTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWL 605
           + +P     +  +++  S  + ++  L++++    EG+++K      S YE   R+ +W+
Sbjct: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQF---SSPYEIGARNDSWI 490

Query: 606 KLKKDYLEGIGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNDNTG--------------- 650
           K+K +Y E +G+++DL V+                +L    D +                
Sbjct: 491 KIKPEYFEELGETMDLVVI--GRDPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQR 548

Query: 651 --EFETCCKIGTGFSDEMLQQLHEKLKA----TVIDGPKATYIYDSSAEPDVWFEP--SL 702
             +  + C I  G SD   +++  K +     T    P +  +   +  P  W +P  SL
Sbjct: 549 NPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSL 608

Query: 703 LFEV----LTADLSLSPIYKAGSSAYDKGVSLRFPRF 735
           + EV    +  D   S  YK GS+   +G   R  RF
Sbjct: 609 VLEVKARSVDTDELSSKKYKTGSTL--RGAYCRALRF 643

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 97.1 bits (240), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 92/372 (24%), Positives = 157/372 (42%), Gaps = 35/372 (9%)

Query: 401 LKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY 459
            +P LAK T    E +       F  E K DGER Q+H +  G  ++  SR G + +  Y
Sbjct: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306

Query: 460 PEIH----IGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDV------LA 509
            E      I   +K     K  ILD E + +D E+  +LPF ++ +     +      +A
Sbjct: 307 GENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIA 366

Query: 510 KDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQ 569
                +    AFD++  N   L N +L+ R++ L ++ TP     +    +   N + ++
Sbjct: 367 PTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAIK 426

Query: 570 KFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLXXXXX 629
             L+Q+++   EG+++K L    S Y    R+ +W+K+K +YLE  G+++DL ++     
Sbjct: 427 DSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLII----- 478

Query: 630 XXXXXXXXXXFLLGCYNDNTGE------FETCCKIGTGFSDEMLQQLHEKL--KATVI-- 679
                     F  G    +  E      F + C I  G S+E  + +  K   K  +   
Sbjct: 479 -GREQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSE 537

Query: 680 DGPKATYIYDSSAEPDVWFEP--SLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIR 737
           D P    +   +  P  W  P  S++ EV    +      ++    Y  G +L F    +
Sbjct: 538 DPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQ 594

Query: 738 IREDKGVEDATS 749
           IR DK  +   S
Sbjct: 595 IRYDKDWKTVAS 606

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 101/422 (23%), Positives = 173/422 (40%), Gaps = 64/422 (15%)

Query: 390 NEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIY 448
           N+  S++ G    P LAK      E + R     F  E K DGER QVH +  G +++ +
Sbjct: 243 NDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFF 302

Query: 449 SRNGENMTERY----PEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKR 504
           SR G + T  Y        I  ++K  N  K  +LD E V +D  ++ ILPF ++    +
Sbjct: 303 SRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAK 362

Query: 505 KDVLAKDVK---VRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELT 561
             +   D+     R     FD+L  N   L    L +R++ L  + TP     +      
Sbjct: 363 GVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTR 422

Query: 562 TSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDL 621
             ++  ++  L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL
Sbjct: 423 CYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDL 479

Query: 622 CVLXXXXXXXXXXXXXXXFLLGCYNDNTGEFE---------------------------- 653
            ++               F+LG    +  E E                            
Sbjct: 480 III------GRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKV 533

Query: 654 ----TCCKIGTGFSDEMLQQLHEKLKA---TVIDGPKATYIYDSSAEPDVWFEP--SLLF 704
               + C +  G S E  ++++ + +       D    + +   S  P  W EP  S++ 
Sbjct: 534 KKVLSFCSVANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRIPAEWIEPSDSIVL 593

Query: 705 EVLTADL--SLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSH 762
           E+ +  L  + + I +  +S    G   R     RIR DK   D T    + +LYE++  
Sbjct: 594 EIKSRSLDNTETSIRRYATSCTLYGGYCR-----RIRYDK---DWTDCYTLAQLYEDRPI 645

Query: 763 RS 764
           +S
Sbjct: 646 KS 647

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 101/421 (23%), Positives = 178/421 (42%), Gaps = 61/421 (14%)

Query: 390 NEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIY 448
           ++  S++ G    P LAK      E + R   + F  E K DGER QVH +  G +++ +
Sbjct: 243 DDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFF 302

Query: 449 SRNGENMTERY----PEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKR 504
           SR G + T  Y        I   ++  +  K  +LD E V +D +++ ILPF ++     
Sbjct: 303 SRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSA- 361

Query: 505 KDVLA----KDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATEL 560
           K+ L+     +V        FD+L  N   L    L +R++ L+ + +P     +     
Sbjct: 362 KEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSS 421

Query: 561 TTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLD 620
               ++ ++K L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LD
Sbjct: 422 RCYGVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLD 478

Query: 621 LCVLXXXXXXXXXXXXXXXFLLGC-------YNDNTGEFE-------------------- 653
           L V+               F+LG        Y  + G+                      
Sbjct: 479 LIVI------GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVK 532

Query: 654 ---TCCKIGTGFSDEMLQQLHEK----LKATVIDGPKATYIYDSSAEPDVWFEP--SLLF 704
              + C I  G S E  +++  K     K T    P A+ +   S  P  W +P  S++ 
Sbjct: 533 KILSFCSIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVL 592

Query: 705 EVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHRS 764
           E+ +  L  +   +     Y    +L      RIR DK   D  +   + +LYE+++ +S
Sbjct: 593 EIKSRSLDNT---ETNMQKYATNCTLYGGYCKRIRYDKEWTDCYT---LNDLYESRTVKS 646

Query: 765 S 765
           +
Sbjct: 647 N 647

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 133/279 (47%), Gaps = 13/279 (4%)

Query: 355 ELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKP-TKAIN 413
           +LL        D    V + + V        I   ++  S+  G    P LAK  + + +
Sbjct: 208 KLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSINIGYAFAPHLAKKLSISYD 267

Query: 414 EILDRFQGETFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEI----HIGDFV 468
           +I  + + + F  E K DGER Q+H ++ G  ++  SR G + T  Y E      I  ++
Sbjct: 268 KICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRRGVDYTYLYGENLSTGTIACYL 326

Query: 469 KDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVK---VRVCLFAFDILC 525
           K   + K  +LD E V +D++Q  +LPF ++ +     +  +++        L  FD++ 
Sbjct: 327 KLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEEISGQDYHPLLMVFDLVF 386

Query: 526 HNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMV 585
            N + L+ + L +R++ L  V  P     Q       SN + ++K L+ +++   EG+++
Sbjct: 387 LNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENIIRKSLEHAISVGSEGIVL 446

Query: 586 KMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVL 624
           K      S Y    R+ +W+K+K +YLE  G+++DL V+
Sbjct: 447 K---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 128/269 (47%), Gaps = 13/269 (4%)

Query: 365 RDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKP-TKAINEILDRFQGET 423
           +D    V + + V N      +   N+  ++  G P  P  AK  + +  +I  + + + 
Sbjct: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293

Query: 424 FTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEI----HIGDFVKDRNETKTLI 478
           F  E K DGER Q+H  + G  +   SR G + T  Y E      +  ++   N  +  +
Sbjct: 294 FIEE-KMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCV 352

Query: 479 LDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVK---VRVCLFAFDILCHNSNKLINYS 535
           LD E V +DKE+  +LPF ++ +  R  +  + V     R  L  FD++  N   L+N  
Sbjct: 353 LDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIP 412

Query: 536 LKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHY 595
           L +R+  L ++ TP     +       S+   ++  L+ +++   EG+++K      S Y
Sbjct: 413 LYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRY 469

Query: 596 EPSKRSRNWLKLKKDYLEGIGDSLDLCVL 624
             + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 470 TVASRNDDWIKVKPEYLEQFGENMDLIVI 498

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 113/224 (50%), Gaps = 12/224 (5%)

Query: 409 TKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEIH---- 463
           T + + I  R + + F  E K DGER Q+H +  G  ++  SR G + +  Y +      
Sbjct: 285 TYSYDTIARRLKNDFFIEE-KMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGDNRNNGA 343

Query: 464 IGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVK---VRVCLFA 520
           IG ++    + K  ILD E V +D  +  ILPF ++ +   + +   D++         A
Sbjct: 344 IGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMA 403

Query: 521 FDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSC 580
           FD++  N + L    L +R+  L ++  P P   +    L  ++   ++  L++++    
Sbjct: 404 FDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGS 463

Query: 581 EGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVL 624
           EG+++K  +   S Y  +KRS +W+K+K +YLE  G+++DL V+
Sbjct: 464 EGIILKRFD---SQYLVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,535,329
Number of extensions: 2887194
Number of successful extensions: 7473
Number of sequences better than 10.0: 43
Number of HSP's gapped: 7566
Number of HSP's successfully gapped: 44
Length of query: 765
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 648
Effective length of database: 40,065,477
Effective search space: 25962429096
Effective search space used: 25962429096
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)