Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A019307.346ON45045022890.0
NCAS0A141207.346ON42742515960.0
TDEL0C020207.346ON42544614870.0
KAFR0B008407.346ON42642214840.0
SAKL0F11286g7.346ON42343314670.0
KLLA0D12430g7.346ON41841614590.0
CAGL0A03927g7.346ON43742214610.0
Kpol_530.357.346ON42542614480.0
Skud_12.2667.346ON43641714480.0
Suva_10.2977.346ON43641714430.0
Smik_12.2617.346ON43641714390.0
YLR203C (MSS51)7.346ON43641714300.0
NCAS0E028807.346ON42941614270.0
TPHA0F029307.346ON43641614160.0
Ecym_47277.346ON42941914060.0
Kwal_56.246317.346ON42242813770.0
ZYRO0F11616g7.346ON41541613730.0
NDAI0E044807.346ON44342813730.0
KLTH0H01342g7.346ON42243613680.0
KNAG0B026307.346ON43842513560.0
ACL152W7.346ON42841513470.0
KNAG0C037507.346ON42441513420.0
TBLA0E005007.346ON43742913280.0
NDAI0D015001.521ON32179790.32
KLTH0G09108g2.231ON782139732.2
Skud_15.1626.25ON73426704.6
Kwal_33.14788na 1ON29654687.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A01930
         (450 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   886   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   619   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   577   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   576   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   569   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   566   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   567   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   562   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   562   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   560   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   558   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   555   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   554   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   550   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   546   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   535   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   533   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   533   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   531   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   526   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   523   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   521   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   516   0.0  
NDAI0D01500 Chr4 complement(361232..362197) [966 bp, 321 aa] {ON...    35   0.32 
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    33   2.2  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...    32   4.6  
Kwal_33.14788 s33 (817935..818825) [891 bp, 296 aa] {ON} [contig...    31   7.3  

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/450 (94%), Positives = 423/450 (94%)

Query: 1   MLAVKTGNMTTANMILKSIPLQECSISYFKNNYQKFSNRHFVGFVKNALGMEPPPSPNEP 60
           MLAVKTGNMTTANMILKSIPLQECSISYFKNNYQKFSNRHFVGFVKNALGMEPPPSPNEP
Sbjct: 1   MLAVKTGNMTTANMILKSIPLQECSISYFKNNYQKFSNRHFVGFVKNALGMEPPPSPNEP 60

Query: 61  AFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTGKEINYTCPISGIPTHHSKEAWENDTN 120
           AFENRFHPWDQSPSPD            KCPVTGKEINYTCPISGIPTHHSKEAWENDTN
Sbjct: 61  AFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKEINYTCPISGIPTHHSKEAWENDTN 120

Query: 121 YHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDS 180
           YHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDS
Sbjct: 121 YHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDS 180

Query: 181 EFQLATVTKMLSYPITIASILHKYCPYALEPNGPITLEGLKSIAALKYSLRHNEFETTKE 240
           EFQLATVTKMLSYPITIASILHKYCPYALEPNGPITLEGLKSIAALKYSLRHNEFETTKE
Sbjct: 181 EFQLATVTKMLSYPITIASILHKYCPYALEPNGPITLEGLKSIAALKYSLRHNEFETTKE 240

Query: 241 RPMRIFILGARAESQLPEHIWKQFSYLFPFQNFEINFIGPECSVLXXXXXXXXXXXXXXX 300
           RPMRIFILGARAESQLPEHIWKQFSYLFPFQNFEINFIGPECSVL               
Sbjct: 241 RPMRIFILGARAESQLPEHIWKQFSYLFPFQNFEINFIGPECSVLMNNNNMNAEETNTTT 300

Query: 301 SGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPEN 360
           SGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPEN
Sbjct: 301 SGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPEN 360

Query: 361 TKSWMGETMKALLDTKCAIFTTGFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKW 420
           TKSWMGETMKALLDTKCAIFTTGFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKW
Sbjct: 361 TKSWMGETMKALLDTKCAIFTTGFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKW 420

Query: 421 ELNDMDPQEVYQYNMYIAGFRGKRYHAVKV 450
           ELNDMDPQEVYQYNMYIAGFRGKRYHAVKV
Sbjct: 421 ELNDMDPQEVYQYNMYIAGFRGKRYHAVKV 450

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/425 (67%), Positives = 336/425 (79%), Gaps = 14/425 (3%)

Query: 26  ISYFKNNYQKFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXX 85
           +S F  + +  S+R  VGFVKNALG++PPP P EP F NRF+PWD+SPSP          
Sbjct: 17  VSLFAIDSRISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIK 76

Query: 86  XXXKCPVTGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRS 145
              KCPVTGKEI +TCP+SGIPTH+SKEAWENDTNYH+NKIY+ L+KVN++EHDLRSGR 
Sbjct: 77  AQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRP 136

Query: 146 FPEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYC 205
           FPEF+FP  Q  D  V+M NWD+FFYTRQF SMD+EFQLATVTKMLSYPITI SIL+KY 
Sbjct: 137 FPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYS 196

Query: 206 PYALEPNGPITLEGLKSIAALKYSLRHNEFETTKERPMRIFILGARAESQLPEHIWKQFS 265
           PY L P GP+TLEGLKS+AAL+Y+LR+N F TTK RPMRIFILGARAESQLP HIWKQ  
Sbjct: 197 PYNLIPKGPVTLEGLKSLAALRYTLRNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQ 256

Query: 266 YLFPFQNFEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYH 325
           +LFP Q FEINFIGPECS+L                        +RIVKR+DE L L Y+
Sbjct: 257 FLFPAQAFEINFIGPECSLLEQDSNYLSSD--------------SRIVKRVDESLTLAYY 302

Query: 326 TDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFN 385
            D+F   H A+DFFPYD YND+FFTFHPGFASPE++K+WMG+TMKALLDTKCAIFTTGF+
Sbjct: 303 PDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFS 362

Query: 386 KQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRY 445
           + D++KDI  VQ+TYG+EVDMLM P KNVFGSTKWELND++PQ+VYQ+NMYIAGFRGKRY
Sbjct: 363 QDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRY 422

Query: 446 HAVKV 450
           H VK 
Sbjct: 423 HTVKA 427

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/446 (62%), Positives = 339/446 (76%), Gaps = 26/446 (5%)

Query: 9   MTTANMILKSIPLQECSISYFKNNYQKFSNRHFV-GFVKNALGMEPPPSPNEPAFENRFH 67
           M +A     S+  Q C         + F+ R F+ GFV+NALG++PPPSP++P  ENRFH
Sbjct: 2   MLSATSRFPSLRAQRCG--------KVFNQRRFIIGFVRNALGLDPPPSPDDPTPENRFH 53

Query: 68  PWDQSPSPDXXXXXXXXXXXXKCPVTGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIY 127
           PWDQSP  D            +CPVTGKEINYTCP+SGIPTHHS+EAWE D  YHQ+K Y
Sbjct: 54  PWDQSPVGDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKY 113

Query: 128 DILKKVNVFEHDLRSGRSFPEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATV 187
           +ILKKVN++EHDLRSGR FPEF+FPQ QD D  V+M NWD+FFYTRQF SMD+EFQLA V
Sbjct: 114 EILKKVNIYEHDLRSGRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAV 173

Query: 188 TKMLSYPITIASILHKYCPYALEPNGPITLEGLKSIAALKYS---LRHNEFETTKERPMR 244
           TKMLSYPI+IAS+LH++ PY+L P GP+TLEGLKS+AAL+Y+   L +    +TK+RPMR
Sbjct: 174 TKMLSYPISIASVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISSTKDRPMR 233

Query: 245 IFILGARAESQLPEHIWKQFSYLFPFQNFEINFIGPECSVLXXXXXXXXXXXXXXXSGSM 304
           IFILGARAE+QLP H+WKQ  YLFP Q FE++F+GPEC +                   +
Sbjct: 234 IFILGARAEAQLPGHVWKQLQYLFPEQMFELHFVGPECLL------------NKEKHQYV 281

Query: 305 TEIRPNRIVKRIDERLNLVYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSW 364
           T   P  +VKR+DE ++ VYHTDFFH LH A+DFFPYD Y DVFF FHPGF +PE + SW
Sbjct: 282 TSSTP--VVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASW 339

Query: 365 MGETMKALLDTKCAIFTTGFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELND 424
           + ETMK LL+TKCAIFTTGFNK DLL+D+D V++ YGKEVD+LM+P KNVFGSTKWELND
Sbjct: 340 LNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVLMEPVKNVFGSTKWELND 399

Query: 425 MDPQEVYQYNMYIAGFRGKRYHAVKV 450
           M+PQEVYQ+NMYIAGFRGKRYHA++V
Sbjct: 400 MNPQEVYQFNMYIAGFRGKRYHAIEV 425

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/422 (63%), Positives = 326/422 (77%), Gaps = 20/422 (4%)

Query: 34  QKFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVT 93
           ++  +R  VGFV+NALG+EPPP+P+EP   NRF+PWDQSPSP+            +CP+T
Sbjct: 20  RRVLSRTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPIT 79

Query: 94  GKEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQ 153
           GKEINYTCPISGIPTHHS+EAWE D  YH+NKI DILKKVN++EHDLRSGRSFPEF+FP 
Sbjct: 80  GKEINYTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPS 139

Query: 154 SQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNG 213
            Q  D AV++ NWD++FYTR F SMD+EFQLATVTKMLSYPITIAS+LH+Y PY+L P+G
Sbjct: 140 DQTFDRAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHG 199

Query: 214 PITLEGLKSIAALKYSLRHNEFETT-----KERPMRIFILGARAESQLPEHIWKQFSYLF 268
           PITLEGLKSIAAL+YSL  ++ +++     K RPMRIFILGARAESQLP H+WKQF YLF
Sbjct: 200 PITLEGLKSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILGARAESQLPGHVWKQFQYLF 259

Query: 269 PFQNFEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYHTDF 328
           P Q FEI FIGPEC +                  S +    N IVKRID+ ++LVYH   
Sbjct: 260 PLQTFEIIFIGPECQL---------------REPSNSVGGANNIVKRIDDTISLVYHPKL 304

Query: 329 FHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQD 388
           FH +H A+DFFPYD YNDVFF FHPGFASPE  + WM +T+KALLDTKCA+F TGF+K+D
Sbjct: 305 FHDIHKAQDFFPYDPYNDVFFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKD 364

Query: 389 LLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAV 448
           L  D+ ++ + YG ++D LM P KN+FGSTKWELND++PQEVYQ+NMYI+ FRGKRYH +
Sbjct: 365 LSNDVKLLNKMYGDKLDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPI 424

Query: 449 KV 450
           ++
Sbjct: 425 EI 426

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/433 (63%), Positives = 336/433 (77%), Gaps = 20/433 (4%)

Query: 22  QECSISYFKNNYQKFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXX 81
           + CSI+    +  +   RH +GFV+NALG++PPPSP++P  +NRFHPWDQSPSPD     
Sbjct: 7   KRCSIA--PASATRIQKRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRA 64

Query: 82  XXXXXXXKCPVTGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLR 141
                  +CPVTGKEINYTCP SGIPTHHS+EAWE DT YH  K Y+ILKKVN++EHDLR
Sbjct: 65  ATIRALARCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLR 124

Query: 142 SGRSFPEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASIL 201
           SGR FPEF+FPQ QD+D  V+M NWD+FFYTRQF SMD+EFQLA VTKMLSYP T+ S+L
Sbjct: 125 SGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVL 184

Query: 202 HKYCPYALEPNGPITLEGLKSIAALKYSL---RHNEFE-TTKERPMRIFILGARAESQLP 257
           H++ PYAL P GPITLEGLKS+AAL+Y+L   +H +    TK+RPMRIFILGARAE+QLP
Sbjct: 185 HEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLP 244

Query: 258 EHIWKQFSYLFPFQNFEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRID 317
            H+WKQF +LFP  NFE++FIGPE                      +T   P  IV+R+D
Sbjct: 245 GHVWKQFQFLFPEINFELHFIGPES------------FYDREKREYITSSTP--IVRRVD 290

Query: 318 ERLNLVYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKC 377
           E L+ VYHTD+FH  H A+DFFPYD Y D+FF FHPGFA+PE+T+ WMG+TM+ LL+TKC
Sbjct: 291 ETLSFVYHTDYFHVFHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKC 350

Query: 378 AIFTTGFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYI 437
           AIFTTGFN+QDL++D+  V+E YG E+DMLM+P +N+FGSTKWELNDM+PQEVYQ+NMYI
Sbjct: 351 AIFTTGFNEQDLVRDMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYI 410

Query: 438 AGFRGKRYHAVKV 450
           AGFRGKRYHA++V
Sbjct: 411 AGFRGKRYHAIEV 423

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/416 (62%), Positives = 317/416 (76%), Gaps = 16/416 (3%)

Query: 38  NRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTGKEI 97
            R  +GFV+NALG++PP SP++P  ENRFHPWDQSPSPD             CPVT K+I
Sbjct: 16  TRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDI 75

Query: 98  NYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDH 157
            +TCP+SGIPTHHS+EAWE DT YH++K Y++LKKVN++EHDLRSGR FPEF+FPQ QD+
Sbjct: 76  QFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDY 135

Query: 158 DCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITL 217
           D  V+M+NWD+FFYTR F SMD+EFQLA VTKMLSYPITI S+LH+Y PY+L P GPITL
Sbjct: 136 DRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITL 195

Query: 218 EGLKSIAALKYSL---RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNFE 274
           EGLKS+AAL+Y+L   +   F   ++ P+RIFILG RAE+QLP H+WKQ  YL P  + E
Sbjct: 196 EGLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255

Query: 275 INFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLHN 334
           ++F+GPE                     S  +     IVKRIDE++ L YHTDFFH  H 
Sbjct: 256 LHFVGPES-------------FYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHE 302

Query: 335 ARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDID 394
           A+DFFPYD YNDVFF FHPGFA+PE  + WMG+TMKAL+ TKCA+FTTGF+K+DLL+DI 
Sbjct: 303 AQDFFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDIS 362

Query: 395 IVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVKV 450
           IVQ+ YG E+DMLM+P  NVFGSTKWELND +P EVYQ+NMYIAGFRGKRYHA+++
Sbjct: 363 IVQDKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/422 (62%), Positives = 313/422 (74%), Gaps = 4/422 (0%)

Query: 33  YQKFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPV 92
           Y   S R  +GFV+NALG++PPPSP+EP  +NRFHPWDQSP+ D            KCPV
Sbjct: 16  YACVSKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPV 75

Query: 93  TGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFP 152
           T K I YTCPISGIPTHHS+EAWE D  YH +K Y+ILKKVN++EHDLRSGR FPEF+FP
Sbjct: 76  THKPIQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFP 135

Query: 153 QSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPN 212
           + Q  D  V++ NWD+F YTR F SMD+EFQLA VTKMLSYPITI S+LH++ PY+L P 
Sbjct: 136 RDQGPDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPK 195

Query: 213 GPITLEGLKSIAALKYSL--RHNEFETT--KERPMRIFILGARAESQLPEHIWKQFSYLF 268
           GPITLEGLKS+AAL+Y+L    N   TT  K +PMRIFILGARAE+QLP H+WKQ  +LF
Sbjct: 196 GPITLEGLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLF 255

Query: 269 PFQNFEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYHTDF 328
           P QNFEI+FIGPE                   + +        + KRIDE +   YHTD+
Sbjct: 256 PQQNFEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDY 315

Query: 329 FHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQD 388
           FHTLH A+DFFPYD Y DVFF FHPG ASPE+  +WM +T+K LLDTKCAIFTTGFNK+D
Sbjct: 316 FHTLHTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKD 375

Query: 389 LLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAV 448
           +  DI I+Q+TYGKE+DMLM P KNVFGSTKWEL+D DP  VYQ+NMYIAGFRGKRYH +
Sbjct: 376 MADDIQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPI 435

Query: 449 KV 450
           KV
Sbjct: 436 KV 437

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/426 (63%), Positives = 328/426 (76%), Gaps = 20/426 (4%)

Query: 31  NNYQKFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKC 90
            +Y     R  +GFV+NALG++PPPSP++P  ENRFHPWDQSP  D            KC
Sbjct: 14  GSYSLIQKRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKC 73

Query: 91  PVTGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFE 150
           PVT K+INYTCP+SGIPTHH KEAW  D +YH++K Y+ILKKVN++EHDLRSGR FPEF+
Sbjct: 74  PVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFD 133

Query: 151 FPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALE 210
           FPQ QD+D  +++ NWD+FFYTR F SMD+EFQLA VTKMLSYPITI S+LH++ PY+L 
Sbjct: 134 FPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLN 193

Query: 211 PNGPITLEGLKSIAALKYSL------RHNEFETTKERPMRIFILGARAESQLPEHIWKQF 264
           P GP+TLEGLKS+AAL+Y+L        N    T++RPMRIFILGARAE+QLP H+WKQF
Sbjct: 194 PKGPVTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQF 253

Query: 265 SYLFPFQNFEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVY 324
            YLFP Q FEI+FIGPEC +                +  +T   P  IVK++D+ L LV+
Sbjct: 254 QYLFPEQEFEIHFIGPECYL------------NKEKNQYITSSTP--IVKKVDDTLKLVF 299

Query: 325 HTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGF 384
           H D+FH  H A+DFFPYD + DVFFTFHPG+A PE T+ W+GETMKALLDTKCAIFTTGF
Sbjct: 300 HPDYFHVFHEAQDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGF 359

Query: 385 NKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKR 444
           +KQDLL+DID+V+  YG E+DMLM P KNVFGSTKWELNDM+PQEVYQ+NMYIAGFRGKR
Sbjct: 360 SKQDLLRDIDVVKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKR 419

Query: 445 YHAVKV 450
           YHA++V
Sbjct: 420 YHAIEV 425

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/417 (64%), Positives = 322/417 (77%), Gaps = 18/417 (4%)

Query: 37  SNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTGKE 96
           + RH +GFV+NALG++PPPSP++P  ENRFHPWDQSPS D             CPVTGK+
Sbjct: 32  TRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91

Query: 97  INYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQD 156
           INYTCP+SGIPTHHS+EAWE D  YH +K Y+ILKKVN++EHDLRSGR FPEF+FPQ Q 
Sbjct: 92  INYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQG 151

Query: 157 HDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPIT 216
           +D AV++ NWD+FFYTR F SMD+EFQLA VTKMLSYPITI S+LHK+ PY+L P GPIT
Sbjct: 152 YDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPIT 211

Query: 217 LEGLKSIAALKYSL----RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQN 272
           LEGLKS+AAL+Y+L      +   TTK R MRIFILGARAE+QLP H+WKQ  +LFP QN
Sbjct: 212 LEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQN 271

Query: 273 FEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTL 332
           FEI+F+GPEC                     +    P  +V+R+DE L  ++HTDFF   
Sbjct: 272 FEIHFVGPEC------------LYKRDKQEYVKSATP--VVQRVDETLRFIHHTDFFDVF 317

Query: 333 HNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKD 392
           H A+DFFPYD Y DVFFTFHPG+ASPE+  SWMGETM+ALL+TKCAIFTTGFNK+DL+ D
Sbjct: 318 HEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDD 377

Query: 393 IDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVK 449
           I+ V+  YGKE+D+LM P +NVFGSTKWELNDM+PQEVYQ+NMYIAGFRGKRYH +K
Sbjct: 378 INAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/417 (64%), Positives = 320/417 (76%), Gaps = 18/417 (4%)

Query: 37  SNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTGKE 96
           + RH +GFV+NALG++PPPSP++P  ENRFHPWDQSPS D             CPVTGK+
Sbjct: 32  TRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91

Query: 97  INYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQD 156
           INYTCP+SGIPTHHS+EAWE D  YH +K Y+ILKKVN++EHDLRSGR FPEF+FPQ Q 
Sbjct: 92  INYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQG 151

Query: 157 HDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPIT 216
           +D AV++ NWD+F YTR F SMD+EFQLA VTKMLSYPITI S+LHK+ PY+L P GPIT
Sbjct: 152 YDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPIT 211

Query: 217 LEGLKSIAALKYSL----RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQN 272
           LEGLKS+AAL+Y+L      +   TT+ R MRIFILGARAE+QLP H+WKQ  +LFP QN
Sbjct: 212 LEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQN 271

Query: 273 FEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTL 332
           FEI+FIGPEC                    S T      +V+RIDE L   +HTDFF   
Sbjct: 272 FEIHFIGPEC---------LYKRDKQEYVKSATP-----VVQRIDETLKFFHHTDFFQVF 317

Query: 333 HNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKD 392
           H A+DFFPYD Y DVFFTFHPG+ASPE+  SWMGETM ALL+TKCAIFTTGFNK+DL+ D
Sbjct: 318 HEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDD 377

Query: 393 IDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVK 449
           I++V+  YGKE+D+LM P KNVFGSTKWELNDM+PQEVYQ+NMYIAGFRGKRYH +K
Sbjct: 378 INLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/417 (64%), Positives = 321/417 (76%), Gaps = 18/417 (4%)

Query: 37  SNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTGKE 96
           + RH +GFV+NALG++PPPSP++P  ENRFHPWDQSPS D             CPVTGK+
Sbjct: 32  TRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91

Query: 97  INYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQD 156
           INYTCP+SGIPTHHS+EAWE D  YH +K Y+ILKKVN++EHDLRSGR FPEF+FPQ+Q 
Sbjct: 92  INYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQG 151

Query: 157 HDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPIT 216
           +D AV++ NWD+FFYTR F SMD+EFQLA VTKMLSYPITI S+LHK+ PY+L P GPIT
Sbjct: 152 YDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPIT 211

Query: 217 LEGLKSIAALKYSL----RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQN 272
           LEGLKS+AAL+Y+L      +    TK R MRIFILGARAE+QLP H+WKQ  +LFP QN
Sbjct: 212 LEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQN 271

Query: 273 FEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTL 332
           FEI+FIGPEC                     +    P  +V+R+DE L  ++ TDFF   
Sbjct: 272 FEIHFIGPEC------------LYKRDKQEYVKSTTP--VVQRVDETLKFIHRTDFFEVF 317

Query: 333 HNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKD 392
           H A+DFFPYD Y DVFFTFHPG+ASPE+  SWMGETMKALL+TKCAIFTTGFNK+DL  D
Sbjct: 318 HEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDD 377

Query: 393 IDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVK 449
           +++V+  YGKE+D+LM P KNVFGSTKWELNDM+PQEVYQ+NMYIAGFRGKRYH +K
Sbjct: 378 LNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/417 (64%), Positives = 321/417 (76%), Gaps = 18/417 (4%)

Query: 37  SNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTGKE 96
           + RH +GFV+NALG++PPPSP +P  ENRFHPWDQSPS D             CPVTGK+
Sbjct: 32  TRRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91

Query: 97  INYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQD 156
           INYTCP+SGIPTHHS+EAWE D  YH +K Y+ILKKVN++EHDLRSGR FPEF+FPQ Q 
Sbjct: 92  INYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQG 151

Query: 157 HDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPIT 216
           +D AV++ NWD+FFYTR F SMD+EFQLA VTKMLSYPITI S+LHK+ PY+L P GPIT
Sbjct: 152 YDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPIT 211

Query: 217 LEGLKSIAALKYSLRHNEFE----TTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQN 272
           LEGLKS+AAL+Y+L   E      TTK R MRIFILGARAE+QLP H+WKQ  +LFP Q+
Sbjct: 212 LEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQS 271

Query: 273 FEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTL 332
           FEI+FIGPEC                     +    P  +V+R+DE L  +Y T+FF   
Sbjct: 272 FEIHFIGPEC------------LYKRDKQEYVKSTTP--VVQRVDETLKFIYRTNFFEVF 317

Query: 333 HNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKD 392
           H A+DFFPYD Y DVFFTFHPG+ASPE+  SWMGETMKALL+TKCAIFTTGFNK+DL  D
Sbjct: 318 HEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDD 377

Query: 393 IDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVK 449
           I++V+  YGKE+D+LM+P +NVFGSTKWELNDM+PQEVYQ+NMYIAGFRGKRYH +K
Sbjct: 378 INLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/416 (64%), Positives = 314/416 (75%), Gaps = 18/416 (4%)

Query: 38  NRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTGKEI 97
            RH +GFV+NALG++PP SP++P  ENRFHPWDQSPSPD            +CPVTGKEI
Sbjct: 27  TRHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERAARIRTLARCPVTGKEI 86

Query: 98  NYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDH 157
           NYTCPISGIPTHHS+EAWE D  YH +K Y++LKKVN++EHDLRSGR FPEF+FP+ Q  
Sbjct: 87  NYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQGQ 146

Query: 158 DCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITL 217
           D  V+M NWD+F YTR F SMD+EFQ+A VTKMLSYPITI S+LH++ PY+L+P GPI+L
Sbjct: 147 DRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPISL 206

Query: 218 EGLKSIAALKYSLRHNE----FETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNF 273
           EGLKS+AAL+Y+L   +      TTK RPMRIFILGARAESQLP H+WKQ  YLFP Q F
Sbjct: 207 EGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQLQYLFPEQTF 266

Query: 274 EINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLH 333
           EI+FIGPE                              I + +DE L L+YHT++FH LH
Sbjct: 267 EIHFIGPESYYDKDKKKYIQLTTP--------------ITESVDETLKLIYHTEYFHKLH 312

Query: 334 NARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDI 393
            A+DFFPYD Y DVFF FHPGFAS E  + WM +TMK LLDTKCAIFTTGF K DLL+DI
Sbjct: 313 EAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDI 372

Query: 394 DIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVK 449
            +VQ+ YGKE+D+LMKPTKNVFGSTKWELNDM+PQEVYQ+NMYIAGFRGKRY  +K
Sbjct: 373 AVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/416 (63%), Positives = 318/416 (76%), Gaps = 19/416 (4%)

Query: 39  RHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTGKEIN 98
           R  +GFVKNALG++P PSP++P  ENRFHPWDQSPSPD            KCPVT KEIN
Sbjct: 34  RSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEIN 93

Query: 99  YTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDHD 158
           YTCP+SGIPTHHS+EAWE D +YHQ+K Y+ILKKVN++EHDLRSGR FPEF+FP  Q HD
Sbjct: 94  YTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHD 153

Query: 159 CAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITLE 218
             V++ NWD+FFYTR F SMD+EFQLA VTKMLSYP+TI SILH++ PY+L P GPITLE
Sbjct: 154 RVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLE 213

Query: 219 GLKSIAALKYSL-----RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNF 273
           GLKS+AAL+YSL     + N      +RPMRIFILGARAE+QLP H+WKQ  +LFP Q F
Sbjct: 214 GLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTF 273

Query: 274 EINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLH 333
           EI+FIG EC +                +  +    P  +VK+IDE + L+YH+D+FH  H
Sbjct: 274 EIHFIGTECLL------------NNEKNKYIKSAIP--VVKKIDETMKLIYHSDYFHVYH 319

Query: 334 NARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDI 393
            A+DF PYD Y DVFFTFHPGFA+PE +  WMG+TMKALL+TKCAIFTTGFNKQD+  D+
Sbjct: 320 EAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDV 379

Query: 394 DIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVK 449
           +IV+  YGKE+D LM P KN +GSTKWELNDM+PQE++Q+NMY+AGFRGKRYH +K
Sbjct: 380 EIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/419 (59%), Positives = 316/419 (75%), Gaps = 17/419 (4%)

Query: 35  KFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTG 94
           K   R  +GFV+NALG++PP SP+EP  +NRFHPWDQSPSP+            KCPVTG
Sbjct: 25  KQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTG 84

Query: 95  KEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQS 154
           K I ++C  SGIPTHHS+EAW+ND+ YH++K Y +LKKVN++EHDLRSGR F EF+FP+ 
Sbjct: 85  KNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQ 144

Query: 155 QDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGP 214
           QD+D  V+M NWD++FYTR F SMD+EFQLA VTKMLSYPITI SILH+Y PY+L P GP
Sbjct: 145 QDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGP 204

Query: 215 ITLEGLKSIAALKYSL---RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQ 271
           ITLEGLKS+AAL+Y+L   ++    + +++P+R+FILGARAE+QLP H+WKQ  YLFP  
Sbjct: 205 ITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRVFILGARAEAQLPGHVWKQLQYLFPES 264

Query: 272 NFEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYHTDFFHT 331
             E++F+GPE +                    +T   P  +VKRID+ + + YHTD+FH 
Sbjct: 265 LIELHFVGPESNY------------DREKREYVTSSIP--VVKRIDDTMKMHYHTDYFHV 310

Query: 332 LHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLK 391
            H A+DFFPYD YND+FF FHPGF SPE   +WM  T++ALL TKCAIFTTGFNK+DL+ 
Sbjct: 311 FHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMD 370

Query: 392 DIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVKV 450
           D+  V+E YG E+DML+ PTKNVFGSTKWELND++P EVYQ+NMYIAGFRGKRYHA+++
Sbjct: 371 DLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/428 (59%), Positives = 319/428 (74%), Gaps = 18/428 (4%)

Query: 27  SYFKNNYQKFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXX 86
           S  +N++     RH +GFV+NALG++PPPSP+EP  ENRFHPWDQSPSPD          
Sbjct: 9   SSLRNSHCSLQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRA 68

Query: 87  XXKCPVTGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSF 146
             KCPVTG+EINYTCP SGIPTHHS+EAWE D +Y Q+K  +ILKKVN++EHDLRSGR F
Sbjct: 69  LAKCPVTGREINYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGRPF 128

Query: 147 PEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCP 206
           PEF+FP  QD D  V++ NWD+FFYTR F SMD+EFQLA VTKMLSYPITI S+LH++ P
Sbjct: 129 PEFDFPLDQDFDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQFSP 188

Query: 207 YALEPNGPITLEGLKSIAALKYSLRHNE----FETTKERPMRIFILGARAESQLPEHIWK 262
           Y+L P GPITLEGLKS+AAL+Y+L  ++        K  P+RIF+LGARAE+QLP H+WK
Sbjct: 189 YSLNPKGPITLEGLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQLPGHVWK 248

Query: 263 QFSYLFPFQNFEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNL 322
           Q  ++FP    EI+F+GPE                              I++R+DE LN 
Sbjct: 249 QLQFMFPETQMEIHFVGPESYYDRNKREYVHSAAP--------------IIRRVDETLNF 294

Query: 323 VYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTT 382
           VYHTD+FH  H A+DFFPYD Y D+FF FHPGFA+PE+ ++WMG+TM+ALL+TKCAIFTT
Sbjct: 295 VYHTDYFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTT 354

Query: 383 GFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRG 442
           GFN+ DL +D+D V   YGKE+D++M P KN FGSTKWELND++PQEVYQ+NM++AGFRG
Sbjct: 355 GFNEVDLQRDLDAVVAEYGKELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRG 414

Query: 443 KRYHAVKV 450
           KRYHA++V
Sbjct: 415 KRYHAIEV 422

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/416 (61%), Positives = 319/416 (76%), Gaps = 17/416 (4%)

Query: 38  NRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTGKEI 97
            R  +GFV+NALG++PPPSP++P  ENRFH WDQSP+ D            +CPVTGKEI
Sbjct: 14  RRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVTGKEI 73

Query: 98  NYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDH 157
           NYTCP+SGIPTHHSKEAWE D  YH++K +++LKKVN++EHDLRSGR FPEF+FPQ  + 
Sbjct: 74  NYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLEF 133

Query: 158 DCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITL 217
           D  V+M NWD+FFYTRQF SMD+EFQLA VTKMLSYPITIAS+L+++ PY+L P GPITL
Sbjct: 134 DRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPITL 193

Query: 218 EGLKSIAALKYSLRHNEFET---TKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNFE 274
           EGLKS+AAL+Y+L   E +T   TK+RPMR+FILGARAE+ LP H+WKQ  +LFP   FE
Sbjct: 194 EGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETAFE 253

Query: 275 INFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLHN 334
           ++FIGPEC V                        P  +VKRIDE L+ VYHTD+FH  H+
Sbjct: 254 LHFIGPECLVNKEKHQYVSS--------------PAPVVKRIDETLSFVYHTDYFHVYHD 299

Query: 335 ARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDID 394
           A+DFFPYD Y D FF FHPGF +PE+TK W+ +T+  LL+TKCAIF TG NK  LL+DI+
Sbjct: 300 AQDFFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDIN 359

Query: 395 IVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVKV 450
            V + + KE+D+LM+PTKN++GSTKWELND++PQEVYQ+NMYIAGFRGKRYHA+++
Sbjct: 360 AVMDKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/428 (59%), Positives = 316/428 (73%), Gaps = 20/428 (4%)

Query: 29  FKNN--YQKFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXX 86
           F+NN      S+R  +GFV+NALG++P  SP++P  ENRFHPWDQSP  D          
Sbjct: 30  FRNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRT 89

Query: 87  XXKCPVTGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSF 146
              CPVT KEINYTCPISGIPTHHSK AWE D NYH NKIY+ILKKVN++EHDLRSGR F
Sbjct: 90  LAHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPF 149

Query: 147 PEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCP 206
           PEF FPQ QD D  ++M NWD+F YTR F SMD+EFQ+A VTKMLSYPITI SILH++ P
Sbjct: 150 PEFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSP 209

Query: 207 YALEPNGPITLEGLKSIAALKYSLR--HNE--FETTKERPMRIFILGARAESQLPEHIWK 262
           Y+L+P GPITLEGLKS+AAL+Y+L   HN+     TK RPMRIF+LGARAE+QLP HIWK
Sbjct: 210 YSLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWK 269

Query: 263 QFSYLFPFQNFEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNL 322
           Q  YLFP Q FE+ FIGPE                      +   +P  +++ ID+ L L
Sbjct: 270 QLQYLFPEQKFELFFIGPEA------------YYDKEKKQYLKLDKP--LIQTIDDTLKL 315

Query: 323 VYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTT 382
            + T++FHTLH ++D FPYD Y DVFF FHPGF++ E T+ WM +TMK+LL+T+CAIF T
Sbjct: 316 TFITEYFHTLHESQDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNT 375

Query: 383 GFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRG 442
           GF++ D+L D++I+ E Y  ++D+LMKP KNVFGSTKWELND++PQ+VYQ+NMYIAGFRG
Sbjct: 376 GFSRNDMLNDMNILDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRG 435

Query: 443 KRYHAVKV 450
           KRY  V++
Sbjct: 436 KRYPTVEL 443

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/436 (59%), Positives = 324/436 (74%), Gaps = 20/436 (4%)

Query: 21  LQECSISY--FKNNYQKFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXX 78
           +Q C +S    ++       RH +GFV+NALG++PPPSP+EP  ENRFHPWDQSPSPD  
Sbjct: 1   MQRCILSRNTVRSCQHNVQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLR 60

Query: 79  XXXXXXXXXXKCPVTGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEH 138
                     KCPVTG+EINYTCP SGIPTH+S+EAWEND  Y Q+K  +ILKKVN++EH
Sbjct: 61  ERAATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEH 120

Query: 139 DLRSGRSFPEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIA 198
           DLRSGR FPEF+FP  QD D  V++ NWD+FFYTR F SMD+EFQLA VTKMLSYP+TI 
Sbjct: 121 DLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIG 180

Query: 199 SILHKYCPYALEPNGPITLEGLKSIAALKYSL--RHNEFET--TKERPMRIFILGARAES 254
           S+LH++ PY+L P GP+TLEGLKS+AAL+Y+L    N   T  TK  P+RIFILGARAE+
Sbjct: 181 SVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEA 240

Query: 255 QLPEHIWKQFSYLFPFQNFEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVK 314
           QLP H+WKQ  ++FP  N E++F+GPE                   S S        IV+
Sbjct: 241 QLPGHVWKQLQFMFPETNIELHFVGPES-------YYDRNKREYVHSSSP-------IVR 286

Query: 315 RIDERLNLVYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLD 374
           R+DE L+ VYHTD+FH  H A+DFFPYD Y D+FF FHPGFA+PE+ ++WMG+TM+ALL+
Sbjct: 287 RVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLE 346

Query: 375 TKCAIFTTGFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYN 434
           TKCA+FTTGFN+ DL +D+  V   +GKE+DMLM+P  N FGSTKWELNDM+PQEVYQ+N
Sbjct: 347 TKCAVFTTGFNELDLRRDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFN 406

Query: 435 MYIAGFRGKRYHAVKV 450
           M+IAGFRGKRYHA++V
Sbjct: 407 MFIAGFRGKRYHAIEV 422

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/425 (59%), Positives = 310/425 (72%), Gaps = 26/425 (6%)

Query: 37  SNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTGKE 96
           + R  +GFV+NALG+EPPPSP +P  ENRFHPWDQSP               KCPVTG  
Sbjct: 27  ARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGLN 86

Query: 97  INYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQD 156
           + YTCP+SGIPTHHS+EAWE DT YH  K Y+ LKKVN++EHDLRSGR FPEF+FPQ Q 
Sbjct: 87  VEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQG 146

Query: 157 HDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPIT 216
           +D  V+M NWD+FFYTR F SMD+EFQLA VTKMLSYP+TIAS+L ++ PY+L P GPIT
Sbjct: 147 YDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPIT 206

Query: 217 LEGLKSIAALKYSLRHNEFETT------------KERPMRIFILGARAESQLPEHIWKQF 264
           LEGLKS+AA++Y+L    F  +            K RPMR+F+LGARAE+QLP H+WKQ 
Sbjct: 207 LEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQL 266

Query: 265 SYLFPFQNFEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVY 324
           SYLFP Q+FE+ FIGPE                    G      P  +V+++DE L  ++
Sbjct: 267 SYLFPEQSFEMVFIGPES-------------YYDRARGQYVR-SPTPVVEKVDETLKFIH 312

Query: 325 HTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGF 384
           +TD+FH LH ++DFFPYD Y D FFTFHPGFASPEN  +W+  T+ ALLDTKCAIFTTGF
Sbjct: 313 YTDYFHVLHESQDFFPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGF 372

Query: 385 NKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKR 444
           ++ DL+ D+ ++ E +G E+D+LM+PTKNVFGSTKWELND++P EVYQ+NMYIAGFRGKR
Sbjct: 373 DRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKR 432

Query: 445 YHAVK 449
           YH +K
Sbjct: 433 YHTIK 437

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/415 (59%), Positives = 299/415 (72%), Gaps = 16/415 (3%)

Query: 38  NRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTGKEI 97
            R  +GFV+NALG++PP SP+EP  ENRFH W+QSPSPD            +CPVTGK+I
Sbjct: 28  RRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRALARCPVTGKDI 87

Query: 98  NYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDH 157
            Y+C  SGIPTHHS+EAWE D  YH++K +  L+KVNV+EHDLRSGR F EF+FPQ Q  
Sbjct: 88  RYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGR 147

Query: 158 DCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITL 217
           D  V+M NWD+F YTRQF SMD++FQLA VTKMLSYPITI S+LH++ PYALEP GPITL
Sbjct: 148 DRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITL 207

Query: 218 EGLKSIAALKYSL--RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNFEI 275
           EGLKS+AAL+Y+L          + +PMRIFILGARAE+QLP H+WKQ  YLFP  N EI
Sbjct: 208 EGLKSLAALRYTLYPESESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEI 267

Query: 276 NFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLHNA 335
           +FIGPE                              + KR+D  L LV+HTD+ H  H A
Sbjct: 268 HFIGPEALYDRQRKEYVHSSTP--------------VSKRVDGTLKLVHHTDYLHVFHEA 313

Query: 336 RDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDIDI 395
           +DFFPYD YNDVFF FHPGFAS E   SWM +T+ ALL+TKCAIF TGF++ D+  D + 
Sbjct: 314 QDFFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEA 373

Query: 396 VQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVKV 450
           ++ ++  E+D+LM PTKN+FGSTKWELNDM+P EVYQ+NMYIAGFRGKRYHA++V
Sbjct: 374 LRASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/415 (57%), Positives = 303/415 (73%), Gaps = 20/415 (4%)

Query: 38  NRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTGKEI 97
           +R  +G+V+NA G+EP  SP+ P   NRFHPW++SP  D            +CPVTGK I
Sbjct: 28  HRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNI 87

Query: 98  NYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDH 157
           NYTCPISGIPTHHS++AWE+DT+YH+NK Y+ LKKVN++EHDLRSGRSFPEF+FP  Q  
Sbjct: 88  NYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGR 147

Query: 158 DCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITL 217
           D AV++ NWD+F YTRQF SMD+EF LATVTKMLSYPITIAS+LH++ PY L+P GP+TL
Sbjct: 148 DRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTL 207

Query: 218 EGLKSIAALKYSL--RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNFEI 275
           EGLKSIAAL+Y+L  +  +   +   PMRIFI+G RAESQLP H+WKQ  YLF  + FEI
Sbjct: 208 EGLKSIAALRYTLYPKLGKTSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFEI 267

Query: 276 NFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLHNA 335
           +FIGPEC +                           ++K++D+ L+L+YH  +FH LH +
Sbjct: 268 HFIGPECQLKEPKNTSTP------------------LIKKVDDTLSLIYHPQYFHELHKS 309

Query: 336 RDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDIDI 395
            D FPY+ Y DVFF FHPGFA P+  K W+ ET+  LL+TKCAIF TGFN+ D+  D+ +
Sbjct: 310 GDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTL 369

Query: 396 VQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVKV 450
           + + Y  E+D+LMKP KNVFGS KWELND++PQEVYQ+NMYIAGFRGKRYH +K+
Sbjct: 370 IDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/429 (57%), Positives = 316/429 (73%), Gaps = 30/429 (6%)

Query: 36  FSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDXXXXXXXXXXXXKCPVTGK 95
           +S R+ +GFV++ LG++PPPSPN+P  ENRFHPW+ SP  D            KCPV+  
Sbjct: 22  YSKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARIKTMAKCPVSNL 81

Query: 96  EINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQ 155
           +INYTCPISGIPTHHS++ WE DTNYH+N I DILKKVN++EHDLRSGR FPEF+FP+ Q
Sbjct: 82  DINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQ 141

Query: 156 DHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPI 215
           ++D  +++ NWD++FYTR F SMD+EFQLA VTKMLSYP+TIAS+LH++ PY+L P GP+
Sbjct: 142 EYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPV 201

Query: 216 TLEGLKSIAALKYSLRHNEFE--------------TTKERPMRIFILGARAESQLPEHIW 261
           TLEGLKS+AAL+Y+L +N                 T+K RPMRIFILGARAE+QLP H+W
Sbjct: 202 TLEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGARAEAQLPPHVW 261

Query: 262 KQFSYLFPFQNFEINFIGPECSVLXXXXXXXXXXXXXXXSGSMTEIRPNRIVKRIDERLN 321
           KQ  YLFP  NFEI+FIGPE  +                S  +T   P  I KRID+ ++
Sbjct: 262 KQLQYLFPNSNFEIHFIGPESLL------------SKDKSHYVTSTTP--ITKRIDDSMS 307

Query: 322 LVYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFT 381
           LVYHTD+FH  H A+DF+PYD Y D+FF FHPG A+ + T  W+ ETM+ LLD+KC IF 
Sbjct: 308 LVYHTDYFHVYHKAQDFYPYDPYFDIFFMFHPGLAATKET--WLNETMQGLLDSKCPIFM 365

Query: 382 TGFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFR 441
           TGF+++D+  DI ++ + + K++D+LMKP KNVFGSTKWELND +PQEVYQ+NMYIAG+R
Sbjct: 366 TGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYR 425

Query: 442 GKRYHAVKV 450
           GKRYHA + 
Sbjct: 426 GKRYHATET 434

>NDAI0D01500 Chr4 complement(361232..362197) [966 bp, 321 aa] {ON}
           Anc_1.521 YJR070C
          Length = 321

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 4/79 (5%)

Query: 360 NTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTK 419
           N  S +    +AL + KC       N  D  K +D + ET+G + ++L      V G TK
Sbjct: 27  NKDSVLSNRFRALFNLKCVAEQFKINPSDAKKAVDYMAETFGDKSELLKHEVAYVLGQTK 86

Query: 420 WELNDMDPQEVYQYNMYIA 438
               +MD  ++ +  M  A
Sbjct: 87  ----NMDSTDILRKVMLDA 101

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 60/139 (43%), Gaps = 16/139 (11%)

Query: 132 KVNVFEHDLRSGRSFPEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKML 191
           K+ + ++ +  GR FP+   P  +  D A   N +      + FV+ + EFQ AT    +
Sbjct: 84  KLQLSKYKMLFGRLFPQM--PPIEQVDVASFANAF------QGFVASNEEFQNATKNSHV 135

Query: 192 SYPITIASILHKYCPYALEPNGPITLEGLKSIAALKYSLRHNEFETTKERPMRIFILGAR 251
           + P++ AS        +  P G +   G+ +I  +  S++ +E      R ++I +    
Sbjct: 136 TVPVSSASGAGSPATASATPEGSV---GVDAIEGIDGSIQSHE-----GREIKIILPPKP 187

Query: 252 AESQLPEHIWKQFSYLFPF 270
                 +  W+Q   LF F
Sbjct: 188 VALHFIQVTWEQCCVLFRF 206

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 20/26 (76%)

Query: 5   KTGNMTTANMILKSIPLQECSISYFK 30
           KTG+ T++ ++ K++P +EC ISY K
Sbjct: 563 KTGDSTSSILLGKTLPFEECGISYGK 588

>Kwal_33.14788 s33 (817935..818825) [891 bp, 296 aa] {ON} [contig
           101] FULL
          Length = 296

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 312 IVKRIDERLNLVYHTDFFHTLHNARDFFPYDSYNDV-FFTFHPGFASPENTKSW 364
           +VKR D  L+L+   +F H L++  D+F  +   DV F T + G+ S E+ +SW
Sbjct: 194 VVKRAD--LDLLQFKEFVHALNSGIDYFNKNPEEDVQFITENFGY-SKEDAESW 244

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,202,399
Number of extensions: 2222293
Number of successful extensions: 5196
Number of sequences better than 10.0: 29
Number of HSP's gapped: 5268
Number of HSP's successfully gapped: 38
Length of query: 450
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 337
Effective length of database: 40,524,141
Effective search space: 13656635517
Effective search space used: 13656635517
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)