Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A019207.347ON19319310301e-144
TDEL0C020107.347ON1911939121e-126
ZYRO0F11638g7.347ON1911939061e-126
Suva_4.817.347ON1911939011e-125
Smik_4.737.347ON1911938951e-124
Skud_4.927.347ON1911938921e-123
YDL165W (CDC36)7.347ON1911938871e-123
Kpol_530.347.347ON1911938761e-121
NCAS0A141307.347ON1911938741e-121
CAGL0I03388g7.347ON1911938641e-119
KNAG0C037607.347ON1911938641e-119
KAFR0B008507.347ON1921948581e-118
TPHA0F029407.347ON1911938351e-115
TBLA0E005107.347ON2871697891e-106
KLTH0H01320g7.347ON1901947631e-104
Kwal_56.246347.347ON1901947621e-104
SAKL0F11308g7.347ON1911947531e-102
KLLA0D12408g7.347ON1841936899e-93
ACL151C7.347ON2082006613e-88
Ecym_47267.347ON1912006585e-88
SAKL0B08052g3.370ON576841046e-05
KLTH0F11880g3.370ON563841021e-04
ZYRO0C16588g3.370ON608821012e-04
NDAI0A050803.370ON57582993e-04
KAFR0H008603.370ON57882984e-04
Smik_16.3163.370ON56082966e-04
YPR072W (NOT5)3.370ON56082966e-04
Kwal_23.39623.370ON55384967e-04
CAGL0D01342g3.370ON54883959e-04
Skud_16.3613.370ON560124950.001
Suva_16.4013.370ON56582930.002
TPHA0A035003.370ON54881920.002
Kpol_1006.73.370ON54080920.002
TBLA0H014903.370ON55283890.004
KLTH0A03652g7.214ON77265880.006
KNAG0A072903.370ON50786880.007
Ecym_34563.370ON50886850.017
ADL364C3.370ON50487840.020
Kpol_1070.257.214ON686103840.023
KLLA0B09196g3.370ON59080830.030
CAGL0B01144g1.59ON391132820.035
TDEL0C051203.370ON56269820.040
NCAS0A112103.370ON58287770.17
TDEL0H023307.214ON81281710.93
Kwal_47.181147.214ON76365710.94
ZYRO0D16302g7.214ON82981701.2
KAFR0C028408.162ON35075691.7
CAGL0L00407g6.278ON1371161682.3
KLLA0E04335g7.214ON75866682.4
NDAI0A026907.214ON846106682.5
TBLA0D042707.214ON84793663.6
AGL147C8.368ON189692663.9
NDAI0C060108.210ON101498639.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A01920
         (193 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   401   e-144
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   355   e-126
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   353   e-126
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   351   e-125
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   349   e-124
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   348   e-123
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   346   e-123
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   342   e-121
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   341   e-121
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   337   e-119
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   337   e-119
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   335   e-118
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   326   e-115
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   308   e-106
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   298   e-104
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   298   e-104
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   294   e-102
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   270   9e-93
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   259   3e-88
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   258   5e-88
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    45   6e-05
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    44   1e-04
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    44   2e-04
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    43   3e-04
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    42   4e-04
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    42   6e-04
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    42   6e-04
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    42   7e-04
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    41   9e-04
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    41   0.001
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    40   0.002
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    40   0.002
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    40   0.002
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    39   0.004
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    39   0.006
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    39   0.007
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    37   0.017
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    37   0.020
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    37   0.023
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    37   0.030
CAGL0B01144g Chr2 complement(102067..103242) [1176 bp, 391 aa] {...    36   0.035
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    36   0.040
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    34   0.17 
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    32   0.93 
Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038...    32   0.94 
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    32   1.2  
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    31   1.7  
CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} simila...    31   2.3  
KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} simila...    31   2.4  
NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {O...    31   2.5  
TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa] ...    30   3.6  
AGL147C Chr7 complement(420751..426441) [5691 bp, 1896 aa] {ON} ...    30   3.9  
NDAI0C06010 Chr3 (1378818..1381862) [3045 bp, 1014 aa] {ON} Anc_...    29   9.5  

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  401 bits (1030), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 193/193 (100%), Positives = 193/193 (100%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60
           MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW
Sbjct: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120
           AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120

Query: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK
Sbjct: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180

Query: 181 CQREFLLFYNAIM 193
           CQREFLLFYNAIM
Sbjct: 181 CQREFLLFYNAIM 193

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  355 bits (912), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 2/193 (1%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M+KFGL+ALVPLIK +++E + +YDHS+TLGADL+SMLHSLGIPRDSKRHRVLDTFQSPW
Sbjct: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120
           AETSRSEVEP FFIPDSFT+IP VLQS T  TPP F+SVQ DQQRVALFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQT--TPPCFNSVQHDQQRVALFQDETLFYLFYK 118

Query: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEPVVS+DGLSERGSYVFFDPQRWEK
Sbjct: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEK 178

Query: 181 CQREFLLFYNAIM 193
           CQREFLLFYNAIM
Sbjct: 179 CQREFLLFYNAIM 191

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  353 bits (906), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 169/193 (87%), Positives = 182/193 (94%), Gaps = 2/193 (1%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60
           MDKFGLEALVPL+K +D+ELS  YDHSMTLGADL+SMLHSLGIPRDSKRH+VLDTFQSPW
Sbjct: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120
           AETSRSEVEP FFIP+SF +IP+VL S +  TPP F+SVQ+DQQRVALFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQS--TPPCFNSVQQDQQRVALFQDETLFYLFYK 118

Query: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEPVVS+DGLSERGSYVFFDPQRWEK
Sbjct: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEK 178

Query: 181 CQREFLLFYNAIM 193
           CQR+FLLFYNAIM
Sbjct: 179 CQRDFLLFYNAIM 191

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  351 bits (901), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/193 (86%), Positives = 180/193 (93%), Gaps = 2/193 (1%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60
           MDKFGL+ALVPL+K +DKELS  YDHSMTLGADL+SML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MDKFGLQALVPLLKQEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120
           AETSRSEVEP FF P+SFT+IP VLQSN   TPP F+S+Q DQQRVALFQDETLF+LFYK
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPSVLQSNV--TPPCFNSIQNDQQRVALFQDETLFFLFYK 118

Query: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEP+VS DGLSERGSYVFFDPQRWEK
Sbjct: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEK 178

Query: 181 CQREFLLFYNAIM 193
           CQR+FLLFYNAIM
Sbjct: 179 CQRDFLLFYNAIM 191

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  349 bits (895), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 180/193 (93%), Gaps = 2/193 (1%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M+KFGL+ALVPL+K +DKELS  YDHSMTLGADL+SML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120
           AETSRSEVEP FF P+SFT+IP VLQSN   TPP F+S+Q DQQRVALFQDETLF+LFYK
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNV--TPPCFNSIQNDQQRVALFQDETLFFLFYK 118

Query: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEP+VS DGLSERGSYVFFDPQRWEK
Sbjct: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEK 178

Query: 181 CQREFLLFYNAIM 193
           CQR+FLLFYNAIM
Sbjct: 179 CQRDFLLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  348 bits (892), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 179/193 (92%), Gaps = 2/193 (1%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M+KFGL ALVPL+K +DKELS  YDHSMTLGADL+SML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MEKFGLRALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120
           AETSRSEVEP FF P+SFT+IP VLQSN   TPP F+S+Q DQQRVALFQDETLF+LFYK
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNV--TPPCFNSIQNDQQRVALFQDETLFFLFYK 118

Query: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEP+VS DGLSERGSYVFFDPQRWEK
Sbjct: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEK 178

Query: 181 CQREFLLFYNAIM 193
           CQR+FLLFYNAIM
Sbjct: 179 CQRDFLLFYNAIM 191

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  346 bits (887), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 179/193 (92%), Gaps = 2/193 (1%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M+KFGL+ALVPL+K +DKELS  YDHSMTLGADL+SML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120
           AETSRSEVEP FF P+SFT+IP VLQS    TPP F+S+Q DQQRVALFQDETLF+LFYK
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSTV--TPPCFNSIQNDQQRVALFQDETLFFLFYK 118

Query: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEP+VS DGLSERGSYVFFDPQRWEK
Sbjct: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEK 178

Query: 181 CQREFLLFYNAIM 193
           CQR+FLLFYNAIM
Sbjct: 179 CQRDFLLFYNAIM 191

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  342 bits (876), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 160/193 (82%), Positives = 179/193 (92%), Gaps = 2/193 (1%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60
           MDKFGLEAL+PLIK DD ELSK Y+H+MT+G DL+SMLHSLGIPRD++R+R+LDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120
           AETSRSEVEP FF P+SF +IP+VLQS  K TPP F+S++ DQQRV LFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPRFFTPESFKNIPNVLQS--KVTPPVFNSIENDQQRVTLFQDETLFYLFYK 118

Query: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPM+EP+VS DGLSERGSY+FFDPQRWEK
Sbjct: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEK 178

Query: 181 CQREFLLFYNAIM 193
           CQREF+LFYNAIM
Sbjct: 179 CQREFVLFYNAIM 191

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  341 bits (874), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 164/193 (84%), Positives = 175/193 (90%), Gaps = 2/193 (1%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60
           MDKFGL+ALVPL++ DDKELSK YDHSMTLGADL+SM+HSLGIPRD+ RHRVLDTFQSPW
Sbjct: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120
           AETSRSEVEPTFFIPDSF  I  VLQS    TPP FDS Q DQQRVALFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPV--TPPRFDSAQNDQQRVALFQDETLFYLFYK 118

Query: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180
           HPGTV+QELTYLELR RNWRYH TL+AWLTKDP+MEP VS DGLSERGSYVFFDPQRWEK
Sbjct: 119 HPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEK 178

Query: 181 CQREFLLFYNAIM 193
           CQ++FLLFYNAIM
Sbjct: 179 CQKDFLLFYNAIM 191

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  337 bits (864), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 160/193 (82%), Positives = 176/193 (91%), Gaps = 2/193 (1%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M KFGL+ LVPLI+ D+++  K+YDHSMT+G DL+SMLHSLGIPRDSK HRVLDTFQSPW
Sbjct: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120
           AETSRSEVEP ++IP+SF +IPDVLQS T  TPP+FD VQ DQQRVALFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKT--TPPTFDDVQTDQQRVALFQDETLFYLFYK 118

Query: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180
           HPGTVIQELTYLELRKRNWRYHK LKAWLTKDPMMEPVV+ DGLSERGSYVFFDPQRWEK
Sbjct: 119 HPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEK 178

Query: 181 CQREFLLFYNAIM 193
           CQR+F LFY+AIM
Sbjct: 179 CQRDFPLFYSAIM 191

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  337 bits (864), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 174/193 (90%), Gaps = 2/193 (1%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60
           MDKFGL+ALVPL++  D E++  YDHSM LGADL+SMLHSLGIPRDSKR  VL TFQSPW
Sbjct: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120
           AETSRSEVEPTF+IP SF  I +VLQS +  TPP FDSVQ+DQQRVALFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPTFYIPASFLGIDEVLQSES--TPPCFDSVQRDQQRVALFQDETLFYLFYK 118

Query: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEPVVS DGLSERGSYVFFDPQRWEK
Sbjct: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEK 178

Query: 181 CQREFLLFYNAIM 193
           CQR+FLLFYNAIM
Sbjct: 179 CQRDFLLFYNAIM 191

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  335 bits (858), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 162/194 (83%), Positives = 175/194 (90%), Gaps = 3/194 (1%)

Query: 1   MDKFGLEALVPLIKPDDK-ELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSP 59
           MDKFGL+AL+PLIK D + E +  YDHSMTLGADL+SML+SLGIPRD + HRVLDTFQSP
Sbjct: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60

Query: 60  WAETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFY 119
           WAETSRSEVEP F IPDSF +I +VLQSN   TPP FDS+Q DQQRVALFQDETLFYLFY
Sbjct: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNV--TPPCFDSIQNDQQRVALFQDETLFYLFY 118

Query: 120 KHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWE 179
           KHP TVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEP+VS DGLSE+GSYVFFDPQRWE
Sbjct: 119 KHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWE 178

Query: 180 KCQREFLLFYNAIM 193
           KCQR+FLLFYNAIM
Sbjct: 179 KCQRDFLLFYNAIM 192

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  326 bits (835), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 174/193 (90%), Gaps = 2/193 (1%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60
           MDKFGLEAL+PLIK DD E SK Y+H+MT+GADLTS+ HSLGIP ++KR+RVLDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQHSLGIPNNNKRYRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120
           AETSRSEVEP +F P SFT+IP VLQS   DTP  F+SV+ DQQR++LFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPRYFTPKSFTNIPKVLQS--IDTPSVFNSVETDQQRISLFQDETLFYLFYK 118

Query: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180
           HPGTVIQELTYLELRKRNWRYHK LKAWLTKDP++EP+V+ DG SERGSY+FFDPQRWEK
Sbjct: 119 HPGTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEK 178

Query: 181 CQREFLLFYNAIM 193
           CQR+F+LFYNAIM
Sbjct: 179 CQRDFVLFYNAIM 191

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  308 bits (789), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 158/169 (93%), Gaps = 2/169 (1%)

Query: 25  DHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPWAETSRSEVEPTFFIPDSFTHIPDV 84
           DHS+T+GADL+SMLHSLG+PRD+KRHR+LDTFQSPWAETSRSEV+P FFIP SF++I +V
Sbjct: 121 DHSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRFFIPSSFSNISNV 180

Query: 85  LQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKT 144
           LQ NT  TPP+F++++ DQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWR+HK 
Sbjct: 181 LQCNT--TPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKI 238

Query: 145 LKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEKCQREFLLFYNAIM 193
           LK WLTKDPMMEP+V+ DG SERGSYVFFDPQRWEKCQREF+LFYNAIM
Sbjct: 239 LKTWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/17 (70%), Positives = 16/17 (94%)

Query: 1  MDKFGLEALVPLIKPDD 17
          MD+FGL+ALVPLI+ D+
Sbjct: 1  MDRFGLKALVPLIRLDE 17

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  298 bits (763), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 168/194 (86%), Gaps = 5/194 (2%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDS-KRHRVLDTFQSP 59
           M+K+GL AL+PLI+ +D+  S  YD SMTLG DL+ +LHSLGIP +   R+RVLDTFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58

Query: 60  WAETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFY 119
           W ETSRSEVEP FF+P+SF +IP+VLQS  +  PP+F+SVQ+D  +++LFQDETLFYLFY
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGER--PPAFNSVQQDHAKISLFQDETLFYLFY 116

Query: 120 KHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWE 179
           KHPG+V+QELTYLELRKRNWRYHKTLK WLTKDPMMEPVV+  G SERGSYVFFDPQRWE
Sbjct: 117 KHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWE 176

Query: 180 KCQREFLLFYNAIM 193
           KCQR+F+LFYNAIM
Sbjct: 177 KCQRDFVLFYNAIM 190

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  298 bits (762), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 168/194 (86%), Gaps = 5/194 (2%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRD-SKRHRVLDTFQSP 59
           M+K+GL AL+PLI+ +D+  S  YD SMTLG DL+ +LHSLGI  + S R+RVLDTFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQ--SPEYDSSMTLGIDLSPVLHSLGIASNQSTRYRVLDTFQSP 58

Query: 60  WAETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFY 119
           W ETSRSEVEP FF+P+SF +IP+VLQ+   D PP+F+SVQ+D  +++LFQDETLFYLFY
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQAG--DKPPAFNSVQQDHAKISLFQDETLFYLFY 116

Query: 120 KHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWE 179
           KHPG+V+QELTYLELRKRNWRYHKTLK WLTKDPMMEPVV+  G SERGSYVFFDPQRWE
Sbjct: 117 KHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWE 176

Query: 180 KCQREFLLFYNAIM 193
           KCQR+F+LFYNAIM
Sbjct: 177 KCQRDFVLFYNAIM 190

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  294 bits (753), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 166/194 (85%), Gaps = 6/194 (3%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSK-RHRVLDTFQSP 59
           ++K+GL+AL+PLIK +       YD +MT+G DL+SMLHSLGI  + + + RVLDTF SP
Sbjct: 3   VEKYGLKALLPLIKQETGNAE--YDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60

Query: 60  WAETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFY 119
           W ETSRSEVEP FF P+SF +IP+VLQS    +PPSF+SVQ+D  ++ALFQDETLFYLFY
Sbjct: 61  WVETSRSEVEPKFFTPESFVNIPNVLQS---PSPPSFNSVQQDHPKIALFQDETLFYLFY 117

Query: 120 KHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWE 179
           KHPGTV+QE+TYLELRKRNWRYHKTLK WLTKDPMMEPVVS DGLSERGSYVFFDPQRWE
Sbjct: 118 KHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWE 177

Query: 180 KCQREFLLFYNAIM 193
           KCQR+F+LFYNAIM
Sbjct: 178 KCQRDFVLFYNAIM 191

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  270 bits (689), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 129/193 (66%), Positives = 156/193 (80%), Gaps = 9/193 (4%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M+K+GL+ LVP+++ D       YD +MTLG DL S+L+SL I +D+K H  LD F+SPW
Sbjct: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55

Query: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120
            ETSRSEV+PTFFIP+SF +I  +L ++  +    F SV +DQ R++L QDETLFYLFYK
Sbjct: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE----FTSVNRDQPRISLLQDETLFYLFYK 111

Query: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180
           HPG+VIQELTYLELRKRNWRYHKTLK WLTKDPMMEPVV+ D +SERGSYVFFDPQRWEK
Sbjct: 112 HPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEK 171

Query: 181 CQREFLLFYNAIM 193
           CQR+F+L YNAIM
Sbjct: 172 CQRDFVLHYNAIM 184

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  259 bits (661), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 129/200 (64%), Positives = 150/200 (75%), Gaps = 16/200 (8%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRD-------SKRHRVL 53
           MDK+GL+ L+P+IK +     K YD  MTLG D++S+LHSL +          S  H  L
Sbjct: 18  MDKYGLKGLLPVIKHE-----KQYDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHAL 72

Query: 54  DTFQSPWAETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDET 113
           DTF SPW ETSRSEVEP FFIP+SF +I  VL   + D    F SV +D  R++L QDET
Sbjct: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD----FTSVARDHPRISLLQDET 128

Query: 114 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFF 173
           LFYLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEP+VS D  SERGSYVFF
Sbjct: 129 LFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFF 188

Query: 174 DPQRWEKCQREFLLFYNAIM 193
           DPQRWEKCQR+F+L Y+AIM
Sbjct: 189 DPQRWEKCQRDFILNYSAIM 208

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  258 bits (658), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 133/200 (66%), Positives = 151/200 (75%), Gaps = 16/200 (8%)

Query: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIP-RDS------KRHRVL 53
           M K+GL++L+P+IK D     K YD SMTLG DL S+LHSL +  RDS        H  L
Sbjct: 1   MSKYGLKSLLPVIKHD-----KQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55

Query: 54  DTFQSPWAETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDET 113
           DTF SPW ETSRSEVEP FFIP+SF +I  VL   +      F SV +D  R++L QDET
Sbjct: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST----YFTSVARDHPRISLLQDET 111

Query: 114 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFF 173
           LFYLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEP+VS D  SERGSYVFF
Sbjct: 112 LFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFF 171

Query: 174 DPQRWEKCQREFLLFYNAIM 193
           DPQRWEKCQR+F+L YNAIM
Sbjct: 172 DPQRWEKCQRDFILNYNAIM 191

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 47/84 (55%), Gaps = 6/84 (7%)

Query: 109 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMMEP--VVSNDGLS 165
           F  +TLF++FY + GT  Q L   EL + RNW+++K    W  K+    P  VVS++   
Sbjct: 484 FDLDTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEKLPPGVVSSENKQ 543

Query: 166 ERGSYVFFDPQR-W--EKCQREFL 186
           E  S+ +FD Q+ W   +C  +F+
Sbjct: 544 EEISWRYFDYQKSWLARRCGSDFV 567

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (55%), Gaps = 5/84 (5%)

Query: 106 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLS 165
           ++ F  +TLF++FY + GT  Q L+  EL  R W+++K  + W  K+  +E +      S
Sbjct: 473 MSKFDLDTLFFIFYHYQGTYEQFLSARELSIRGWQFNKVNRCWFYKE--VEKLPPGMEQS 530

Query: 166 ERGSYVFFDPQR-W--EKCQREFL 186
           E  S+ +FD Q+ W   +C  EF+
Sbjct: 531 EEISWRYFDYQKSWLARRCGAEFV 554

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 109 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPVVSNDGLSER 167
           F  +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +E +      SE 
Sbjct: 519 FDLDTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKE--VEKLPPGMAQSEE 576

Query: 168 GSYVFFDPQR-W--EKCQREFL 186
            S+ +FD QR W   +C  +F+
Sbjct: 577 ESWRYFDYQRSWLARRCNSDFI 598

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 4/82 (4%)

Query: 109 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPVVSNDGLSER 167
           F  +TLF++FY + GT  Q L   EL K R+W+Y+K    W  K+    P  +N    E 
Sbjct: 485 FDLDTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEKLPPGANYNKDEE 544

Query: 168 GSYVFFDPQR-W--EKCQREFL 186
            S+ +FD ++ W   +C  +F+
Sbjct: 545 ESWRYFDYKKSWLSRRCGNDFV 566

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 109 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPVVSNDGLSER 167
           F  +TLF++FY + GT  Q L+  EL K RNW+++K  + W  K+  +E +      SE 
Sbjct: 490 FDLDTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--IEKLPPGMNKSEE 547

Query: 168 GSYVFFDPQR-W--EKCQREFL 186
            S+ +FD ++ W   +C  +F+
Sbjct: 548 ESWRYFDYKKSWLARRCSPDFV 569

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 109 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSER 167
           F  +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 168 GSYVFFDPQR-W--EKCQREFL 186
            S+ +FD ++ W   +C  +F+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 109 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSER 167
           F  +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 168 GSYVFFDPQR-W--EKCQREFL 186
            S+ +FD ++ W   +C  +F+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 5/84 (5%)

Query: 106 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLS 165
           ++ F  +TLF++FY + GT  Q L   EL  R W+++K  + W  K+  +E +      S
Sbjct: 463 MSKFDLDTLFFIFYHYQGTHEQFLAARELTMRGWQFNKVNRCWFYKE--VEKLPPGMEQS 520

Query: 166 ERGSYVFFDPQR-W--EKCQREFL 186
           E  S+ +FD Q+ W   +C  +F+
Sbjct: 521 EEISWRYFDYQKSWLARRCGTDFV 544

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 46/83 (55%), Gaps = 6/83 (7%)

Query: 108 LFQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPVVSNDGLSE 166
           +F  +TLF++FY + GT  Q L   EL K RNW+++K  + W  K+  +E +      SE
Sbjct: 459 MFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKE--IEKLPPGMTKSE 516

Query: 167 RGSYVFFD-PQRW--EKCQREFL 186
             S+ +FD  + W   +C  +F+
Sbjct: 517 EESWRYFDFKKSWLSRRCGSDFV 539

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 20/124 (16%)

Query: 81  IPDVLQSNTKDTPPSFD------SVQKDQ--QRVAL------FQDETLFYLFYKHPGTVI 126
           +P  L +N  DT   FD      S + D    R +L      F  +TLF++FY + G+  
Sbjct: 430 VPLNLANNENDTTDKFDKDGNPKSKKHDDIYNRTSLARIFMKFDLDTLFFIFYHYQGSYE 489

Query: 127 QELTYLEL-RKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQR-W--EKCQ 182
           Q L   EL + RNW +++  + W  K+  +E +    G SE  S+ +FD ++ W   +C 
Sbjct: 490 QFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEEESWRYFDYKKSWLARRCG 547

Query: 183 REFL 186
            +F+
Sbjct: 548 NDFV 551

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 109 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSER 167
           F  +TLF++FY + G+  Q L   EL + RNW +++  + W  K+  +E +    G SE 
Sbjct: 477 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 534

Query: 168 GSYVFFDPQR-W--EKCQREFL 186
            S+ +FD ++ W   +C  +F+
Sbjct: 535 ESWRYFDYKKSWLARRCGNDFV 556

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 6/81 (7%)

Query: 109 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPVVSNDGLSER 167
           F  +TLF++FY + GT  Q L   EL K RNW+Y+K  + W  K+  +     +   +E 
Sbjct: 460 FDLDTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKE--VTKSAPDMAQTEE 517

Query: 168 GSYVFFDPQR-W--EKCQREF 185
            ++ +FD Q  W   +C  +F
Sbjct: 518 ETWRYFDYQNSWLARRCNHDF 538

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 10/80 (12%)

Query: 112 ETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPVVSNDGL--SERG 168
           +TLF++FY + GT  Q L   EL K RNW+++K  + W  K+    P     G+  +E  
Sbjct: 455 DTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYKEVTKSPP----GMQQAEEE 510

Query: 169 SYVFFDPQR-W--EKCQREF 185
           ++ +FD Q  W   +C  +F
Sbjct: 511 TWRYFDYQNSWLARRCNSDF 530

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 10/83 (12%)

Query: 109 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPVVSNDGL--S 165
           F  +TLF++FY + GT  Q L+  EL K RNW ++K  + W  ++    P     GL  S
Sbjct: 463 FDLDTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYREVEKLPP----GLPQS 518

Query: 166 ERGSYVFFDPQR-W--EKCQREF 185
           E  S+ +FD Q+ W   +C   F
Sbjct: 519 EEISWRYFDYQKSWLSRRCNSNF 541

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 114 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFF 173
           LFY FY     + QE+ Y  L +RNW+  KT + W ++  +  P  SN+ L E   +  F
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSRHSL--PKFSNE-LCEVADFKIF 723

Query: 174 DPQRW 178
           +   W
Sbjct: 724 NLDDW 728

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 8/86 (9%)

Query: 109 FQDETLFYLFYKHPGTVIQELTYLELR-KRNWRYHKTLKAWLTKDPMMEPVVSNDGLSER 167
           F  +TLF++FY + GT  Q L   EL   R+W+++K  + W  K+  +E +      SE 
Sbjct: 419 FDLDTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNKSEE 476

Query: 168 GSYVFFDPQR-W--EKCQREFLLFYN 190
            S+ +FD ++ W   +C  +F+  YN
Sbjct: 477 ESWRYFDYKKSWLARRCNSDFV--YN 500

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 5/86 (5%)

Query: 104 QRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDG 163
           Q +  F  +TLF++FY + GT  Q L   EL  R W +++  + W  ++  +E +     
Sbjct: 416 QILTKFDLDTLFFIFYHYQGTYEQFLAARELNIRGWLFNRVNRCWFYRE--VEKLPPGME 473

Query: 164 LSERGSYVFFDPQR-W--EKCQREFL 186
             E  S+ +FD Q+ W   +C  +F+
Sbjct: 474 QKEEVSWRYFDYQKSWLARRCGPDFV 499

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 5/87 (5%)

Query: 104 QRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDG 163
           Q +  F  +TLF++FY + GT  Q L   EL  R W +++  + W  K+  +E +     
Sbjct: 412 QIMTKFDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYKE--VEKLPPGMD 469

Query: 164 LSERGSYVFFDPQR-W--EKCQREFLL 187
             E  S+ +FD Q+ W   +C  +F+ 
Sbjct: 470 QKEEVSWRYFDYQKSWLARRCGPDFVF 496

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 9/103 (8%)

Query: 97  DSVQKDQQRVAL--FQDETLFYLFYKH--PGTVIQ-ELTYLELRKRNWRYHKTLKAWLTK 151
           D+  +D+ R+ L  F+   +F LFY +  P T +Q +++ + L +R+W+  K    W  K
Sbjct: 543 DNTNEDKLRLVLERFRPTEIFTLFYHYYFPLTPLQKQISSILLIERDWKLLKNGTMWFLK 602

Query: 152 DPMMEPVVSNDGLSERGSYVFFDPQRWEKCQR-EFLLFYNAIM 193
               EP  SN+   E G+Y  F    W   ++  F L +N++M
Sbjct: 603 --QGEPKFSNESF-EVGNYKIFKADDWTVIEKFNFKLDFNSLM 642

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 98  SVQKDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEP 157
           SV K   + AL   +TLF++FY + G+  Q L   EL  R W ++K  + W  K+  +E 
Sbjct: 494 SVAKIMSKFAL---DTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKE--VEK 548

Query: 158 VVSNDGLSERGSYVFFDPQR 177
           +       E  ++ +FD Q+
Sbjct: 549 LPPGIEGKEEVTWRYFDYQK 568

>CAGL0B01144g Chr2 complement(102067..103242) [1176 bp, 391 aa] {ON}
           similar to uniprot|Q06263 Saccharomyces cerevisiae
           YLR181c
          Length = 391

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 59/132 (44%), Gaps = 9/132 (6%)

Query: 10  VPLIKPDDKELSKIYDHSMTLGA---DLTSMLHSLGIPRDSKRHRVLDTFQSPWAETSRS 66
           VPL K +++E++K+   S        D+  +++ L +  +   +   D ++S   E   S
Sbjct: 210 VPLDKSEEEEVNKLVGDSQDNAVTEDDVDDLINKLKMADEDSENEPDDLYRSQADENGGS 269

Query: 67  EVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQ--DETLFYLFYKHPGT 124
           E      +PD+  +IP    S   DTP   DS  +DQ   A  +  D+ +  + +     
Sbjct: 270 EEPSNLGLPDTPANIP----SRKLDTPAFVDSSDEDQGSDADVEEKDDAVEPVVHTSSTP 325

Query: 125 VIQELTYLELRK 136
           + QEL  LE  K
Sbjct: 326 MEQELEELETSK 337

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 36.2 bits (82), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 109 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPVVSNDGLSER 167
           F  +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +E +      +E 
Sbjct: 473 FDLDTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKE--VEKLPPGMLQAEE 530

Query: 168 GSYVFFDPQ 176
            S+ +FD Q
Sbjct: 531 ESWRYFDYQ 539

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 13/87 (14%)

Query: 75  PDSFTHIPDVLQSNTKDTPP------SFDSVQKDQQRVAL------FQDETLFYLFYKHP 122
           P  FT+  +V++SN  +  P      S  SV+    R +L      F  +TLF++FY + 
Sbjct: 434 PIRFTYPYEVIKSNQGNLNPNDKTHASHQSVEDIYSRTSLAKIFSKFDLDTLFFIFYHYQ 493

Query: 123 GTVIQELTYLEL-RKRNWRYHKTLKAW 148
           GT  Q L   EL + R+W ++K    W
Sbjct: 494 GTYDQFLAARELSQNRHWLFNKVDSCW 520

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 32.0 bits (71), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 113 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVF 172
           TLFY +Y     + Q +  L L +RNW+  K+   W  +    EP  +N+ + E   Y  
Sbjct: 692 TLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLR--QGEPKFANE-VCEVADYKI 748

Query: 173 FDPQRWEKCQR-EFLLFYNAI 192
           F    W    +  F L Y A+
Sbjct: 749 FKLDDWTVADKPNFKLDYAAL 769

>Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038C
           (NOT3) - CCR4 trascriptional complex component [contig
           198] FULL
          Length = 763

 Score = 32.0 bits (71), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 114 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFF 173
           LFY FY     + +E+ Y  L +R+W+  K+  +W ++  +  P  SN+ L E   +  F
Sbjct: 674 LFYCFYYSITPLEREIAYTLLIERSWKVSKSGDSWFSRHGV--PKFSNE-LCEVADFKIF 730

Query: 174 DPQRW 178
           +   W
Sbjct: 731 NLDDW 735

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 35/81 (43%), Gaps = 4/81 (4%)

Query: 113 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVF 172
           TLFY +Y     + QE+  + L +R+W+  K    W  +    E   +N+ L E   Y  
Sbjct: 712 TLFYNYYFAVTPLEQEIASIILSERDWKVSKNCAMWFLR--QSETKFANE-LCEVADYKI 768

Query: 173 FDPQRWEKCQR-EFLLFYNAI 192
           F    W    R  F L Y A+
Sbjct: 769 FKLDDWTVIDRLNFKLDYAAL 789

>KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.162
           YBL016W
          Length = 350

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 10/75 (13%)

Query: 22  KIYDHSMTLGADLTSMLHSLG-----IPRDSKRHRVLDTFQSPWAETSRSEVEPTFFIPD 76
           K++ H   LG DL   +            ++ RH  L T+  P  E   + + PTFF   
Sbjct: 270 KVFAHVNPLGVDLLKKMLVFDPSKRITAAEALRHPYLKTYHDPNDEPEGAPISPTFF--- 326

Query: 77  SFTHIPDVLQSNTKD 91
            F H  DVL   TKD
Sbjct: 327 EFDHFKDVL--TTKD 339

>CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} similar
           to uniprot|P35187 Saccharomyces cerevisiae YMR190c SGS1
           DNA helicase
          Length = 1371

 Score = 30.8 bits (68), Expect = 2.3,   Method: Composition-based stats.
 Identities = 34/161 (21%), Positives = 71/161 (44%), Gaps = 14/161 (8%)

Query: 11  PLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPWAETSRSEVEP 70
           P IK    E+ K+     TL  ++ ++ H L    D     V    +S   ++ R+ +  
Sbjct: 217 PKIKSKQSEIEKMELKLETLSQEIKNISHILS---DISNENVFKNIKSQKFDSQRASITA 273

Query: 71  TFFIPD-----SFTHIPDVLQSNTKDTPPSFDSVQKDQQ-RVALFQDETLFYLFYKHPGT 124
              + D      F +  ++ ++N    P   +SV + QQ  ++ FQ+E+L+   Y  P T
Sbjct: 274 NNSLTDLQINEGFNN--NITKNNRDFNPIPDNSVIRGQQVNMSSFQEESLYIDSYNEPNT 331

Query: 125 VIQELTYLELRKR---NWRYHKTLKAWLTKDPMMEPVVSND 162
             +     ++R R   N+R  +  + +  +   ++P +++D
Sbjct: 332 QSRAPYTRQMRDRHQINYRIPEADEPFEYRVGKLQPTIASD 372

>KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q75AN0 Ashbya gossypii ADL108C ADL108Cp and
           some similarites with YIL038C uniprot|P06102
           Saccharomyces cerevisiae YIL038C NOT3 Subunit of the
           CCR4- NOT complex which is a global transcriptional
           regulator with roles in transcription initiation and
           elongation and in mRNA degradation
          Length = 758

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 3/66 (4%)

Query: 113 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVF 172
           TLFY +Y     + Q +  L L++R WR  KT   W  +   ++   SND   E   Y  
Sbjct: 641 TLFYHYYFSVTPLEQRICALLLKQREWRVLKTGDCWFLRQGAVK--FSNDQ-CEVADYKI 697

Query: 173 FDPQRW 178
           F    W
Sbjct: 698 FKMDIW 703

>NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {ON}
           Anc_7.214
          Length = 846

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 44/106 (41%), Gaps = 13/106 (12%)

Query: 83  DVLQSNTKDTPPSFDSVQKDQQRVALFQDE----------TLFYLFYKHPGTVIQELTYL 132
           D+++ + +D   SFD+ + +     L+ +           TLFY +Y     + +E+  +
Sbjct: 679 DIIRCSLRDILDSFDAEKDNYDNSQLYNEILEKFRGLEMFTLFYNYYFAVTPLEKEIANV 738

Query: 133 ELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRW 178
            L +RNW+       W  +     P+   + L E G Y  F    W
Sbjct: 739 ILNERNWKVSFDETMWFLR---QGPIKFQNELCELGDYKIFKLDEW 781

>TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa]
           {ON} Anc_7.214 YIL038C
          Length = 847

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 8/93 (8%)

Query: 86  QSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTL 145
           Q+N+K+     D ++K  ++    +  TLFY +Y     + +E++ + L +R+WR     
Sbjct: 703 QANSKE-----DKLKKILEKFRSLETFTLFYNYYFSVTPLEKEVSMVVLAERDWRITNNE 757

Query: 146 KAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRW 178
             W ++    E  +S D L E G Y  F  + W
Sbjct: 758 TMWFSR--QGEAKLS-DELYEIGDYRIFSLEDW 787

>AGL147C Chr7 complement(420751..426441) [5691 bp, 1896 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR170C
            (SEC7)
          Length = 1896

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 7/92 (7%)

Query: 23   IYDHSMTLGADLTSMLHSLGI-PRDSKRHRVLDTFQSPWAETSRSEVEPTFFIPDSFTHI 81
            I   S TL +    +L SL +  R SK   VL T+Q    +  +   E  F   D+F  +
Sbjct: 1345 ILVKSTTLKSGWKPILESLQLCARSSKESIVLKTYQLITVDVMKDHFESVFVQEDAFIEL 1404

Query: 82   PDVLQSNTKD------TPPSFDSVQKDQQRVA 107
              VL+  TK+      +  S  S++K  Q+VA
Sbjct: 1405 VGVLREITKNRKYQKLSLHSLKSLKKIYQKVA 1436

>NDAI0C06010 Chr3 (1378818..1381862) [3045 bp, 1014 aa] {ON}
           Anc_8.210 YER157W
          Length = 1014

 Score = 28.9 bits (63), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 39/98 (39%), Gaps = 6/98 (6%)

Query: 40  SLGIPRDSKRHRVLDTFQSPWAETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSV 99
           S+ I RD +     D  Q    E      +P     +S   I D L  N KD   +F+S 
Sbjct: 837 SVSIGRDERLTLDHDRSQRGLNENIGPNDKPILNSTNSTHEIIDDLTGNLKDKESNFESQ 896

Query: 100 QKDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKR 137
           Q D Q++ L   +T      K+PG   Q +  + +   
Sbjct: 897 QMDDQQLPLSDSQT------KNPGNEEQNIKEISMENN 928

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,311,322
Number of extensions: 952815
Number of successful extensions: 2592
Number of sequences better than 10.0: 60
Number of HSP's gapped: 2562
Number of HSP's successfully gapped: 61
Length of query: 193
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 89
Effective length of database: 41,556,135
Effective search space: 3698496015
Effective search space used: 3698496015
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)