Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A019107.348ON2141959621e-133
NCAS0A141407.348ON2241887891e-107
KAFR0B008607.348ON2281877551e-102
TPHA0F029507.348ON2161847501e-101
SAKL0F11330g7.348ON2081907481e-101
Kpol_530.337.348ON1951827441e-100
TDEL0C020007.348ON2131857441e-100
ZYRO0F11660g7.348ON1981827093e-95
KLLA0D12386g7.348ON2111797078e-95
Smik_4.727.348ON1971837008e-94
YDL166C (FAP7)7.348ON1971836972e-93
KNAG0C037707.348ON2231836941e-92
Ecym_47257.348ON2341836924e-92
TBLA0E005207.348ON2091816843e-91
Suva_4.807.348ON2061836824e-91
ACL150W7.348ON2191806836e-91
Skud_4.917.348ON1941846702e-89
Kwal_56.246357.348ON2261856681e-88
CAGL0I03366g7.348ON2121886618e-88
KLTH0H01298g7.348ON2141816602e-87
YML065W (ORC1)4.327ON91452800.10
KNAG0G018808.236ON22549740.35
NDAI0C051708.478ON19061730.44
Suva_13.924.327ON92352740.47
Smik_13.794.327ON93952740.59
TBLA0C004808.101ON36026720.79
KAFR0C037902.667ON202140701.2
Skud_13.794.327ON92552711.3
KAFR0B025608.236ON23436691.4
Kpol_467.98.101ON35935691.6
TPHA0I018208.558ON55935682.7
CAGL0A04477g7.390ON77072683.2
KLTH0B07634g2.48ON78945674.1
ZYRO0F04752g8.101ON37526664.2
KAFR0J005705.165ON60288657.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A01910
         (214 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   375   e-133
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   308   e-107
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   295   e-102
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   293   e-101
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   292   e-101
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   291   e-100
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   291   e-100
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   277   3e-95
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   276   8e-95
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   274   8e-94
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   273   2e-93
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   271   1e-92
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   271   4e-92
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   268   3e-91
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   267   4e-91
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   267   6e-91
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   262   2e-89
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   261   1e-88
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   259   8e-88
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   258   2e-87
YML065W Chr13 (142210..144954) [2745 bp, 914 aa] {ON}  ORC1Large...    35   0.10 
KNAG0G01880 Chr7 (420542..421219) [678 bp, 225 aa] {ON} Anc_8.23...    33   0.35 
NDAI0C05170 Chr3 complement(1201173..1201745) [573 bp, 190 aa] {...    33   0.44 
Suva_13.92 Chr13 (144893..147664) [2772 bp, 923 aa] {ON} YML065W...    33   0.47 
Smik_13.79 Chr13 (139688..142507) [2820 bp, 939 aa] {ON} YML065W...    33   0.59 
TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101...    32   0.79 
KAFR0C03790 Chr3 complement(771996..772604) [609 bp, 202 aa] {ON...    32   1.2  
Skud_13.79 Chr13 (140322..143099) [2778 bp, 925 aa] {ON} YML065W...    32   1.3  
KAFR0B02560 Chr2 (510628..511332) [705 bp, 234 aa] {ON} Anc_8.23...    31   1.4  
Kpol_467.9 s467 complement(23151..24230) [1080 bp, 359 aa] {ON} ...    31   1.6  
TPHA0I01820 Chr9 (404763..406295,406384..406530) [1680 bp, 559 a...    31   2.7  
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    31   3.2  
KLTH0B07634g Chr2 (618664..621033) [2370 bp, 789 aa] {ON} simila...    30   4.1  
ZYRO0F04752g Chr6 complement(396614..397741) [1128 bp, 375 aa] {...    30   4.2  
KAFR0J00570 Chr10 complement(97155..98963) [1809 bp, 602 aa] {ON...    30   7.2  

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  375 bits (962), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 182/195 (93%)

Query: 1   MTTDNSRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRK 60
           MTTDNSRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRK
Sbjct: 1   MTTDNSRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRK 60

Query: 61  SHIVXXXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYH 120
           SHIV             RKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYH
Sbjct: 61  SHIVDEDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYH 120

Query: 121 DSKIQENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKN 180
           DSKIQENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKN
Sbjct: 121 DSKIQENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKN 180

Query: 181 GVTNELQGKNKNAQN 195
           GVTNELQGKNKNAQN
Sbjct: 181 GVTNELQGKNKNAQN 195

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  308 bits (789), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 142/188 (75%), Positives = 165/188 (87%)

Query: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVX 65
           SRRY+PNLLITGTPG GKSTTCELLQRRLPEY YYNISDFAKE+DCY+GYDKGRKSHIV 
Sbjct: 4   SRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVD 63

Query: 66  XXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125
                       R+GKSI+DWHVND+FPERLIDLV VLRCDNS+LYDRL+ R YHD+KI+
Sbjct: 64  EDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIE 123

Query: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185
           EN+DAEIMGVVLQDA+ESY +EIVVELQSD TEQM+ANV+RIV+W KMW++QH++GVTNE
Sbjct: 124 ENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNE 183

Query: 186 LQGKNKNA 193
           L+ K +N+
Sbjct: 184 LEDKQRNS 191

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  295 bits (755), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 136/187 (72%), Positives = 160/187 (85%)

Query: 3   TDNSRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSH 62
           T  SRRY PNLL+TGTPG GKSTTCELL RRLP+Y Y+NIS+FA+++ CY+GYD+ RKSH
Sbjct: 5   TKESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSH 64

Query: 63  IVXXXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDS 122
           IV             R+GKSI+DWHVND+FPERLIDLVVVLRCDNSIL+DRL+ RGYH+S
Sbjct: 65  IVDDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHES 124

Query: 123 KIQENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGV 182
           KIQENLDAEIMGVVLQDA++SY+QEIVVELQS+ TE+M+ANVERIV W +MW+ QHKNGV
Sbjct: 125 KIQENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGV 184

Query: 183 TNELQGK 189
           TNE QG+
Sbjct: 185 TNEYQGE 191

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  293 bits (750), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 139/184 (75%), Positives = 156/184 (84%)

Query: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVX 65
           SRRY+PNLLITGTPG GKSTTCELLQRRL +Y YYNISDFAKE++CY+G+D+GRKSHIV 
Sbjct: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVD 61

Query: 66  XXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125
                       RKGK IVDWHVND+FPERLIDLVVVLRCDNS+LYDRL  RGYHDSKI 
Sbjct: 62  EDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121

Query: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185
           EN+DAEIMGVVLQDA ESY QEIVVELQSD TEQM+ NV++IV+W ++W+ QHKNGVTNE
Sbjct: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNE 181

Query: 186 LQGK 189
           L  K
Sbjct: 182 LSKK 185

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  292 bits (748), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 159/190 (83%)

Query: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVX 65
           ++R  PN+L+TGTPG GKSTTCELL RRL +Y YYNISDFA+E+ CY+GYD+ RKSHIV 
Sbjct: 3   TKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHIVD 62

Query: 66  XXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125
                       RKGKSIVDWHVND+FPERLIDLVVVLRCDNSILYDRL+KRGYHDSKI+
Sbjct: 63  EDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSKIE 122

Query: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185
           ENLDAEIMGVV+QDA ESY QEIVVELQSD  E M+ANV+RIVEW +MW++QH NGVTNE
Sbjct: 123 ENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVTNE 182

Query: 186 LQGKNKNAQN 195
           L+ ++ NA +
Sbjct: 183 LEPESDNASD 192

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  291 bits (744), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 140/182 (76%), Positives = 155/182 (85%)

Query: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVX 65
           SRR +PNLLITGTPG GKST+CELLQRRL +Y YYNISDFAKE+DCYEGYD+ RKSHIV 
Sbjct: 3   SRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHIVD 62

Query: 66  XXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125
                       R+G SIVDWHVND+FPERLIDLVVVLRCDNSILYDRL+ R YHDSKIQ
Sbjct: 63  EDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSKIQ 122

Query: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185
           ENLDAEIMGVVLQDA ESY +EIVVELQSD TEQMEANV+RIV+W ++W+ QHK GVTNE
Sbjct: 123 ENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVTNE 182

Query: 186 LQ 187
           L+
Sbjct: 183 LE 184

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  291 bits (744), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 136/185 (73%), Positives = 156/185 (84%)

Query: 7   RRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVXX 66
           RR++PNLLITGTPG GKSTTCELLQRRLP+Y YYNISDFAKE+DC++GYD+ RKS+IV  
Sbjct: 4   RRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYIVDE 63

Query: 67  XXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQE 126
                      R+G +IVDWHVND+FPERLIDLVVVLRCDN+ILYDRL  R YHD+KIQE
Sbjct: 64  DKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAKIQE 123

Query: 127 NLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNEL 186
           NLDAEIMGVVLQDA +SY+QEIVVELQSD TEQMEANV+RIV W K+W+ QHK+G TNEL
Sbjct: 124 NLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQTNEL 183

Query: 187 QGKNK 191
             + K
Sbjct: 184 LERTK 188

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  277 bits (709), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 129/182 (70%), Positives = 152/182 (83%)

Query: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVX 65
           SRRY PN+LITGTPGSGKSTT ELLQRRL ++ YYNISDFA+ENDC++GYD+GRKSHIV 
Sbjct: 3   SRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHIVD 62

Query: 66  XXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125
                       RKG +I+DWHVND+FPERLIDLVVVLRC+NSIL+ RL KRGYH +KI 
Sbjct: 63  EDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTKID 122

Query: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185
           EN+DAEIMGVV+QDA++SY++EIVVEL SD TEQME NV+RIV W ++W DQH +GVTNE
Sbjct: 123 ENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVTNE 182

Query: 186 LQ 187
           L 
Sbjct: 183 LH 184

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  276 bits (707), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 150/179 (83%)

Query: 8   RYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVXXX 67
           R++PN++++GTPG GKSTTCELL RRLPEY YYNISDFAKE+DCY+GYD  RKS+IV   
Sbjct: 5   RFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNIVDDD 64

Query: 68  XXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQEN 127
                     RKG  I+DWHVND+FPERL+DLVVVLRCDN ILYDRLNKRGYH++KI+EN
Sbjct: 65  KLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAKIEEN 124

Query: 128 LDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNEL 186
           +DAEIMGVVLQDA +SY QEIVVELQSD TE+M+ NV+RI+ W ++W+ QHK GVTNEL
Sbjct: 125 MDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVTNEL 183

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  274 bits (700), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 148/183 (80%)

Query: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVX 65
           SRRY PN+++TGTPG GKS+ CELL+ +L +Y YYNISDFAK++DC+EGYD+GRKSHIV 
Sbjct: 3   SRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHIVD 62

Query: 66  XXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125
                       R+G SIVDWHVNDIFPERLIDLVVVLRCDNS LY RL+ RGYHDSKI+
Sbjct: 63  EDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSKIE 122

Query: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185
           ENLDAEIMGVV QDAVESY+  IVVELQSD  E ME+NV RI+ W KMW++QH  GVTNE
Sbjct: 123 ENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVTNE 182

Query: 186 LQG 188
            QG
Sbjct: 183 YQG 185

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  273 bits (697), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 128/183 (69%), Positives = 148/183 (80%)

Query: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVX 65
           +RRY PN+++TGTPG GKS+TCE L+ +L +Y YYNISDFAK+NDC+EGYD+GRKSHIV 
Sbjct: 3   ARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHIVD 62

Query: 66  XXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125
                       R+G SIVDWHVND+FPERLIDLVVVLRCDNS LY RL+ RGYHDSKI+
Sbjct: 63  EDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKIE 122

Query: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185
           ENLDAEIMGVV QDAVESY+  IVVELQSD  E M +NV RIV W KMW++QH +GVTNE
Sbjct: 123 ENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVTNE 182

Query: 186 LQG 188
            QG
Sbjct: 183 YQG 185

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  271 bits (694), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 124/183 (67%), Positives = 146/183 (79%)

Query: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVX 65
           SRR  PN+L+TGTPG+GKSTTCELL R LP+Y YYNISDFA +N CY+GYD+ RKSHIV 
Sbjct: 4   SRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIVD 63

Query: 66  XXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125
                         G +I+DWHVND+FPERLIDLV VLRCD+S+L+DRLNKR YH SKI 
Sbjct: 64  EDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKID 123

Query: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185
           EN+DAEIMGVVLQDA++SY+++IVVELQSDDTEQM ANV+R+V W  MW +QH  GVTNE
Sbjct: 124 ENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTNE 183

Query: 186 LQG 188
           L  
Sbjct: 184 LSA 186

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  271 bits (692), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 147/183 (80%)

Query: 5   NSRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIV 64
           +S R  PN+++TGTPG GK+TTCELLQRRL +  YYNISDFAKE+DCYEGYD+GRKSHIV
Sbjct: 16  DSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHIV 75

Query: 65  XXXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKI 124
                        RKG +I+DWHVND+FPERLIDLVVVLRCDNS LYDRL+KRGYHD+KI
Sbjct: 76  DEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAKI 135

Query: 125 QENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTN 184
           +EN+DAEIMGVVLQDA++SY  +IVVELQS+   QME NV RIV W   W+ QH  GVTN
Sbjct: 136 EENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVTN 195

Query: 185 ELQ 187
           ELQ
Sbjct: 196 ELQ 198

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  268 bits (684), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 124/181 (68%), Positives = 150/181 (82%)

Query: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVX 65
           SRRY PNLLI+GTPG+GKS+TCELL+R L +Y Y NISDFAKE +CY+G+DKGRKSHIV 
Sbjct: 3   SRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHIVD 62

Query: 66  XXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125
                       R+G +IVDWHVND+FPERLIDLVV+LR DNS+LYDRL  R YHD+K+Q
Sbjct: 63  EDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAKVQ 122

Query: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185
           ENLDAEIMGVVLQDA++SY QEIV+ELQS++TE+M +NV+RIV W ++W  QH +GVTNE
Sbjct: 123 ENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVTNE 182

Query: 186 L 186
           L
Sbjct: 183 L 183

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  267 bits (682), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 146/183 (79%)

Query: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVX 65
           SRRY PN+++TGTPG GKS+TCELL+  L  Y YYNISDFAK+NDC+EGYD+GRKSHIV 
Sbjct: 3   SRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHIVD 62

Query: 66  XXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125
                       R+G SI+DWHVND+FPERLIDLVVVLRCDNS LY RL+ RGYHDSKI+
Sbjct: 63  EDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSKIE 122

Query: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185
           ENLDAEIMGVV QDAV+SY+  IVVELQSD  + + +NV RI+ W KMW++QH  GVTNE
Sbjct: 123 ENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVTNE 182

Query: 186 LQG 188
            QG
Sbjct: 183 YQG 185

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  267 bits (683), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 148/180 (82%)

Query: 8   RYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVXXX 67
           R  PN+L++GTPG GKSTTCELLQR LP+Y Y+NISDFA+E++CY+GYD+ RKSHIV   
Sbjct: 5   RCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHIVDED 64

Query: 68  XXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQEN 127
                     R+G +IVDWHVNDIFPERLIDLVVVLRCDN+IL+DRL KRGYH SKI+EN
Sbjct: 65  RLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSKIEEN 124

Query: 128 LDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNELQ 187
           +DAEIMGVVLQDA++SY +EIVVELQSDDTEQM+ NV+RI  W   W+ +H +GV+N LQ
Sbjct: 125 IDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVSNALQ 184

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  262 bits (670), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 123/184 (66%), Positives = 144/184 (78%)

Query: 7   RRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVXX 66
           RR+ PN+++TGTPG GKS+TCELL+  L  Y YYNISDFAK+NDC+E YD+ RKSHIV  
Sbjct: 4   RRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHIVDE 63

Query: 67  XXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQE 126
                      R+G SI+DWHVND+FPERLIDLVVVLRCDNS LY RL+ RGYHDSKI+E
Sbjct: 64  DKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKIEE 123

Query: 127 NLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNEL 186
           NLDAEIMGVV QDAV+SY+  IVVELQ D  E M +NV RIV W KMW++QH +GVTNE 
Sbjct: 124 NLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVTNEY 183

Query: 187 QGKN 190
           QG +
Sbjct: 184 QGPH 187

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  261 bits (668), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 143/185 (77%)

Query: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVX 65
           S R  PN+L+TGTPG GK++TCELLQRRL    YYNISDFAKE  CY+GYD+ RKSHIV 
Sbjct: 3   STRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHIVD 62

Query: 66  XXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125
                       R G +IVDWHVND+FPERLIDLVVVLR DNS L+DRL+KRGYH++KIQ
Sbjct: 63  EDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAKIQ 122

Query: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185
           EN+DAEIMGVV+ DA +SY QEIVVELQSD TEQM+ NV+RIV W   W +QH  GVTNE
Sbjct: 123 ENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVTNE 182

Query: 186 LQGKN 190
           L G +
Sbjct: 183 LNGAD 187

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  259 bits (661), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 149/188 (79%)

Query: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVX 65
           SRR+ PN+++TGTPG GKSTTCELLQRRL  Y YYNIS+FA+E+ CY+GYD+GRKSHIV 
Sbjct: 3   SRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHIVD 62

Query: 66  XXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125
                        +GKSI+DWHVND+FPERLIDLVVVLR +N  LYDRL  RGYHDSKI+
Sbjct: 63  EDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSKIE 122

Query: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185
           ENLDAEIMGVVLQDA ESY+ EIVVELQS+ TE ME NV+RI  W   W+++HK+GV++E
Sbjct: 123 ENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVSSE 182

Query: 186 LQGKNKNA 193
           L+   K A
Sbjct: 183 LKDGKKYA 190

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  258 bits (660), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 146/181 (80%)

Query: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVX 65
           S R+ PN+L+TGTPG GK++TCELLQRRL +  YYNISDFA++++CY+GYD+ RKSHIV 
Sbjct: 3   STRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHIVD 62

Query: 66  XXXXXXXXXXXXRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125
                       RKG +IVDWHVNDIFPERLIDLVVVLR DN++LYDRL  RGYH++KIQ
Sbjct: 63  EDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAKIQ 122

Query: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185
           EN+DAEIMGVV+QDA +SY++EIVVELQSD  +QM+ NV+RI  W   W++Q+  GVTNE
Sbjct: 123 ENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVTNE 182

Query: 186 L 186
           L
Sbjct: 183 L 183

>YML065W Chr13 (142210..144954) [2745 bp, 914 aa] {ON}  ORC1Largest
           subunit of the origin recognition complex, which directs
           DNA replication by binding to replication origins and is
           also involved in transcriptional silencing; exhibits
           ATPase activity
          Length = 914

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 11/52 (21%)

Query: 13  LLITGTPGSGKSTTC-----ELL----QRRLPEYAYYNISDF--AKENDCYE 53
           + + GTPG GK+ T      ELL    QR +P++ Y  I+     K  DCYE
Sbjct: 475 IYVAGTPGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYE 526

>KNAG0G01880 Chr7 (420542..421219) [678 bp, 225 aa] {ON} Anc_8.236
          YER170W
          Length = 225

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 13 LLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKS 61
          LL+ G PG+GK T  + L +R PE    +  D  ++N   EG   G+ +
Sbjct: 10 LLLLGAPGAGKGTQTKRLIKRFPEIKAISSGDLLRKN-IQEGTPLGQTA 57

>NDAI0C05170 Chr3 complement(1201173..1201745) [573 bp, 190 aa]
          {ON} Anc_8.478 YDR248C
          Length = 190

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 2  TTDNSRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKS 61
          TTD+S + E  +++ GT G+GKST  +L+ R   +   +   +F + +D +   +  + S
Sbjct: 3  TTDSSTQREKIIVLAGTAGTGKSTIADLILRTFKK--DFPKLEFVEGDDLHPAANVEKMS 60

Query: 62 H 62
          H
Sbjct: 61 H 61

>Suva_13.92 Chr13 (144893..147664) [2772 bp, 923 aa] {ON} YML065W
           (REAL)
          Length = 923

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 11/52 (21%)

Query: 13  LLITGTPGSGKSTTC-----ELL----QRRLPEYAYYNISDF--AKENDCYE 53
           + + GTPG GK+ T      EL+    Q+ LP++ Y  I+     K  DCYE
Sbjct: 485 IYVAGTPGVGKTLTVREVVKELISSSAQQELPDFLYVEINGLKMVKPTDCYE 536

>Smik_13.79 Chr13 (139688..142507) [2820 bp, 939 aa] {ON} YML065W
           (REAL)
          Length = 939

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 11/52 (21%)

Query: 13  LLITGTPGSGKSTTC-----ELL----QRRLPEYAYYNISDF--AKENDCYE 53
           + + GTPG GK+ T      ELL    Q+ +P++ Y  I+     K  DCYE
Sbjct: 503 IYVAGTPGVGKTLTVREVVKELLSSSTQQEIPDFLYVEINGLKMVKPTDCYE 554

>TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101
          YFR007W
          Length = 360

 Score = 32.3 bits (72), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 16/26 (61%)

Query: 9  YEPNLLITGTPGSGKSTTCELLQRRL 34
          Y  N++I G PGSGKST  E L   L
Sbjct: 23 YTINIIIVGPPGSGKSTIAEKLSANL 48

>KAFR0C03790 Chr3 complement(771996..772604) [609 bp, 202 aa] {ON}
           Anc_2.667 YKL024C possible ribosomal frameshifting
          Length = 202

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/140 (20%), Positives = 58/140 (41%), Gaps = 25/140 (17%)

Query: 13  LLITGTPGSGKSTTCELLQRRLPEYAYYNIS--DFAKENDCYEGYDKGR--KSHIVXXXX 68
           + + G PG+GK T C  L   + +Y + ++S  D  +     EG + G   K++I     
Sbjct: 15  IFVLGGPGAGKGTQCAKL---VKDYGFVHLSAGDLLRAEQDREGSEFGSLIKNYIKEGLI 71

Query: 69  XXXXXXXXXRKGKSIVDW------HVNDIFPERL------------IDLVVVLRCDNSIL 110
                     K   + ++      ++ D FP ++               V+   C  +++
Sbjct: 72  VPQEITIQLLKNAILENYEKGSTKYLVDGFPRKMDQAITFEQVIVKAKFVLFFDCSETVM 131

Query: 111 YDRLNKRGYHDSKIQENLDA 130
            +RL +RG    +I +N+++
Sbjct: 132 LERLLERGKSSGRIDDNIES 151

>Skud_13.79 Chr13 (140322..143099) [2778 bp, 925 aa] {ON} YML065W
           (REAL)
          Length = 925

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 11/52 (21%)

Query: 13  LLITGTPGSGKSTTC-----ELL----QRRLPEYAYYNISDF--AKENDCYE 53
           + + GTPG GK+ T      EL+    Q+ +P++ Y  I+     K  DCYE
Sbjct: 487 IYVAGTPGVGKTLTVREVVKELVSSSAQQEIPDFLYVEINGLKMVKPTDCYE 538

>KAFR0B02560 Chr2 (510628..511332) [705 bp, 234 aa] {ON} Anc_8.236
          YER170W
          Length = 234

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 13 LLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKE 48
          LL+ G PGSGK T  + L++ LP     +  D  +E
Sbjct: 10 LLLLGAPGSGKGTQTKKLKKLLPNILAISSGDLLRE 45

>Kpol_467.9 s467 complement(23151..24230) [1080 bp, 359 aa] {ON}
          complement(23151..24230) [1080 nt, 360 aa]
          Length = 359

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 4/35 (11%)

Query: 7  RRYEPNLLITGTPGSGKSTT----CELLQRRLPEY 37
          + Y  +L+I G PGSGKST     CE L     EY
Sbjct: 21 KNYRISLVIVGPPGSGKSTIANELCERLNSMFHEY 55

>TPHA0I01820 Chr9 (404763..406295,406384..406530) [1680 bp, 559 aa]
           {ON} Anc_8.558 YBR186W
          Length = 559

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 3/35 (8%)

Query: 1   MTTDNSRRYEPNLLITGTPGSGKSTTCELLQRRLP 35
           +T +NS R    +L+ G PG+GK+T C+ L +++ 
Sbjct: 296 LTNNNSNRL---ILLHGPPGTGKTTLCKALFQKIS 327

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 78  RKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKI--QENLDAEIMGV 135
           R+    V   V+DIF   L + +  L CDN+   D      + D  I  QEN+D +I   
Sbjct: 475 RRNSGTVKNFVSDIFQGTLTNRIKCLTCDNTTARD----EPFLDFPIEVQENVDIDI--- 527

Query: 136 VLQDAVESYQQE 147
             Q+ +ES+ Q+
Sbjct: 528 --QEILESFHQK 537

>KLTH0B07634g Chr2 (618664..621033) [2370 bp, 789 aa] {ON} similar
           to uniprot|P40164 Saccharomyces cerevisiae YNL201C PSY2
           Nuclear protein of unknown function deletion results in
           sensitivity to anticancer drugs oxaliplatin and
           cisplatin but not mitomycin C deletion is synthetically
           lethal with a chitin synthase (CHS1) null mutant
          Length = 789

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 3/45 (6%)

Query: 93  PERLIDL-VVVLRCDNSILYDRLNKRGYHDSKIQENLDAEIMGVV 136
           P+R++ L + V+RC  SI+   LN   YH   I ENL A +M ++
Sbjct: 607 PQRMLQLRLTVVRCLKSIVC--LNDEFYHRYLISENLYAPVMDLL 649

>ZYRO0F04752g Chr6 complement(396614..397741) [1128 bp, 375 aa]
          {ON} similar to uniprot|P43591 Saccharomyces cerevisiae
          YFR007W Hypothetical ORF
          Length = 375

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 9  YEPNLLITGTPGSGKSTTCELLQRRL 34
          Y   +LI G PGSGKST  + L R++
Sbjct: 58 YRVCILIVGPPGSGKSTVAQDLSRQI 83

>KAFR0J00570 Chr10 complement(97155..98963) [1809 bp, 602 aa] {ON}
           Anc_5.165 YJL019W
          Length = 602

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 14/88 (15%)

Query: 110 LYDRLNKRGYHDSKIQENLDAEIMGVV----------LQDAVESYQQEI-VVELQSDDTE 158
           LY+ LN R   D K +  LD ++  V+          L   V +YQ EI  +  + +   
Sbjct: 155 LYNELNSR---DLKQKNELDNKLKIVISQFEKNIKKLLPSNVLNYQSEIDKLNKKVNSLS 211

Query: 159 QMEANVERIVEWHKMWMDQHKNGVTNEL 186
           Q E  +E + EW K  ++Q K  + NE+
Sbjct: 212 QQEVTLENVTEWQKELINQLKENLPNEI 239

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,481,798
Number of extensions: 857651
Number of successful extensions: 3124
Number of sequences better than 10.0: 53
Number of HSP's gapped: 3118
Number of HSP's successfully gapped: 53
Length of query: 214
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 109
Effective length of database: 41,441,469
Effective search space: 4517120121
Effective search space used: 4517120121
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)