Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A019007.349ON56556525460.0
ZYRO0F11682g7.349ON59752010331e-133
TDEL0C019907.349ON60651210281e-132
NCAS0A141507.349ON57050810211e-132
KAFR0B008707.349ON5425139081e-115
Smik_4.717.349ON7593869201e-114
YDL167C (NRP1)7.349ON7193839041e-112
Suva_4.797.349ON7083849031e-112
Skud_4.907.349ON7073868941e-111
Kwal_56.246387.349ON5273708301e-103
SAKL0F11352g7.349ON5833628181e-101
KNAG0C037807.349ON5383718121e-101
KLTH0H01276g7.349ON5574098041e-99
TBLA0E020607.349ON5643607929e-98
ACL149W7.349ON6283607873e-96
Kpol_530.327.349ON6844097704e-93
TPHA0F029607.349ON6543887529e-91
KLLA0D12364g7.349ON6313947255e-87
CAGL0I03344g7.349ON6033966414e-75
KLLA0E11045g8.822ON43291761.2
TDEL0B007508.822ON41892723.3
Ecym_11698.537ON55457707.0
Suva_13.1305.570ON84473698.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A01900
         (565 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {O...   985   0.0  
ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some s...   402   e-133
TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {O...   400   e-132
NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON} Anc_7...   397   e-132
KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.3...   354   e-115
Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}...   358   e-114
YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}  ...   352   e-112
Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}...   352   e-112
Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}...   348   e-111
Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL1...   324   e-103
SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some s...   319   e-101
KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.3...   317   e-101
KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {...   314   1e-99
TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.3...   309   9e-98
ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homo...   307   3e-96
Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}...   301   4e-93
TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.3...   294   9e-91
KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]...   283   5e-87
CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {...   251   4e-75
KLLA0E11045g Chr5 (968674..969972) [1299 bp, 432 aa] {ON} simila...    34   1.2  
TDEL0B00750 Chr2 (139060..140316) [1257 bp, 418 aa] {ON} Anc_8.8...    32   3.3  
Ecym_1169 Chr1 (344690..346354) [1665 bp, 554 aa] {ON} similar t...    32   7.0  
Suva_13.130 Chr13 (207349..209883) [2535 bp, 844 aa] {ON} YML029...    31   8.4  

>NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {ON}
           Anc_7.349 YDL167C
          Length = 565

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/565 (86%), Positives = 486/565 (86%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60
           MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA
Sbjct: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60

Query: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120
           LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK
Sbjct: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120

Query: 121 KFCANHPELDLNEEMVTSKDVAILTDILGLQSNNTENYTIDISTDVLLSLYKKCSSSEDI 180
           KFCANHPELDLNEEMVTSKDVAILTDILGLQSNNTENYTIDISTDVLLSLYKKCSSSEDI
Sbjct: 121 KFCANHPELDLNEEMVTSKDVAILTDILGLQSNNTENYTIDISTDVLLSLYKKCSSSEDI 180

Query: 181 KFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICYWTSKTPD 240
           KFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICYWTSKTPD
Sbjct: 181 KFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICYWTSKTPD 240

Query: 241 EYSRNFHNNTYVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQLYPVEHIIEV 300
           EYSRNFHNNTYVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQLYPVEHIIEV
Sbjct: 241 EYSRNFHNNTYVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQLYPVEHIIEV 300

Query: 301 APSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFPAPXXXXXX 360
           APSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFPAP      
Sbjct: 301 APSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFPAPNNSNTN 360

Query: 361 XXXXXXXXXXXXXXXXHTNTSPHSSLQQAVHHSPYQTYNKLNDSVTGSLXXXXXXXXXXX 420
                           HTNTSPHSSLQQAVHHSPYQTYNKLNDSVTGSL           
Sbjct: 361 NTNNGESNNNTQTTGEHTNTSPHSSLQQAVHHSPYQTYNKLNDSVTGSLNQQTYRYSNNN 420

Query: 421 XXXXXXXXXXXFNMPFTSYTGNGSSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPKLSGI 480
                      FNMPFTSYTGNGSSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPKLSGI
Sbjct: 421 NSNIKIHNTANFNMPFTSYTGNGSSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPKLSGI 480

Query: 481 HQXXXXXXXXXXXXXXXXXXXXXXXXKAFGMKNHTNIDKYLKTXXXXXXXXXXXNNEMYT 540
           HQ                        KAFGMKNHTNIDKYLKT           NNEMYT
Sbjct: 481 HQDNNTKNNITNNSNNFGFDNRSRNNKAFGMKNHTNIDKYLKTSSLPSPYMSSSNNEMYT 540

Query: 541 KNEGIIDIGTTNLTNMDNNENVFNM 565
           KNEGIIDIGTTNLTNMDNNENVFNM
Sbjct: 541 KNEGIIDIGTTNLTNMDNNENVFNM 565

>ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 597

 Score =  402 bits (1033), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 218/520 (41%), Positives = 292/520 (56%), Gaps = 41/520 (7%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAIS-NDSENFQD 59
           M+YVVLEVE+ H     KDQ RI  +SYQ VN +   +  Q N      IS NDS N  +
Sbjct: 1   MYYVVLEVETAHLIEIPKDQCRIAKISYQFVNAETLQVHYQENQAPLHIISENDSTNLHE 60

Query: 60  ALVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEF 119
           A+  L+ +I    G   FV+C+LNS  +LRVTL RQA D    LP YL++PK+FDLW E+
Sbjct: 61  AVANLNEEINRIAGDEPFVLCSLNSTWHLRVTLSRQARDQNFALPSYLQHPKIFDLWKEY 120

Query: 120 KKFCANHPEL-----DLNEEMVTSKDVAILTDILGLQSNNTENYTIDISTDVLLSLYKKC 174
           +++C NHPE+     +    M    ++A + DI GL  N++ ++ +  S ++LL L+++C
Sbjct: 121 ERWCVNHPEVMPLRKNGGRRMKDVAELARVLDINGLNFNDS-SFDLSRSVEILLRLHQRC 179

Query: 175 SSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICYW 234
           S+ ED+  VLT PYD  MD++ F +E ++V++++NLPPD TQ+ELE+WF    ++P+ +W
Sbjct: 180 STPEDMAMVLTHPYDSHMDVRNFLQECSKVLYLNNLPPDTTQSELESWFTQFGARPVGFW 239

Query: 235 TSKTPDEYSRNFHNNT------YVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLHM 288
           T K   E + N +NN       YV  Q SI GF++FQTHEEA + L LNG+SI S+  + 
Sbjct: 240 TVKNIVEETSNVNNNWSMNNSPYVEEQDSISGFVVFQTHEEATEVLTLNGRSILSNMANT 299

Query: 289 KQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFR 348
           KQ   VEHI+E+ PSST+VLD  Q+IL PFPQSKNKPR GDWNCPSCGFSNFQRRTACFR
Sbjct: 300 KQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFR 359

Query: 349 CSF----------------------------PAPXXXXXXXXXXXXXXXXXXXXXXHTNT 380
           CSF                            P+P                      +T  
Sbjct: 360 CSFPATTAVQVNTKQYISGGPAANLQNGKITPSPSQTYYPLNVTPTQTVPTPQSRHNTTM 419

Query: 381 SPHSSLQQAVHHSPYQTYNKLNDSVTGSLXXXXXXXXXXXXXXXXXXXXXXFNMPFTSYT 440
           +PH     A+ H         N+                             N  +    
Sbjct: 420 TPHMDQSMAMLHGTGAAGAGGNNYRYPGAQSLNFVANNVNNGNGNGNNNSGSNNRYNGQG 479

Query: 441 GNGSSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPKLSGI 480
             GS+VPFRAGDWKCPSC YHNFAKN+ CLRCG PK++ +
Sbjct: 480 NGGSNVPFRAGDWKCPSCIYHNFAKNVVCLRCGGPKITAV 519

>TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {ON}
           Anc_7.349 YDL167C
          Length = 606

 Score =  400 bits (1028), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 216/512 (42%), Positives = 302/512 (58%), Gaps = 39/512 (7%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAI-SNDSENFQD 59
           MHYVVLEVE+ H     KD  R+  LSYQ ++ +        + +  I++    S +FQ+
Sbjct: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60

Query: 60  ALVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEF 119
           ++ + D D+ + +G++EFV+C+L S  ++RVT+ RQA D G  LP YL++P++FDLW E+
Sbjct: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120

Query: 120 KKFCANHPE-LDLNEEMVTS-KDVAILTDILGLQSNNTENYT----IDISTDVLLSLYKK 173
            ++CANHPE L L +   T  K V   T+IL +   +TE  T    +  + D+LL L ++
Sbjct: 121 DRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEEITEKPVLGYTVDILLQLCER 180

Query: 174 CSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICY 233
           C++ EDI  VL++PYD  +DI+ F +E+++V++++NLPPD TQ+ELE+WF    ++P+ +
Sbjct: 181 CTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVGF 240

Query: 234 WTSKTPDEYSRN------FHNNTYVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLH 287
           WT K   E + N       +N+ YV  Q SI GF++FQTHEEA + L+LNG+SI S+  +
Sbjct: 241 WTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNMAN 300

Query: 288 MKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACF 347
            KQ   VEHI+E+ PSST+VLD  Q+IL PFPQSKNKPR GDWNCPSCGFSNFQRRTACF
Sbjct: 301 TKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACF 360

Query: 348 RCSFPAPXXXXXXXXXXXXXXXXXXXXXXHTNTSPHSSLQQAVHHSPYQTYNKLNDSVTG 407
           RCSFPA                         N          V  SP Q++ ++N  +  
Sbjct: 361 RCSFPAASAVQVNNKQYMNYNGNINSTNQGGNI-----YITKVGGSPTQSHYQINTQLPQ 415

Query: 408 SLXXXXXXXXXXXXXXXXXXXXXXF------NMPFTSYTGN---------------GSSV 446
           +                       F      N P  +Y+ N               GS+V
Sbjct: 416 TQAVRTNANYNDQNSLKHSNSAYRFNGNNGGNSPIMNYSNNRFNGQQVNNSNVNNGGSNV 475

Query: 447 PFRAGDWKCPSCTYHNFAKNIACLRCGDPKLS 478
           PFRAGDWKCP+CTYHNFAKN+ CLRCG  K+S
Sbjct: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAKVS 507

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGIH 481
           R GDW CPSC + NF +  AC RC  P  S + 
Sbjct: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQ 371

>NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON}
           Anc_7.349 YDL167C
          Length = 570

 Score =  397 bits (1021), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 224/508 (44%), Positives = 303/508 (59%), Gaps = 33/508 (6%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60
           M YVVLE+E+ H+  T KD +RI   SYQ +N +  TL A      SI I + +  F+D 
Sbjct: 1   MFYVVLELETSHQVETPKDHSRITKCSYQFINSE--TLQATFEEPKSIDIPDMANAFKDT 58

Query: 61  LVQLDSDIKTTIGQ-NEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEF 119
           + QL++DIK  I   ++FV+C+L S+ ++RVTL RQA D+G  LP YL++P++F+LW EF
Sbjct: 59  ISQLEADIKAEIVDFSDFVLCSLFSVWDIRVTLPRQAHDLGFILPSYLKHPRVFNLWKEF 118

Query: 120 KKFCANHPEL----DLNEEMVTSKDVAILTDILGL------------QSNNTENYTIDIS 163
            K+C NHPE+      N  + + K    ++DI+ +             SN     +I  S
Sbjct: 119 DKWCGNHPEVIPMRKSNLRVKSPKTAGDISDIVNILEIDTSLQVPLSTSNPQTLLSIQDS 178

Query: 164 TDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWF 223
           T++L  L KKC++ +D++ VLT+PYD   DIKTF +E +RV++++NLP D TQ+ELE+WF
Sbjct: 179 TNILTKLRKKCTTLDDVQLVLTRPYDSYADIKTFLQERSRVLYMNNLPSDTTQSELESWF 238

Query: 224 ANHNSKPICYWTSK-TPDEYSR-----NFHNNTYVMNQHSIIGFIIFQTHEEAKQSLLLN 277
               ++PI +WT+K T +E S      + + N  V  Q  + GF++FQ+HEEA ++L+LN
Sbjct: 239 TQFGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQDCVAGFVVFQSHEEATEALVLN 298

Query: 278 GKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGF 337
           G+SI S+  + KQ   VEHI+E+ PSST+VLD  QDIL  FPQSKNKPR GDW+CPSCGF
Sbjct: 299 GRSILSNIANTKQPRVVEHIVEIQPSSTRVLDAGQDILSAFPQSKNKPRPGDWSCPSCGF 358

Query: 338 SNFQRRTACFRCSFPAP---XXXXXXXXXXXXXXXXXXXXXXHTNTSPHSSLQQAVHHSP 394
           SNFQRRTACFRCSFPAP                           +T P     Q+     
Sbjct: 359 SNFQRRTACFRCSFPAPNNNKGLNISGTSNIASTNQMPVVNRIQSTFPIPQSHQSSISQT 418

Query: 395 YQTYNK-LNDSVTGSLXXX---XXXXXXXXXXXXXXXXXXXFNMPFTSYTGNGSSVPFRA 450
           +Q YNK L  S +GS                          F+M     T  GS+VPFRA
Sbjct: 419 FQQYNKPLTPSNSGSRTQNFRHNGSNNTNNNNNNRYNTNSQFSMTSGGIT-TGSNVPFRA 477

Query: 451 GDWKCPSCTYHNFAKNIACLRCGDPKLS 478
           GDWKCPSCTYHNFAKN+ CLRC  PK+S
Sbjct: 478 GDWKCPSCTYHNFAKNVVCLRCRIPKIS 505

>KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.349
           YDL167C
          Length = 542

 Score =  354 bits (908), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 202/513 (39%), Positives = 283/513 (55%), Gaps = 53/513 (10%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60
           M YV+LE+++ H+  T KD TRI  +++Q+VN +   L      V  I I   +E+F+ A
Sbjct: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNAN--ALGEVPTKVDQIVIDEQAESFKAA 58

Query: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120
             +L+  I +    + F++C+L S  ++RVTL RQA D+GV++P +L+YPK+FDL  E++
Sbjct: 59  FEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQ 118

Query: 121 KFCANHPE-LDLNEEMVTSKDVAI---------------LTDILGLQSNN---------T 155
           ++C NHPE +    ++ + K + +               L D+   +  N          
Sbjct: 119 RWCLNHPEVMSWKPKLESDKTINMDKKKLGLLELLTVLGLEDMYNFKEENDGAIDDKMFK 178

Query: 156 ENYTIDISTDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDIT 215
               + IST VLL L  +C++S+D K VLT PYD   D+++F +E +RV++++NLP D T
Sbjct: 179 NERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDTT 238

Query: 216 QNELETWFANHNSKPICYWTSK--TPDEYSR----NFHNNTYVMNQHSIIGFIIFQTHEE 269
           Q+ELE+WF    ++P+ +WT K    D  S     N +N+ YV    SI GF++FQTHEE
Sbjct: 239 QSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHEE 298

Query: 270 AKQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGD 329
           A + L LNG++I S+  + KQ   VEH++E+ PSST VLD   +IL  FPQSKNKPR GD
Sbjct: 299 AIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPGD 358

Query: 330 WNCPSCGFSNFQRRTACFRCSFPAPXXXXXXXXXXXXXXXXXXXXXXHTNTSPHSSLQQA 389
           W+CPSCGFSNFQRRTACFRCSFPAP                      +T  S  ++  +A
Sbjct: 359 WSCPSCGFSNFQRRTACFRCSFPAPSNGHINIKSQNNSHHPEITSEHNTEGSQQNNTNRA 418

Query: 390 VHHSPYQTYNKLNDSVTGSLXXXXXXXXXXXXXXXXXXXXXXFNMPFTSYTGNGSSVPFR 449
                   Y      V GS                        N+PF            R
Sbjct: 419 NASFNNSMYRYNTRYVNGS--------SYNQMNNNNHNNNTGSNIPF------------R 458

Query: 450 AGDWKCPSCTYHNFAKNIACLRCGDPKLSGIHQ 482
           AGDW C SCTYHNFAKN+ CLRCG PK S I+Q
Sbjct: 459 AGDWNCASCTYHNFAKNVLCLRCGGPKTSTIYQ 491

>Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}
           YDL167C (REAL)
          Length = 759

 Score =  358 bits (920), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 255/386 (66%), Gaps = 34/386 (8%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60
           MHYVVLE++  H   + KDQ RI+N++YQ V+ +      + N + +I +  ++ + + A
Sbjct: 1   MHYVVLELQVAHLPNSPKDQCRIVNIAYQFVDAETLACHYENNSLPNIEVDRETRSLETA 60

Query: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120
           ++QLD  I+  +G +EFV+ +L S  ++RVTL RQA D G  L  YL++PKLFDLW EF 
Sbjct: 61  MIQLDKAIQDILGNDEFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKLFDLWKEFD 120

Query: 121 KFCANHPELDLNEEMVTS-------------------KDVAILTDILGLQSNNTENYTI- 160
           ++C NHPE+   E+M T+                   KD+  +  IL + S+  E  ++ 
Sbjct: 121 RWCVNHPEIL--EQMKTASNNNNSGTKGNSGGLAKNAKDLDEMIRILEISSSTEEAVSVP 178

Query: 161 ------DISTDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDI 214
                   +TD+L+ L++KC SSED+KFVLTQPYD   DI+TF +E ++V++++NLPPD 
Sbjct: 179 EEYSLLRRTTDILIHLHRKCCSSEDMKFVLTQPYDSHTDIRTFLQERSKVLYMNNLPPDT 238

Query: 215 TQNELETWFANHNSKPICYWTSKTPDEYSRNFHNNT------YVMNQHSIIGFIIFQTHE 268
           TQ+ELE+WF  +  +P+ +WT K   E + N +NN       YV +Q SI GF++FQTHE
Sbjct: 239 TQSELESWFTQYGVRPVGFWTVKNIVEDTSNINNNWSLNNSPYVEDQDSISGFVVFQTHE 298

Query: 269 EAKQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLG 328
           EA + L LNG+SI S+  + KQ   VEH++E+ PSST VLD  Q+IL PFPQSKNKPR G
Sbjct: 299 EATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPG 358

Query: 329 DWNCPSCGFSNFQRRTACFRCSFPAP 354
           DWNCPSCGFSNFQRRTACFRCSFPAP
Sbjct: 359 DWNCPSCGFSNFQRRTACFRCSFPAP 384

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 28/36 (77%), Positives = 33/36 (91%)

Query: 441 GNGSSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPK 476
           G+GS++PFRAGDWKC +CTYHNFAKN+ CLRCG PK
Sbjct: 613 GSGSNIPFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 648

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 19/33 (57%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGIH 481
           R GDW CPSC + NF +  AC RC  P  S I 
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNIQ 388

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 7/37 (18%)

Query: 316 IPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFP 352
           IPF       R GDW C +C + NF +   C RC  P
Sbjct: 618 IPF-------RAGDWKCSTCTYHNFAKNVVCLRCGGP 647

>YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}
           NRP1Putative RNA binding protein of unknown function;
           localizes to stress granules induced by glucose
           deprivation; predicted to be involved in ribosome
           biogenesis
          Length = 719

 Score =  352 bits (904), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 180/383 (46%), Positives = 253/383 (66%), Gaps = 29/383 (7%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60
           MHYVVLE++  H   T KDQ RI N+++QIVN +       TN + SI ++  +++ + A
Sbjct: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60

Query: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120
           +VQLD DI   IG ++FV+ +L S  ++RVTL RQA D G  L  YL++PK+FDLW EF 
Sbjct: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120

Query: 121 KFCANHPELDLNEEMVT----------------SKDVAILTDILGLQSNNTENYTI---- 160
           ++C NHPE+   ++ ++                +KD+  +  IL +     E  ++    
Sbjct: 121 RWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEIY 180

Query: 161 ---DISTDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQN 217
                +TD+L+ L+KKC+S ED++ VLT+PYD   DI+ F +E++++++++NLPPD TQ+
Sbjct: 181 SLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQS 240

Query: 218 ELETWFANHNSKPICYWTSKTPDEYSRNFHNNT------YVMNQHSIIGFIIFQTHEEAK 271
           ELE+WF  +  +P+ +WT K   E + N +NN       YV +Q SI GF++FQTHEEA 
Sbjct: 241 ELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEAT 300

Query: 272 QSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWN 331
           + L LNG+SI S+  + KQ   VEH++E+ PSST VLD  Q+IL PFPQSKNKPR GDWN
Sbjct: 301 EVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWN 360

Query: 332 CPSCGFSNFQRRTACFRCSFPAP 354
           CPSCGFSNFQRRTACFRCSFPAP
Sbjct: 361 CPSCGFSNFQRRTACFRCSFPAP 383

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (87%), Gaps = 1/40 (2%)

Query: 441 GNGSSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPK-LSG 479
           G GS++PFRAGDWKC +CTYHNFAKN+ CLRCG PK +SG
Sbjct: 573 GCGSNMPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISG 612

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 18/30 (60%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLS 478
           R GDW CPSC + NF +  AC RC  P  S
Sbjct: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPS 384

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352
           R GDW C +C + NF +   C RC  P
Sbjct: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607

>Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}
           YDL167C (REAL)
          Length = 708

 Score =  352 bits (903), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 182/384 (47%), Positives = 254/384 (66%), Gaps = 30/384 (7%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60
           MHYVVLE++  H   + KDQ RI+N++YQIV+ +      +     SI +  + ++ + A
Sbjct: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60

Query: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120
           + QLD DI+  IG ++FV+ +L S  ++RVTL RQA D G  L  YL++P+LFDLW EF+
Sbjct: 61  MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE 120

Query: 121 KFCANHPEL-----------------DLNEEMVTSKDVAILTDILGLQSNNTEN-YTID- 161
           ++C NHPE+                  +   +  +KD+  +  IL + +   E+ + +D 
Sbjct: 121 RWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALDN 180

Query: 162 -----ISTDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQ 216
                 + DVLL L+KKCSS+ED+K VLTQPYD   DI++F +E ++V++++NLPPD TQ
Sbjct: 181 HSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQ 240

Query: 217 NELETWFANHNSKPICYWTSKTPDEYSRNFHNNT------YVMNQHSIIGFIIFQTHEEA 270
           +ELE+WF  + ++P+ +WT K   E + N +NN       YV +Q SI GF++FQTHEEA
Sbjct: 241 SELESWFTQYGARPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEA 300

Query: 271 KQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDW 330
            + L LNG+SI S+  + KQ   VEH++E+ PSST VLD  Q+IL PFPQSKNKPR GDW
Sbjct: 301 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 360

Query: 331 NCPSCGFSNFQRRTACFRCSFPAP 354
           NCPSCGFSNFQRRTACFRCSFPAP
Sbjct: 361 NCPSCGFSNFQRRTACFRCSFPAP 384

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 28/36 (77%), Positives = 33/36 (91%)

Query: 441 GNGSSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPK 476
           G+GS++PFRAGDWKC +CTYHNFAKN+ CLRCG PK
Sbjct: 555 GSGSNIPFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 590

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 18/30 (60%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLS 478
           R GDW CPSC + NF +  AC RC  P  S
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPS 385

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 7/37 (18%)

Query: 316 IPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFP 352
           IPF       R GDW C +C + NF +   C RC  P
Sbjct: 560 IPF-------RAGDWKCSTCTYHNFAKNVVCLRCGGP 589

>Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}
           YDL167C (REAL)
          Length = 707

 Score =  348 bits (894), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 249/386 (64%), Gaps = 33/386 (8%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60
           MHYVVLE++  +   + KDQ RI +++YQIV+ +        + +  I +  ++++ + A
Sbjct: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60

Query: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120
           ++QLD DI   IG +EFV+ +L S  ++RVTL RQA D G  L  YL++P+LFDLW EF 
Sbjct: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120

Query: 121 KFCANHPELDLNEEMVTS-------------------KDVAILTDILGLQSNNT------ 155
           ++C NHPEL L +   TS                   KD   +  IL + + +       
Sbjct: 121 RWCVNHPEL-LEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIP 179

Query: 156 -ENYTIDISTDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDI 214
            E   +  +TD+LL L+KKCSS ED+K VLTQPYD   DI+TF +E ++V++++NLPPD 
Sbjct: 180 EEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDT 239

Query: 215 TQNELETWFANHNSKPICYWTSKTPDEYSRNFHNNT------YVMNQHSIIGFIIFQTHE 268
           TQ+ELE+WF  +  +P+ +WT K   E + N +NN       YV  Q SI GF++FQTHE
Sbjct: 240 TQSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEEQDSISGFVVFQTHE 299

Query: 269 EAKQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLG 328
           EA + L LNG+SI S+  + KQ   VEH++E+ PSST VLD  Q+IL PFPQSKNKPR G
Sbjct: 300 EATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPG 359

Query: 329 DWNCPSCGFSNFQRRTACFRCSFPAP 354
           DWNCPSCGFSNFQRRTACFRCSFPAP
Sbjct: 360 DWNCPSCGFSNFQRRTACFRCSFPAP 385

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 25/31 (80%), Positives = 28/31 (90%)

Query: 446 VPFRAGDWKCPSCTYHNFAKNIACLRCGDPK 476
           +PFRAGDWKC +CTYHNFAKN+ CLRCG PK
Sbjct: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 610

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 19/33 (57%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGIH 481
           R GDW CPSC + NF +  AC RC  P  S I 
Sbjct: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNIQ 389

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 7/37 (18%)

Query: 316 IPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFP 352
           IPF       R GDW C +C + NF +   C RC  P
Sbjct: 580 IPF-------RAGDWKCSTCTYHNFAKNVVCLRCGGP 609

>Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL167C
           (NRP1) - Asparagine-rich protein [contig 161] FULL
          Length = 527

 Score =  324 bits (830), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 171/370 (46%), Positives = 242/370 (65%), Gaps = 21/370 (5%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60
           MHYVVLEV+  H E + KD ++I    YQ ++ ++   + Q N    I + N   + Q+A
Sbjct: 1   MHYVVLEVDLAHREDSPKDWSQIAAFHYQFLDTEELKSVFQEN--KHIVLENGC-SLQEA 57

Query: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120
           + QL+ DI   + +++FV+C+LNS  + RVT+ RQA D    LP +L++P++FDLW E+ 
Sbjct: 58  VSQLEKDIGEHL-KDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPRVFDLWKEYD 116

Query: 121 KFCANHPE-LDL---NEEMVTSKDVAILTDILGLQS-------NNTENYTIDISTDVLLS 169
           ++C NHPE L L   N      KDVA L  +L L S          E   ++ +  ++  
Sbjct: 117 RWCVNHPETLALRRSNSMGKKVKDVAELRSVLELDSATQDSTPGAAEPDALEQTIAIIRQ 176

Query: 170 LYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSK 229
           L+KKC ++ED   VLT PYD  +D++ F +E ++V++++NLPPD TQ+ELE+WF    ++
Sbjct: 177 LHKKCVTAEDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGAR 236

Query: 230 PICYWTSKTPDEYSRNFHNN------TYVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISS 283
           P+ +WT K   E + N +NN      TYV  Q SI GF++FQ+HEEA ++L LNG+SI S
Sbjct: 237 PVGFWTVKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILS 296

Query: 284 STLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRR 343
           +  + KQ   +EHI+EV PSS +VLD  Q+IL PFPQSKNKPR GDWNCPSCGFSNFQRR
Sbjct: 297 NIANTKQPRVIEHIVEVQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRR 356

Query: 344 TACFRCSFPA 353
           T+CFRCSFP+
Sbjct: 357 TSCFRCSFPS 366

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (88%)

Query: 442 NGSSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPK 476
            GS+VPFRAGDWKC +CTYHNFAKN+ CLRCG PK
Sbjct: 448 GGSNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPK 482

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDP 475
           R GDW CPSC + NF +  +C RC  P
Sbjct: 339 RPGDWNCPSCGFSNFQRRTSCFRCSFP 365

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352
           R GDW C +C + NF +   C RC  P
Sbjct: 455 RAGDWKCATCTYHNFAKNVVCLRCGGP 481

>SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 583

 Score =  319 bits (818), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 167/362 (46%), Positives = 233/362 (64%), Gaps = 13/362 (3%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60
           M+YVVLE E+ H E   KD TR+  + YQ ++ D  TL  Q+     I +       ++ 
Sbjct: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSD--TL--QSVFEQPIIVEVGPGQLREQ 56

Query: 61  LVQLDSDI--KTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVE 118
           + QLD  +  K T   +EF + +L+S  ++RVT+ RQA D G  LP YL++PK+FDLW E
Sbjct: 57  VAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKE 116

Query: 119 FKKFCANHPE-LDLNEEMVTSKDVAILTDILGLQSNNTENYTIDISTDVLLSLYKKCSSS 177
           + ++C NHPE L L +     K    L ++  +     + + +D +  +L  L+KKC   
Sbjct: 117 YDRWCVNHPETLPLRKNSNLGKKSRDLPELSRVLEAPLQTFPLDQTIGILSQLHKKCLLP 176

Query: 178 EDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICYWTSK 237
           ED   VLT PYD  +D++TF +E ++V++++NLPPD TQ+ELE+WF    ++P+ +WT K
Sbjct: 177 EDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVK 236

Query: 238 TPDEYSRNFHNNT------YVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQL 291
              E + N +NN       YV  Q SI GF++FQTHEEA ++L LNG+SI S+  + KQ 
Sbjct: 237 NVVEETSNVNNNWSCNNSSYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNMANTKQP 296

Query: 292 YPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSF 351
             VEH++E+ PSST+VLD   ++L PFPQSKNKPR GDWNCPSCGFSNFQRRTACFRCSF
Sbjct: 297 RVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSF 356

Query: 352 PA 353
           PA
Sbjct: 357 PA 358

 Score = 79.7 bits (195), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%)

Query: 437 TSYTGNGSSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPKLSG 479
           T+  G GS+VPFRAGDWKC SCTYHNFAKN+ CLRCG PK  G
Sbjct: 488 TTNNGGGSNVPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVG 530

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGI 480
           R GDW CPSC + NF +  AC RC  P  S +
Sbjct: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAV 362

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352
           R GDW C SC + NF +   C RC  P
Sbjct: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526

>KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.349
           YDL167C
          Length = 538

 Score =  317 bits (812), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 236/371 (63%), Gaps = 19/371 (5%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDD-STLLAQTNPVASIAISNDSENFQD 59
           M YV++E++S     +LKDQT++  L YQI++ D         N +  +A+  +  N QD
Sbjct: 1   MFYVLIELQSEQPRDSLKDQTKLKRLDYQIIDADSLEKRKINGNEIRQLAV--EGSNLQD 58

Query: 60  ALVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEF 119
            ++  + +I + I   EFV+C++ S   LRV L R+A D  V LP  L+YP + DLW EF
Sbjct: 59  TVLLFEKEINSVINGEEFVLCSMFSTWELRVVLPREANDEQVELPTILKYPIVLDLWKEF 118

Query: 120 KKFCANHPEL--DLNEEMVTSKDVAILTDILGLQ-----SNNTENYT---IDISTDVLLS 169
            ++C NHP+    +       K++ ++  +LG++     S N   YT   + I++D+LL 
Sbjct: 119 DRWCTNHPDALQSVKGYNRKCKNLPMVHQVLGVEQRLNESVNANGYTRKEVGITSDILLQ 178

Query: 170 LYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSK 229
           L+KKCSS +D   VLTQPY+ ++D +TF EE++ V++++NLPPD TQ ELETWF    S+
Sbjct: 179 LHKKCSSDDDTNTVLTQPYNSKLDYETFTEEQSTVLYLNNLPPDTTQGELETWFGQFGSR 238

Query: 230 PICYWTSKTPDE------YSRNFHNNTYVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISS 283
           P+ +WT K   E       + N +N+ YV  Q S+ GF  FQT EEA  +L L+G+SI S
Sbjct: 239 PVSFWTFKNIVEDTSNINNNWNLNNSYYVEEQDSVSGFATFQTFEEAFNALKLSGRSILS 298

Query: 284 STLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRR 343
           +  + KQ   VEH++E+ PSS ++L  +++IL  FPQSKNKPR GDWNCPSCGFSNFQRR
Sbjct: 299 NVANTKQPRIVEHVVEIHPSSARILHSSEEILSAFPQSKNKPRPGDWNCPSCGFSNFQRR 358

Query: 344 TACFRCSFPAP 354
           TACFRCSFP P
Sbjct: 359 TACFRCSFPVP 369

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (78%)

Query: 444 SSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPKLSGIH 481
           +++PFRAGDWKC +C YHNFAKNI CLRC  PK S  H
Sbjct: 440 TTIPFRAGDWKCAACAYHNFAKNIICLRCSGPKTSHPH 477

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGIH 481
           R GDW CPSC + NF +  AC RC  P  S + 
Sbjct: 341 RPGDWNCPSCGFSNFQRRTACFRCSFPVPSAVQ 373

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 7/37 (18%)

Query: 316 IPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFP 352
           IPF       R GDW C +C + NF +   C RCS P
Sbjct: 442 IPF-------RAGDWKCAACAYHNFAKNIICLRCSGP 471

>KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {ON}
           some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 557

 Score =  314 bits (804), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 172/409 (42%), Positives = 241/409 (58%), Gaps = 60/409 (14%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60
           MHYVVLEVE  H E + KD ++I   +YQ   +D  TL         + + N     QDA
Sbjct: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQF--LDTETLEPVFEENKHVELGNGC-TLQDA 57

Query: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120
           + QL+ DI +   +++FV+C+LNS  + RVT+ RQA D    LP +L++PK+FDLW E+ 
Sbjct: 58  VAQLEKDI-SEHAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYD 116

Query: 121 KFCANHPE---LDLNEEMVTSKDVAILTDILGL--------------------------- 150
           ++C NHPE   +  N     +KD+A +  +LGL                           
Sbjct: 117 RWCMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGAE 176

Query: 151 --------------------QSNNTENYTIDISTDVLLSLYKKCSSSEDIKFVLTQPYDL 190
                               QS   +  TI  +  ++  L+KKC +++D   VLT PYD 
Sbjct: 177 QLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYDS 236

Query: 191 QMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICYWTSKTPDEYSRNFHNN- 249
            +D++ F +E ++V++++NLPPD TQ+ELE+WF    ++P+ +WT K   E + N +NN 
Sbjct: 237 YLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNW 296

Query: 250 -----TYVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSS 304
                TYV  Q SI GF++FQ+HEEA ++L LNG+SI S+  + KQ   +EHI+E+ PSS
Sbjct: 297 SSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSS 356

Query: 305 TKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFPA 353
            +VLD  Q+IL PFPQSKNKPR GDWNCPSCGFSNFQRRT+CFRCSFPA
Sbjct: 357 ARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPA 405

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 27/33 (81%), Positives = 30/33 (90%)

Query: 444 SSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPK 476
           S+VPFRAGDWKC +CTYHNFAKN+ CLRCG PK
Sbjct: 486 SNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPK 518

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSG 479
           R GDW CPSC + NF +  +C RC  P  SG
Sbjct: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAASG 408

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352
           R GDW C +C + NF +   C RC  P
Sbjct: 491 RAGDWKCATCTYHNFAKNVVCLRCGGP 517

>TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.349
           YDL167C
          Length = 564

 Score =  309 bits (792), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 165/360 (45%), Positives = 232/360 (64%), Gaps = 12/360 (3%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQ--TNPVASIAISNDSENFQ 58
           M+Y ++E+++ H+    KD T+IIN+SYQ +N   STL A    + + +I  +    +  
Sbjct: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFIN--QSTLQASFPDDKIPNIDCTTLPLSES 58

Query: 59  DALVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVE 118
            AL+Q D ++    G+ +FV+C+LNS  +LRVT+ RQA D    LP + +YP++FDLW E
Sbjct: 59  IALLQKDLELNLPNGE-DFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKE 117

Query: 119 FKKFCANHPELDLNEEMVTSKDVAILTDILGLQSNNTENYTIDISTDVLLSLYKKCSSSE 178
           F ++C NH EL    +    KD+  L  +L + S  T + +I +++ VL+ L++KC++ +
Sbjct: 118 FDRWCVNHKELVQTRDPRKLKDLKQLATLLHIPSVETLS-SISLASKVLVQLHEKCTTED 176

Query: 179 DIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICYWTSKT 238
           D + VLT PYD ++D   F E  + V++++NLPPD TQ+ELETWF     +PI +WT K 
Sbjct: 177 DQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKN 236

Query: 239 PDEYSRNFHNN------TYVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQLY 292
             E +   +NN       YV    SI GFI+F TH+EA   L LNG SI S+  + KQ  
Sbjct: 237 ILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQPR 296

Query: 293 PVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFP 352
            VEH++E+ PSS KV++  Q IL PFPQSKNKPR GDWNCPSCGFSNFQRRTACFRCSFP
Sbjct: 297 VVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFP 356

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/37 (75%), Positives = 30/37 (81%)

Query: 440 TGNGSSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPK 476
             NGS+VPFRAGDWKC +C YHNFAKNI CLRC  PK
Sbjct: 471 ASNGSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPK 507

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGI 480
           R GDW CPSC + NF +  AC RC  P+   +
Sbjct: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQQQAV 361

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352
           R GDW C +CG+ NF +   C RCS P
Sbjct: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506

>ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL167C (NRP1)
          Length = 628

 Score =  307 bits (787), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 162/360 (45%), Positives = 223/360 (61%), Gaps = 13/360 (3%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60
           M+YV+ E +  H+E T KD  R+  + YQ+  I +  LL        I +       Q A
Sbjct: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQL--IHEPELLPLYADAREIEVGGGG--VQMA 56

Query: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120
             QL++ ++       FV+C+L+S  +LRVTL RQA D G  LP +L + K+FDLW E  
Sbjct: 57  TGQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECD 116

Query: 121 KFCANH-PELDLNEEMVTSKDVAILTDILGLQSNNTENYTIDISTDVLLSLYKKCSSSED 179
           ++CANH  E   N       DVA L  +L L      +  I  +T VLL L+ KC+++ED
Sbjct: 117 RWCANHVSERACNAG--AKGDVAELFRVLDLDEQLVSHAYIQQATRVLLQLHNKCTTAED 174

Query: 180 IKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICYWTSKTP 239
              VLT PYD   D+ +F +E + V++++NLPPD TQ+ELE+WF    ++P+ +WT K  
Sbjct: 175 QSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNV 234

Query: 240 DE------YSRNFHNNTYVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQLYP 293
            E       + + +N+ YV    SI GF++FQ+HE A ++L LNG+SI S+  + KQ   
Sbjct: 235 VEDTSNVNNNWSSNNSRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMANTKQPRV 294

Query: 294 VEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFPA 353
           VEH++E+ PSS++VLD  Q+IL PFPQSKNKPR GDWNCPSCGFSNFQRR ACFRCSFPA
Sbjct: 295 VEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACFRCSFPA 354

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 4/45 (8%)

Query: 438 SYTGNGS----SVPFRAGDWKCPSCTYHNFAKNIACLRCGDPKLS 478
           S  GNGS    +VPFRAGDWKC +C+YHNFAKNI CLRCG+PK +
Sbjct: 489 SCNGNGSLGSSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTA 533

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 20/32 (62%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGI 480
           R GDW CPSC + NF + IAC RC  P  S +
Sbjct: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATSAV 358

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 321 SKNKP-RLGDWNCPSCGFSNFQRRTACFRCSFP 352
           S N P R GDW C +C + NF +   C RC  P
Sbjct: 498 SSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNP 530

>Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}
           complement(78552..80606) [2055 nt, 685 aa]
          Length = 684

 Score =  301 bits (770), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 175/409 (42%), Positives = 237/409 (57%), Gaps = 56/409 (13%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSE-NFQD 59
           M+Y+V+E ++ H   T KD TRI  LSYQ V+ +        + V  I+I ++S  +F+D
Sbjct: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60

Query: 60  ALVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKL------F 113
            + QLD DIKT +G +EFV C+LNS+ +LRVT+ RQA D  V LP YL+  K+      F
Sbjct: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120

Query: 114 DLW----------------------------------VEFKKFCAN---HPELDLNEEMV 136
           + W                                  VE K+   N     E+  N    
Sbjct: 121 NRWAKNHSDTVTVKKSKNLRDLEELLRVLELTAEKTTVETKEIEENSDKEDEVHANTGAE 180

Query: 137 TSKDVAILTDILGLQ----SNNTENYTIDIS--TDVLLSLYKKCSSSEDIKFVLTQPYDL 190
            S +  I T          S   +   ++I+  T++L +++KKC++ EDI  VLT+PYD 
Sbjct: 181 ESGNATITTAADDDNNEDDSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYDS 240

Query: 191 QMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICYWTSKTPDEYSRNFHNNT 250
             D K F EE +++++++NLPPD TQ+ELE+WFA   SKP+ +WT K   E + N +NN 
Sbjct: 241 NSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETSNVNNNW 300

Query: 251 ------YVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSS 304
                 YV  Q SI GF+ FQ+H+EA  +LLLNG+SI S+  + KQ   VEHI+E+ PSS
Sbjct: 301 SMNNSPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPSS 360

Query: 305 TKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFPA 353
             VL+  QDI  PFPQSKNKPR GDWNC SCGFSNFQRRTACFRCS+PA
Sbjct: 361 VTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPA 409

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 25/31 (80%), Positives = 28/31 (90%)

Query: 446 VPFRAGDWKCPSCTYHNFAKNIACLRCGDPK 476
           VPFRAGDWKC +C+YHNFAKN+ CLRCG PK
Sbjct: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPK 570

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 7/41 (17%)

Query: 445 SVPF-------RAGDWKCPSCTYHNFAKNIACLRCGDPKLS 478
           S PF       R GDW C SC + NF +  AC RC  P  S
Sbjct: 371 SAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAAS 411

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352
           R GDW C +C + NF +   C RC  P
Sbjct: 543 RAGDWKCIACSYHNFAKNVVCLRCGGP 569

>TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.349
           YDL167C
          Length = 654

 Score =  294 bits (752), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 161/388 (41%), Positives = 237/388 (61%), Gaps = 35/388 (9%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNID---DSTLLAQTNPVASIAISNDSEN- 56
           M+Y+ +E E+ H+  T KD T+I++LSYQ++N++   D +   + N V  +++ +   N 
Sbjct: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60

Query: 57  ----FQDALVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKL 112
               F+D + Q   +++ TIG  E V+C+LNS  +LRVT+ RQ+ D G+ LP +L+ P +
Sbjct: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120

Query: 113 FDLWVEFKKFCANHPELDLNEEMVTSKDVAILTDILGLQSN----------NTENYTIDI 162
           FDLW E++++C  H       +    KD + L  IL +  N          N  +  I++
Sbjct: 121 FDLWKEYQRWCNLHFSEINTMKTKKYKDSSELYKILEINQNSDAKTNNEKLNDRSGNINM 180

Query: 163 -----------STDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLP 211
                      + DV +++  KCS+ ED + VLT PY+  +D +TF +E +++I+++NLP
Sbjct: 181 DRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKIIYMNNLP 240

Query: 212 PDITQNELETWFANHNSKPICYWTSKTPDEYSR------NFHNNTYVMNQHSIIGFIIFQ 265
           PD TQ+ELE+WFA    KP   WT +   E +       N +N+ YV    SI GF +FQ
Sbjct: 241 PDTTQSELESWFAQFGIKPARLWTVRNILESTSYTNSNGNSNNSPYVEEHDSISGFAVFQ 300

Query: 266 THEEAKQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKP 325
           TH+EA  +LLLNG+SI S+  + KQ   VEHI+E+ PSS  +L+  Q+I   FPQSKNKP
Sbjct: 301 THKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFPQSKNKP 360

Query: 326 RLGDWNCPSCGFSNFQRRTACFRCSFPA 353
           R GDWNC SCGFSNFQRRT+CFRCSFPA
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPA 388

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (82%)

Query: 446 VPFRAGDWKCPSCTYHNFAKNIACLRCGDPKLSGI 480
           VPFRAGDWKC +C+YHNFAKNI CLRCG PK   I
Sbjct: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKTQAI 581

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352
           R GDW C +C + NF +   C RC  P
Sbjct: 550 RAGDWKCSACSYHNFAKNIVCLRCGGP 576

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDP 475
           R GDW C SC + NF +  +C RC  P
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387

>KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]
           {ON} some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 631

 Score =  283 bits (725), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 160/394 (40%), Positives = 230/394 (58%), Gaps = 45/394 (11%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60
           M YV+ E E+ + E   KD T I +++YQI++++    + +     SI   + + + ++ 
Sbjct: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSI---DATHSLKNT 57

Query: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120
           +  +++ +   +   EFV+C+LNS  +LRVTL RQA D    LP +L++PK+FDLW E  
Sbjct: 58  IQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVD 117

Query: 121 KFCANHPE-------------LDLN-------EEMVTSKDVAILTDILGLQSNNT----- 155
           ++  NHPE              + N        ++V S D  ++   + L + +T     
Sbjct: 118 RWYRNHPEQYEKGTDRGGGNVANTNTTTQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRM 177

Query: 156 ENYTIDIST-----------DVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARV 204
           E   ID ++            VL  L++ C+S  D   VLT P+D  +DIK F  E++ V
Sbjct: 178 EQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTV 237

Query: 205 IFISNLPPDITQNELETWFANHNSKPICYWTSKTPDEYSRNFHNNT------YVMNQHSI 258
           ++++NLPPD TQ+ELE+WFA   S+P+ +WT K   E + N +NN       YV  Q SI
Sbjct: 238 LYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSNVNNNWSTNNNLYVDEQDSI 297

Query: 259 IGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPF 318
            GF+++Q HEEA  SL LNG+SI S+  + KQ   VEH++E+ PSS  VLD  Q+IL  F
Sbjct: 298 SGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAF 357

Query: 319 PQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFP 352
           PQSKNKPR GDW CPSC FSNFQRRTACFRCSFP
Sbjct: 358 PQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFP 391

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 34/39 (87%)

Query: 442 NGSSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPKLSGI 480
           NGS+VPFRAGDWKC +CTYHNFAKN+ CLRCG PK + +
Sbjct: 501 NGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTANV 539

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGIH 481
           R GDW CPSC++ NF +  AC RC  P  S + 
Sbjct: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQ 397

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 317 PFPQSKNKP-RLGDWNCPSCGFSNFQRRTACFRCSFP 352
           P     N P R GDW C +C + NF +   C RC  P
Sbjct: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGP 534

>CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {ON}
           similar to uniprot|P32770 Saccharomyces cerevisiae
           YDL167c ARP1
          Length = 603

 Score =  251 bits (641), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 150/396 (37%), Positives = 224/396 (56%), Gaps = 59/396 (14%)

Query: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60
           MHYVVL+V+   +   +K    ++ L YQ+  ID  +L A+  P     +  D E+ ++ 
Sbjct: 1   MHYVVLDVQI--DSSAVK--PVLLRLGYQV--IDPVSLEARNEP---YVVDVDGESIKEF 51

Query: 61  LVQLDSDIKT--TIG---------------QNEFVICTLNSLTNLRVTLRRQALDIGVNL 103
           + +LD D+K+  T+                + EFV CTLN   +++V L   A D+GV L
Sbjct: 52  IAKLDEDLKSHATVANHQESQDGSQSGSDVEKEFVFCTLNPSWSVKVGLVSSANDLGVEL 111

Query: 104 PQYLRYPKLFDLWVEFKKFCANH------PELDLN-----------EEMVTSKDVAILTD 146
           P+YLRYP  FD+W E+  +  NH      P+   N           EE+V + DV+   D
Sbjct: 112 PEYLRYPVFFDIWKEYSIWKKNHSDSSESPQTQANGESIDSFAGKIEELVRTLDVSTEYD 171

Query: 147 ILGLQSNNTENYTIDISTDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIF 206
            L  Q N+   + + ++T VL +L+KKC +  D   VLT PYDL MD K F EE++++++
Sbjct: 172 EL-KQKNDDPTFDVRLATLVLTALHKKCVTPVDDTTVLTVPYDLGMDYKNFIEEQSKILY 230

Query: 207 ISNLPPDITQNELETWFANHNSKPICYWTSK--TPDEYSRNFHNNTYVMN-QHSIIGFII 263
           ISN+P ++ Q +LE WF       + +WT K  + D    +  N+  +++   S+ GF I
Sbjct: 231 ISNIPSELNQTDLEGWFQQKGVASVGFWTLKNISDDATLASQRNHGKMLSIPDSMFGFAI 290

Query: 264 FQTHEEAKQSLLLNGKSISSSTLHMKQLYP-----VEHIIEVAPSSTKVLDHTQDILIPF 318
           FQ+H +A+ +L L+G         MK + P     +E ++++ PSS ++L+  QD LI  
Sbjct: 291 FQSHNDAEYALNLHGTV-------MKIVAPKGNKHIEQLLDIQPSSMRLLEKVQDNLILL 343

Query: 319 PQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFPAP 354
           PQ+KNKPR GDWNCPSCGFSNFQRRTACFRC+FP P
Sbjct: 344 PQNKNKPRPGDWNCPSCGFSNFQRRTACFRCAFPVP 379

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 39/83 (46%)

Query: 394 PYQTYNKLNDSVTGSLXXXXXXXXXXXXXXXXXXXXXXFNMPFTSYTGNGSSVPFRAGDW 453
           P   YN+ N   +  L                        M   S    GS+VPFRAGDW
Sbjct: 480 PLHNYNRFNQGTSAHLPYNLTHSTSSNGYISEGNNHGHGGMSTNSGMIGGSNVPFRAGDW 539

Query: 454 KCPSCTYHNFAKNIACLRCGDPK 476
           KCP C YHNFAKNI CLRCG PK
Sbjct: 540 KCPGCFYHNFAKNIVCLRCGGPK 562

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGI 480
           R GDW CPSC + NF +  AC RC  P  +G+
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFPVPNGV 382

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352
           R GDW CP C + NF +   C RC  P
Sbjct: 535 RAGDWKCPGCFYHNFAKNIVCLRCGGP 561

>KLLA0E11045g Chr5 (968674..969972) [1299 bp, 432 aa] {ON} similar
           to uniprot|P49960 Saccharomyces cerevisiae YMR268C PRP24
           Splicing factor that reanneals U4 and U6 snRNPs during
           spliceosome recycling
          Length = 432

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 38/91 (41%), Gaps = 11/91 (12%)

Query: 201 EARVIFISNLPPDITQNELETWFANHNSKPICYWTSKTPDEYSRNFHNNTYVMNQHSIIG 260
           + R I + NLP DIT ++L   F                 E +R    +     +HS   
Sbjct: 205 DGREIIVKNLPDDITIDDLIKMFNEFGDT-----------EKARIVTGDETNPGRHSRYA 253

Query: 261 FIIFQTHEEAKQSLLLNGKSISSSTLHMKQL 291
           FI F+    A  +L LNG  ++   LH+ ++
Sbjct: 254 FITFKNKASADNALSLNGAVMNGKPLHVSKV 284

>TDEL0B00750 Chr2 (139060..140316) [1257 bp, 418 aa] {ON} Anc_8.822
           YMR268C
          Length = 418

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 46/92 (50%), Gaps = 14/92 (15%)

Query: 205 IFISNLPPDITQNELETWFANHNSKPICYWTSKTPDEYSRNFHNNTYVMNQHSIIGFIIF 264
           I+I+N PP+ TQ ++++ F +HN+  +           S  F +  Y  N +    ++  
Sbjct: 105 IWITNFPPNYTQRDIKSLFLDHNAVAL-----------SVRFPSLRY--NSNRRFAYVDV 151

Query: 265 QTHEEAKQ-SLLLNGKSISSSTLHMKQLYPVE 295
            + EEA + +  LN K + +  L +K+  P+E
Sbjct: 152 TSTEEADRITAELNDKEVETYRLVVKKSNPIE 183

>Ecym_1169 Chr1 (344690..346354) [1665 bp, 554 aa] {ON} similar to
           Ashbya gossypii AEL239W
          Length = 554

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%)

Query: 93  RRQALDIGVNLPQYLRYPKLFDLWVEFKKFCANHPELDLNEEMVTSKDVAILTDILG 149
           + Q LD+  N P+++ Y  +  L ++  K  A   +LDL E +  S+++ I +  LG
Sbjct: 232 KAQVLDLFRNSPEFMEYDTILTLKIQHLKELAESGKLDLPEFLGMSRNLDIDSQSLG 288

>Suva_13.130 Chr13 (207349..209883) [2535 bp, 844 aa] {ON} YML029W
           (REAL)
          Length = 844

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 12/73 (16%)

Query: 163 STDVLLSLYKKCSSSEDIKFVLTQP------------YDLQMDIKTFYEEEARVIFISNL 210
           S  + L+ YKKC  ++ +  +L  P            YD++ D  T    + R++FI  L
Sbjct: 618 SNSLTLAFYKKCKDTQSVIDLLMIPNLHEQRLSVYSEYDIEYDANTPDVGQLRLLFIKVL 677

Query: 211 PPDITQNELETWF 223
             +I++N L+  F
Sbjct: 678 SGEISKNALDELF 690

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,506,647
Number of extensions: 2351334
Number of successful extensions: 7597
Number of sequences better than 10.0: 36
Number of HSP's gapped: 7759
Number of HSP's successfully gapped: 93
Length of query: 565
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 450
Effective length of database: 40,294,809
Effective search space: 18132664050
Effective search space used: 18132664050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)