Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A018907.350ON42242220240.0
NCAS0A141607.350ON45138813540.0
KLTH0H01254g7.350ON38138013290.0
KLLA0D12342g7.350ON38438313140.0
SAKL0F11374g7.350ON38338313111e-180
Kwal_56.246427.350ON38138013101e-180
TBLA0E00390singletonON38338312811e-176
Kpol_530.317.350ON38037912581e-172
TDEL0C019807.350ON38538212481e-171
Suva_4.787.350ON38538412451e-170
Ecym_47237.350ON38138112451e-170
Skud_4.897.350ON38538012261e-167
TPHA0F029707.350ON38137712241e-167
YDL168W (SFA1)7.350ON38638012151e-166
Smik_4.707.350ON38638412121e-165
ZYRO0F11704g7.350ON38238011951e-163
CAGL0L01111g7.350ON38138011931e-162
ACL148C7.350ON38138111591e-157
KAFR0B008807.350ON38137911561e-157
KNAG0C037907.350ON38238710411e-139
SAKL0A00880gsingletonON3883818041e-103
CAGL0J01441g2.480ON3722822111e-17
TBLA0I011402.480ON3772562057e-17
KLLA0B00451gsingletonON3863901818e-14
KLLA0D19929gsingletonON3863261791e-13
KLTH0D05588g2.480ON3892421791e-13
SAKL0B00814g8.16ON3543671782e-13
KLLA0F13530g2.480ON3752831763e-13
KLTH0G18986g8.16ON3543431754e-13
KAFR0A007902.480ON3772491754e-13
AER032W3.118ON3512621721e-12
TPHA0G032102.480ON3772741711e-12
Ecym_53313.118ON3482421701e-12
Suva_4.3943.118ON3512671701e-12
KLTH0G15686g3.118ON3512621701e-12
Ecym_73912.480ON3752751702e-12
NCAS0A077802.480ON3732701692e-12
KLLA0F21010g3.118ON3502431683e-12
Skud_13.2402.480ON3752491683e-12
Kwal_26.77992.480ON3872581684e-12
CAGL0I07843g3.118ON3522691674e-12
SAKL0E02838g2.480ON3772421666e-12
SAKL0C10164g3.118ON3512691648e-12
NCAS0I023503.118ON3512631649e-12
KAFR0G014203.118ON3512621649e-12
ZYRO0G03388g2.480ON3702751631e-11
NDAI0H021602.480ON3812511632e-11
KLLA0B09064gna 1ON3742661622e-11
Kwal_55.19574singletonON3562111622e-11
YMR083W (ADH3)2.480ON3752491622e-11
Suva_13.2612.480ON3752491622e-11
NDAI0A063203.253ON3492011612e-11
Kpol_1058.118.16ON3532391612e-11
TDEL0A025602.480ON3732861613e-11
SAKL0F06270gna 2ON3512691603e-11
YOL086C (ADH1)3.118ON3482621594e-11
Smik_13.2662.480ON3752491586e-11
TBLA0E03430singletonON3512621577e-11
Smik_13.520na 3ON3482621578e-11
Smik_15.713.118ON3482651569e-11
KNAG0K020003.118ON3502501551e-10
SAKL0B08184gna 1ON3732651552e-10
NDAI0A069303.118ON3512641542e-10
TBLA0E034403.118ON3512621542e-10
Suva_13.494na 3ON3482621532e-10
YMR303C (ADH2)na 3ON3482621532e-10
Suva_15.813.118ON3482631523e-10
YBR145W (ADH5)3.118ON3512571523e-10
KAFR0L02010singletonON3512441523e-10
KNAG0E025902.480ON3742621523e-10
Skud_2.2723.118ON3512671514e-10
KLTH0E05588gna 2ON3482621514e-10
NCAS0I01720singletonON3512651505e-10
Smik_2.2843.118ON3512671506e-10
KLLA0F18260gsingletonON3482451489e-10
Suva_10.1548.16ON3562001471e-09
Skud_15.683.118ON3482651471e-09
Smik_48.1singletonON3573371471e-09
Skud_13.477na 3ON3482651471e-09
ABL033C2.480ON3732841462e-09
KLTH0D00616g7.3ON3822871462e-09
KAFR0L02000singletonON3612421462e-09
TDEL0F03190na 2ON3512461452e-09
YLR070C (XYL2)8.16ON3561881452e-09
TPHA0M007303.118ON3502621443e-09
TDEL0C003908.16ON3532441443e-09
Kwal_26.6684singletonON356931443e-09
Suva_12.260singletonON3573471443e-09
Kwal_56.231983.118ON3512621443e-09
Skud_20.2singletonON3573431425e-09
Skud_4.2singletonON3573431425e-09
Kpol_431.82.480ON3802661435e-09
NDAI0H020507.3ON3851041427e-09
TDEL0D050503.118ON3512421417e-09
AAR084WsingletonON3852751418e-09
Kpol_1036.193.118ON3532621409e-09
YJR159W (SOR1)na 4ON3573441409e-09
TDEL0H044607.3ON3822581391e-08
ZYRO0B05940g3.118ON3792771392e-08
ABR229C8.16ON3533381382e-08
YAL060W (BDH1)7.3ON3821981382e-08
YDL246C (SOR2)singletonON3573441372e-08
Smik_1.67.3ON3821981363e-08
ZYRO0G03410gsingletonON3733481354e-08
Suva_1.77.3ON3822001355e-08
ZYRO0F02552g8.16ON3512421328e-08
ZYRO0C12562gna 2ON3482651328e-08
SAKL0D14872g7.3ON3831041311e-07
Skud_1.37.3ON3822571311e-07
NCAS0J003008.16ON3571081292e-07
KAFR0C005803.253ON3342001282e-07
TBLA0A042907.3ON3951031283e-07
YBR046C (ZTA1)3.253ON3342141273e-07
KAFR0I001607.2ON3852851266e-07
Kwal_26.67397.3ON3822771266e-07
Kpol_1049.187.2ON3861051266e-07
KLLA0F00506g7.3ON3851871258e-07
NCAS0A076607.3ON3861051259e-07
KLTH0A00418gsingletonON3562401241e-06
NCAS0A076707.2ON4391011232e-06
KLLA0A10549g3.253ON353881203e-06
SAKL0D14894g7.2ON3851251203e-06
TDEL0D037203.253ON3352021193e-06
Kwal_55.20564singletonON2162081155e-06
KAFR0I001707.3ON3811201185e-06
Kwal_56.229853.253ON3462211185e-06
KNAG0I00120singletonON3811241186e-06
KNAG0K01040singletonON3911211142e-05
KLLA0D05511g8.16ON3543551123e-05
CAGL0D00198g7.3ON3831041105e-05
NCAS0I017303.253ON3492601071e-04
Skud_1.27.2ON4171011062e-04
YAL061W (BDH2)7.2ON4171031062e-04
Smik_1.57.2ON4171011034e-04
ZYRO0A03366g3.253ON349253990.001
Suva_1.67.2ON41791990.001
Suva_4.2793.253ON334210980.002
TPHA0M009303.253ON343227950.004
Suva_6.13singletonON6859840.006
KNAG0D00110singletonON362201880.022
KLTH0C07854g3.253ON358312830.10
KLLA0F00638gna 5ON382111830.11
Smik_14.1932.133ON376116810.19
Skud_86.1singletonON8959730.27
TDEL0A00140singletonON405132770.61
NDAI0H02950singletonON36374750.86
NDAI0H020607.2ON399101741.4
Smik_11.952.423ON19874721.6
TPHA0H03100singletonON392105731.8
Skud_11.862.423ON19874702.8
KNAG0E042007.2ON385101679.1
SAKL0H22088gna 6ON37682679.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A01890
         (422 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    784   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   526   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   516   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   510   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   509   e-180
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   509   e-180
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      498   e-176
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   489   e-172
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   485   e-171
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   484   e-170
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   484   e-170
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   476   e-167
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   476   e-167
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   472   e-166
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   471   e-165
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   464   e-163
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   464   e-162
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   451   e-157
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   449   e-157
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   405   e-139
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   314   e-103
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...    86   1e-17
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...    84   7e-17
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...    74   8e-14
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...    74   1e-13
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    74   1e-13
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    73   2e-13
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    72   3e-13
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    72   4e-13
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    72   4e-13
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...    71   1e-12
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    70   1e-12
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...    70   1e-12
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...    70   1e-12
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    70   1e-12
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    70   2e-12
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    70   2e-12
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    69   3e-12
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    69   3e-12
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    69   4e-12
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    69   4e-12
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    69   6e-12
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...    68   8e-12
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     68   9e-12
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...    68   9e-12
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    67   1e-11
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     67   2e-11
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    67   2e-11
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    67   2e-11
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    67   2e-11
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    67   2e-11
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    67   2e-11
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    67   2e-11
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    67   3e-11
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    66   3e-11
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    66   4e-11
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    65   6e-11
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               65   7e-11
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    65   8e-11
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    65   9e-11
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....    64   1e-10
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    64   2e-10
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    64   2e-10
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    64   2e-10
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    64   2e-10
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    64   2e-10
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    63   3e-10
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...    63   3e-10
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              63   3e-10
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    63   3e-10
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    63   4e-10
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    63   4e-10
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               62   5e-10
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    62   6e-10
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    62   9e-10
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    61   1e-09
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    61   1e-09
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    61   1e-09
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    61   1e-09
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    61   2e-09
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    61   2e-09
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              61   2e-09
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    60   2e-09
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    60   2e-09
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    60   3e-09
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    60   3e-09
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    60   3e-09
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    60   3e-09
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    60   3e-09
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     59   5e-09
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    59   5e-09
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    60   5e-09
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    59   7e-09
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    59   7e-09
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    59   8e-09
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    59   9e-09
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    59   9e-09
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    58   1e-08
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    58   2e-08
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    58   2e-08
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    58   2e-08
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    57   2e-08
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     57   3e-08
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    57   4e-08
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     57   5e-08
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    55   8e-08
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    55   8e-08
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    55   1e-07
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     55   1e-07
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       54   2e-07
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    54   2e-07
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    54   3e-07
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    54   3e-07
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    53   6e-07
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    53   6e-07
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    53   6e-07
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    53   8e-07
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    53   9e-07
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    52   1e-06
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    52   2e-06
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    51   3e-06
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    51   3e-06
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    50   3e-06
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    49   5e-06
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    50   5e-06
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    50   5e-06
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  50   6e-06
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    49   2e-05
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    48   3e-05
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    47   5e-05
NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253     46   1e-04
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      45   2e-04
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    45   2e-04
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     44   4e-04
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    43   0.001
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     43   0.001
Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON...    42   0.002
TPHA0M00930 Chr13 complement(180084..181115) [1032 bp, 343 aa] {...    41   0.004
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    37   0.006
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   39   0.022
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    37   0.10 
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    37   0.11 
Smik_14.193 Chr14 complement(352041..353171) [1131 bp, 376 aa] {...    36   0.19 
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    33   0.27 
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 34   0.61 
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    33   0.86 
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    33   1.4  
Smik_11.95 Chr11 (165566..166162) [597 bp, 198 aa] {ON} YKL141W ...    32   1.6  
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    33   1.8  
Skud_11.86 Chr11 (165849..166445) [597 bp, 198 aa] {ON} YKL141W ...    32   2.8  
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    30   9.1  
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    30   9.6  

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/422 (92%), Positives = 391/422 (92%)

Query: 1   MLPKTFNRKVFTTFSSVFQKRPPLCTSLRLITTTEGRGFLQSKSEKYKAKQFNTQLNQNK 60
           MLPKTFNRKVFTTFSSVFQKRPPLCTSLRLITTTEGRGFLQSKSEKYKAKQFNTQLNQNK
Sbjct: 1   MLPKTFNRKVFTTFSSVFQKRPPLCTSLRLITTTEGRGFLQSKSEKYKAKQFNTQLNQNK 60

Query: 61  LTNISIGKLPISRSPLTQFIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKA 120
           LTNISIGKLPISRSPLTQFIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKA
Sbjct: 61  LTNISIGKLPISRSPLTQFIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKA 120

Query: 121 HEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIAL 180
           HEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSIL               TNVKVGDHVIAL
Sbjct: 121 HEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIAL 180

Query: 181 YTAECGECKFCKSGXXXXXXXAVDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAV 240
           YTAECGECKFCKSG       AVDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAV
Sbjct: 181 YTAECGECKFCKSGXXXXXXXAVDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAV 240

Query: 241 FGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKL 300
           FGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKL
Sbjct: 241 FGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKL 300

Query: 301 IEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVW 360
           IEMTDGGLEYTFDCTGNTKVMRDALEACHKGW                TRPFQLVTGRVW
Sbjct: 301 IEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIIIGVAAAGEEISTRPFQLVTGRVW 360

Query: 361 KGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEINNAFEDLHHGDCLRTVLDL 420
           KGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEINNAFEDLHHGDCLRTVLDL
Sbjct: 361 KGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEINNAFEDLHHGDCLRTVLDL 420

Query: 421 SK 422
           SK
Sbjct: 421 SK 422

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/388 (69%), Positives = 284/388 (73%), Gaps = 46/388 (11%)

Query: 81  QTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTL 140
           Q    MS+TQGKPITCTAAVAY AGKPLTVE IVVDPPKAHEVRIKI+YTAVCHTDAYTL
Sbjct: 64  QNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTL 123

Query: 141 SGVDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGE---CKFCKSGXXX 197
           SG+DPEGAFPSIL               TNVKVGDHVIALYTAECG+   CK  K+    
Sbjct: 124 SGIDPEGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCG 183

Query: 198 XXXXAVDKN-------------------------------------------APMDSICL 214
                  K                                            AP+DSI L
Sbjct: 184 SVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISL 243

Query: 215 LGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQW 274
           LGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAK+RGASKIIVVD+N+ KKQW
Sbjct: 244 LGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQW 303

Query: 275 SMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXX 334
           S DFGATDF+NPK DLKEGETIV KLIEMTDGGLEYTFDCTGN KVMRDALEACHKGW  
Sbjct: 304 SFDFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGE 363

Query: 335 XXXXXXXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITH 394
                         TRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DYQNG LKVDEFITH
Sbjct: 364 SIIIGVAGAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITH 423

Query: 395 RRPFTEINNAFEDLHHGDCLRTVLDLSK 422
           RRPFTEIN+AFEDLHHGDCLRTVLDL+K
Sbjct: 424 RRPFTEINDAFEDLHHGDCLRTVLDLAK 451

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/380 (67%), Positives = 278/380 (73%), Gaps = 46/380 (12%)

Query: 89  TQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA 148
           ++GKPITCTAAVAYEAGKPLTVE+IVVDPPKAHEVRIK++YTAVCHTDAYTLSGVDPEGA
Sbjct: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61

Query: 149 FPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSG-------------- 194
           FPSIL               TNVK GDHVIALYTAEC ECKFCKSG              
Sbjct: 62  FPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 195 --------------------------------XXXXXXXAVDKNAPMDSICLLGCGVTTG 222
                                                  A+D  AP+D  CLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 223 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATD 282
           YGAA+KTA+VQKGDTVA+FGAGTVGLSVVQGA  RGASKIIVVD+NDQKKQWS+DFGATD
Sbjct: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241

Query: 283 FINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXXXXX 342
           F+NP   LK+G+TIV KL+EMTDGGL++TFDCTGNT VMR ALEACHKGW          
Sbjct: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301

Query: 343 XXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEIN 402
                 TRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +G LKVDEFITHRR FT+IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361

Query: 403 NAFEDLHHGDCLRTVLDLSK 422
           +AFEDLHHGDCLRTVLDLSK
Sbjct: 362 SAFEDLHHGDCLRTVLDLSK 381

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  510 bits (1314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/383 (66%), Positives = 278/383 (72%), Gaps = 46/383 (12%)

Query: 85  IMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVD 144
           + S T GKPI C AAVAYEAGKPLTVE I+VD PKAHEVR+++ +TAVCHTDAYTLSGVD
Sbjct: 1   MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60

Query: 145 PEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSG---------- 194
           PEGAFPSIL               TNVKVGDHV+ LYTAECG+CKFCKS           
Sbjct: 61  PEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRA 120

Query: 195 ------------------------------------XXXXXXXAVDKNAPMDSICLLGCG 218
                                                       +D +AP+ S+CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCG 180

Query: 219 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDF 278
           VTTGYGAA+KTANVQ+GDTVAVFGAGTVGLSVVQGAK+RGASKIIVVDVNDQKKQWSMDF
Sbjct: 181 VTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240

Query: 279 GATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXX 338
           GAT F+NP  DLKEGETIVSKLI+MTDGGL++TFDCTGN KVMRDALEACHKGW      
Sbjct: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIII 300

Query: 339 XXXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPF 398
                     TRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQ G+LKVD+FITH+RPF
Sbjct: 301 GVAAAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPF 360

Query: 399 TEINNAFEDLHHGDCLRTVLDLS 421
           TEINNAFEDLHHGDCLRTVLDL+
Sbjct: 361 TEINNAFEDLHHGDCLRTVLDLA 383

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  509 bits (1311), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 261/383 (68%), Positives = 279/383 (72%), Gaps = 46/383 (12%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           MS T GKPITC AAVAYEAGKPLTVE+I+V+PPKAHEVRI+I YTAVCHTDAYTLSGVDP
Sbjct: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60

Query: 146 EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAEC--------GECKFCKSGXXX 197
           EGAFPSIL               TNVK GDHV+ALYTAEC        G+   C S    
Sbjct: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120

Query: 198 XXXXAV--------DKN------------------------------APMDSICLLGCGV 219
                +         KN                              AP+D ICLLGCGV
Sbjct: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGV 180

Query: 220 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFG 279
           TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGAS+IIVVD+NDQKKQW+ DFG
Sbjct: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240

Query: 280 ATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXX 339
           ATDF+NP  DLKEGETIVSKLIE+TDGGL++TFDCTGNTKVMRDALEACHKGW       
Sbjct: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 340 XXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFT 399
                    TRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +G LKVDEFITHRRPFT
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360

Query: 400 EINNAFEDLHHGDCLRTVLDLSK 422
           EIN AF+DLHHGDCLRTVLDLSK
Sbjct: 361 EINAAFDDLHHGDCLRTVLDLSK 383

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  509 bits (1310), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 255/380 (67%), Positives = 275/380 (72%), Gaps = 46/380 (12%)

Query: 89  TQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA 148
           ++GKPITC AAVAYEAGKPLT+E+IVVDPPKAHEVR+KI YTAVCHTDAYTLSGVDPEGA
Sbjct: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61

Query: 149 FPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSGXXX----------- 197
           FPSIL               TNVK GDHVIALYTAEC ECKFCKSG              
Sbjct: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 198 -----------------------------------XXXXAVDKNAPMDSICLLGCGVTTG 222
                                                  A+D  AP+D  CLLGCGVTTG
Sbjct: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 223 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATD 282
           YGAA+KTANVQKGDTVAVFGAGTVGLSVVQGAK RGAS+IIVVD+NDQKKQW+ +FGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241

Query: 283 FINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXXXXX 342
           F+NP  DLK+G+TIV  L+EMTDGGL+YTFDCTGNT VMR ALEACHKGW          
Sbjct: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301

Query: 343 XXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEIN 402
                 TRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY +G LKVDEFITHRR FT+IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361

Query: 403 NAFEDLHHGDCLRTVLDLSK 422
           +AFEDLHHGDCLRTVLDL K
Sbjct: 362 SAFEDLHHGDCLRTVLDLLK 381

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  498 bits (1281), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 249/383 (65%), Positives = 277/383 (72%), Gaps = 46/383 (12%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           MS TQGKPI C AAVAY+A +PLTVE+I+V+PP+AHEVRIKI +TAVCHTDAYTLSGVDP
Sbjct: 1   MSETQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDP 60

Query: 146 EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSGXXX-------- 197
           EGAFP +L               ++VKVGDHVIALYTAECG CKFCKSG           
Sbjct: 61  EGAFPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRET 120

Query: 198 --------------------------------------XXXXAVDKNAPMDSICLLGCGV 219
                                                     A++K AP+ S+CLLGCGV
Sbjct: 121 QGKGVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGV 180

Query: 220 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFG 279
           TTGYGAAIKTANVQK DTVAVFGAGTVGLSVVQGA+ARGASKII+VDVN +K+ +S  FG
Sbjct: 181 TTGYGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFG 240

Query: 280 ATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXX 339
           ATDFINP TDLK GETIVSKL+EMTDGGL++TFDCTGN KVMRDALE CHKGW       
Sbjct: 241 ATDFINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIG 300

Query: 340 XXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFT 399
                    TRPFQLVTGRVWKGSAFGG+KGRSEMGGLI+ YQ G+LKVD+FIT++RPFT
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFT 360

Query: 400 EINNAFEDLHHGDCLRTVLDLSK 422
           EIN AFEDLHHGDCLRTVLDL K
Sbjct: 361 EINAAFEDLHHGDCLRTVLDLEK 383

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  489 bits (1258), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 247/379 (65%), Positives = 272/379 (71%), Gaps = 47/379 (12%)

Query: 88  TTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEG 147
           +T GKPITC AAVAYEA KPL VE+IVVDPPKAHEVRIKI  TAVCHTDAYTLSGVDPEG
Sbjct: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61

Query: 148 AFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSG------------- 194
            FP +L               T VK GDHV+ALYTAECG+CKFC SG             
Sbjct: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121

Query: 195 ---------------------------------XXXXXXXAVDKNAPMDSICLLGCGVTT 221
                                                   A+D  AP+DS+CLLGCGVTT
Sbjct: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181

Query: 222 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGAT 281
           GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAK+RGASKIIVVD+N+ KK+WS +FGAT
Sbjct: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241

Query: 282 DFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXXXX 341
           DF+NP ++L EG+ IVSKL+EMTDGGL++TFDCTGN  VMRDALEACHKGW         
Sbjct: 242 DFVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300

Query: 342 XXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEI 401
                  TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNG+LKVDEFIT+RRPF EI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360

Query: 402 NNAFEDLHHGDCLRTVLDL 420
           N+AFE+LHHG+CLRTVL  
Sbjct: 361 NDAFEELHHGNCLRTVLSF 379

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  485 bits (1248), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 247/382 (64%), Positives = 273/382 (71%), Gaps = 46/382 (12%)

Query: 87  STTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPE 146
           + T+GK ITC AAVAYEAGKPLTVE+I V+ P+AHEVRIKI+YTAVCHTDAYTLSGVDPE
Sbjct: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63

Query: 147 GAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAEC--------GECKFCKSGXXXX 198
           GAFPSIL               TNVK GDHVIALYTAEC        G+   C S     
Sbjct: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123

Query: 199 XXXAVDK--------------------------------------NAPMDSICLLGCGVT 220
               +                                        +AP++SICLLGCGVT
Sbjct: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVT 183

Query: 221 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGA 280
           TGYGAA KTANVQKGDTVAVFGAGTVGLSV+QGAK RGAS+II+VD+NDQK+++  +FGA
Sbjct: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243

Query: 281 TDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXXX 340
           TDFINPK+DLK+G+TIV KLIEMTDGGL+YTFDCTGNTKVMRDALEACHKGW        
Sbjct: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303

Query: 341 XXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTE 400
                   TRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DY+ G LKVDEFIT+ RPFTE
Sbjct: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363

Query: 401 INNAFEDLHHGDCLRTVLDLSK 422
           IN AFEDLH GDCLRTVLDL K
Sbjct: 364 INKAFEDLHAGDCLRTVLDLKK 385

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  484 bits (1245), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 244/384 (63%), Positives = 269/384 (70%), Gaps = 46/384 (11%)

Query: 85  IMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVD 144
           + ++T GKPI C AA+AY+A KPL+VE+I VDPPKAHEVRIKI+YTAVCHTDAYTLSG D
Sbjct: 1   MSASTVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 145 PEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSGXXX------- 197
           PEG FP IL               T VK GDHVIALYTAECG+CKFC SG          
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 198 ---------------------------------------XXXXAVDKNAPMDSICLLGCG 218
                                                      A+D  AP+D+  LLGCG
Sbjct: 121 TQGRGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCG 180

Query: 219 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDF 278
           VTTGYGAA+KTANVQKGDTVAVFG GTVGLSV+QGAKARGASKII +D+N++KKQ+  DF
Sbjct: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDF 240

Query: 279 GATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXX 338
           GATDFINPK DL +G+TIV KLIE TDGGL++TFDCTGNTK+MRDALEACHKGW      
Sbjct: 241 GATDFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 339 XXXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPF 398
                     TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNG LKV+EFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPF 360

Query: 399 TEINNAFEDLHHGDCLRTVLDLSK 422
            EIN AFEDLH GDCLRTVL   K
Sbjct: 361 KEINQAFEDLHQGDCLRTVLKFDK 384

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  484 bits (1245), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 243/381 (63%), Positives = 265/381 (69%), Gaps = 46/381 (12%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           MS T GK I C AA+AY AG PL +E I VDPPKAHEVRIKI +TA+CHTDAYTLSGVDP
Sbjct: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60

Query: 146 EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSG----------- 194
           EG FPSIL               TNVKVGDHVI LYTAEC ECKFC SG           
Sbjct: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120

Query: 195 -----------------------------------XXXXXXXAVDKNAPMDSICLLGCGV 219
                                                     A+D+ AP+D +CLLGCGV
Sbjct: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180

Query: 220 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFG 279
           TTGYGAA+KTA+VQKGDTVAVFGAGTVGLSVVQGA++RGASKIIVVD+ND KK+WS DFG
Sbjct: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240

Query: 280 ATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXX 339
           ATDFINP  DL +GETIVSKLI+MTDGGL++TFDCTGNTKVMRDALEACHKGW       
Sbjct: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 340 XXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFT 399
                    TRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY  G LKVDEF+TH RPF+
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360

Query: 400 EINNAFEDLHHGDCLRTVLDL 420
           EIN+   DLHHGDCLRTVL+ 
Sbjct: 361 EINDGLTDLHHGDCLRTVLNF 381

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  476 bits (1226), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 239/380 (62%), Positives = 267/380 (70%), Gaps = 46/380 (12%)

Query: 85  IMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVD 144
           +++ T GKPI C AAVAY A K L+VE+I VDPPKAHEVRIKI++TAVCHTDAYTLSG D
Sbjct: 1   MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD 60

Query: 145 PEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSG---------- 194
           PEG FP IL                 VK GDHVIALYTAECG+CKFC SG          
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 195 ------------------------------------XXXXXXXAVDKNAPMDSICLLGCG 218
                                                      A+D  AP+D+ CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180

Query: 219 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDF 278
           VTTGYGAAIKTANVQ+GDTVAVFG GTVGLSV+QGAK+RGASKII VD+N++K+Q+S +F
Sbjct: 181 VTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNF 240

Query: 279 GATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXX 338
           GATDFINPK DL E +TIV KLI+MTDGGL++TFDCTGNT +MRDALEACHKGW      
Sbjct: 241 GATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIII 300

Query: 339 XXXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPF 398
                     TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ+G LKV+EFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPF 360

Query: 399 TEINNAFEDLHHGDCLRTVL 418
            EIN AFEDLH+GDCLRTVL
Sbjct: 361 KEINQAFEDLHNGDCLRTVL 380

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  476 bits (1224), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 245/377 (64%), Positives = 266/377 (70%), Gaps = 47/377 (12%)

Query: 91  GKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGAFP 150
           GKPITCTAA+AYEA KPLTV +IVVDPPKAHEVRIKI  TAVCHTDAY+LSGVDPEG FP
Sbjct: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64

Query: 151 SILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSGXXX------------- 197
            +L               TNVKVGDHVIALYTAECG+CKFC SG                
Sbjct: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124

Query: 198 ---------------------------------XXXXAVDKNAPMDSICLLGCGVTTGYG 224
                                                A DK+   +   LLGCGVTTGYG
Sbjct: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184

Query: 225 AAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFI 284
           AAIKTAN+QKGDTVAVFGAGTVGLSVVQGAK+RGASKIIVVD+N+ KK WS +FGATDF+
Sbjct: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244

Query: 285 NPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXXXXXXX 344
           NPK +LK+ E IVSKLIEMTDGGL++TFDCTGN  VMR+ALEACHKGW            
Sbjct: 245 NPK-ELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303

Query: 345 XXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEINNA 404
               TRPFQLVTGRVW+GSAFGGIKGRSEMGGLIKDYQ+G LKVDEFIT RRPFTEIN A
Sbjct: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363

Query: 405 FEDLHHGDCLRTVLDLS 421
           FEDLH+G CLRTVLD S
Sbjct: 364 FEDLHNGSCLRTVLDTS 380

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  472 bits (1215), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 237/380 (62%), Positives = 264/380 (69%), Gaps = 46/380 (12%)

Query: 85  IMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVD 144
           + + T GKPI C AAVAY+A KPL+VE+I VD PKAHEVRIKI+YTAVCHTDAYTLSG D
Sbjct: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 145 PEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSGX--------- 195
           PEG FP +L                 VK GDHVIALYTAECG+CKFC SG          
Sbjct: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120

Query: 196 -------------------------------------XXXXXXAVDKNAPMDSICLLGCG 218
                                                      A+D  AP+D+ CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180

Query: 219 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDF 278
           VTTG+GAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGASKII +D+N++KKQ+   F
Sbjct: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQF 240

Query: 279 GATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXX 338
           GATDF+NPK DL + +TIV KLIEMTDGGL++TFDCTGNTK+MRDALEACHKGW      
Sbjct: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 339 XXXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPF 398
                     TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ G LKV+EFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360

Query: 399 TEINNAFEDLHHGDCLRTVL 418
            EIN AFEDLH+GDCLRTVL
Sbjct: 361 KEINQAFEDLHNGDCLRTVL 380

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  471 bits (1212), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 238/384 (61%), Positives = 265/384 (69%), Gaps = 46/384 (11%)

Query: 85  IMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVD 144
           + + T GKPI C AAVAY+A KP +VE+I VD PKAHEVRIKI+YTAVCHTDAYTLSG D
Sbjct: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 145 PEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSGXXX------- 197
           PEG FP IL                 VK GDHVIALYTAECG+CKFC SG          
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 198 ---------------------------------------XXXXAVDKNAPMDSICLLGCG 218
                                                      A+D  AP+D+ CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180

Query: 219 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDF 278
           VTTGYGAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGASKII VD+N+ KK++   F
Sbjct: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240

Query: 279 GATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXX 338
           GATDFINPK DL + +TIV KL+EMTDGGL++TFDCTGNTK+MRDALEACHKGW      
Sbjct: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 339 XXXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPF 398
                     TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ+G LKV+EFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360

Query: 399 TEINNAFEDLHHGDCLRTVLDLSK 422
            EIN+AFEDLH+GDCLRTVL   +
Sbjct: 361 KEINHAFEDLHNGDCLRTVLKFDE 384

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  464 bits (1195), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 237/380 (62%), Positives = 266/380 (70%), Gaps = 46/380 (12%)

Query: 88  TTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEG 147
           +T+GKP+T  AAVAYEAGKPL+VE+I VDPPKAHEVRI++  TAVCHTDAYTLSG DPEG
Sbjct: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61

Query: 148 AFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGE---CKFCKSGXXXXXXXAVD 204
           AFPSIL               T+VK GDHV+ALYTAECG+   CK  K+           
Sbjct: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121

Query: 205 KN-------------------------------------------APMDSICLLGCGVTT 221
           K                                            AP++S CLLGCGVTT
Sbjct: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTT 181

Query: 222 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGAT 281
           GYGAA+KTANVQKGDTVA+FGAGTVGLSV QGAKARGAS+II+VD+ND KK++  +FGAT
Sbjct: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241

Query: 282 DFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXXXX 341
           DFINP TDL+ G+TIV KLIEMTDGGL++TFDCTGN KVMRDALEACHKGW         
Sbjct: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVA 301

Query: 342 XXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEI 401
                  TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ G LKVDEFIT+RRPF +I
Sbjct: 302 ASGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361

Query: 402 NNAFEDLHHGDCLRTVLDLS 421
           N AFEDLH GD LRTVL+ +
Sbjct: 362 NEAFEDLHAGDSLRTVLNYT 381

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  464 bits (1193), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 236/380 (62%), Positives = 257/380 (67%), Gaps = 46/380 (12%)

Query: 89  TQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA 148
           T+GKPI C AAVAYEAGKP  VE IVVDPPKAHEVRIKI  TAVCHTDAYTLSG DPEG 
Sbjct: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61

Query: 149 FPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSGXXX----------- 197
           FP +L               TNVK GDHVIALYTAEC +CKFC SG              
Sbjct: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121

Query: 198 -----------------------------------XXXXAVDKNAPMDSICLLGCGVTTG 222
                                                  A+D+ AP++S+CLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181

Query: 223 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATD 282
           YGAA+KTANVQKGDTVAVFG GTVGLSV+QGA  RGAS+II +D NDQKK +   FGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241

Query: 283 FINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXXXXX 342
           FINP  DLKE ETIV+KLIEMTDGGL++TFDCTGN  VMR ALEACHKGW          
Sbjct: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301

Query: 343 XXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEIN 402
                 TRPFQLVTGRVWKGSAFGG+KGRSEM GLI+ Y+ G LKVDEFITHRR F EIN
Sbjct: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361

Query: 403 NAFEDLHHGDCLRTVLDLSK 422
            AF+DLH+G CLRTVL  SK
Sbjct: 362 EAFDDLHNGLCLRTVLSFSK 381

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  451 bits (1159), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 230/381 (60%), Positives = 260/381 (68%), Gaps = 46/381 (12%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           MS TQGKPI CTAAVAY AG+PL +E + VDPPKAHEVRIKI  +A+CHTDAYTLSG DP
Sbjct: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60

Query: 146 EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSGXXXXXXXAVD- 204
           EG FP IL               TNVK GDHV+ LYTAEC +CKFC SG           
Sbjct: 61  EGLFPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120

Query: 205 -------------KNAPMDSIC-LLGCGVTTGY--------------------------- 223
                        +N   +++   +GC   + Y                           
Sbjct: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGV 180

Query: 224 ----GAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFG 279
               GAA+KTA+VQ+GDTVAVFGAGTVGLSVVQGAKAR AS+IIVVD+ND K++W+  FG
Sbjct: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240

Query: 280 ATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXX 339
           ATDFINPKTDLKEGETIV++LIEMTDGGL++TFDCTGNTKVMRDALEACHKGW       
Sbjct: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 340 XXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFT 399
                    TRPFQLVTGRVWKGSAFGGIKGRSEMGGL++DY NG LKV EF+TH+RPF 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360

Query: 400 EINNAFEDLHHGDCLRTVLDL 420
           EIN+ FEDLHHGDCLRTVL L
Sbjct: 361 EINSGFEDLHHGDCLRTVLSL 381

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  449 bits (1156), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 258/379 (68%), Gaps = 46/379 (12%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           MS+TQGK I C AAVAYEA KPL V+D++VD PKAHEVRIKI  TA+CHTDAYTLSGVDP
Sbjct: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60

Query: 146 EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSG----------- 194
           EG FP IL               T+VKVGDHVI LYTAEC +CKFCKSG           
Sbjct: 61  EGLFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120

Query: 195 -----------------------------------XXXXXXXAVDKNAPMDSICLLGCGV 219
                                                     A+DK   ++   LLGCGV
Sbjct: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180

Query: 220 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFG 279
           TTG+GAA+K ANVQKGDTVAVFGAGTVGLSVVQGA+ RG SK+IVVD+ND+KKQ+S DFG
Sbjct: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240

Query: 280 ATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXX 339
           ATDF+NP TDLK+GETIV+KLI MTDGGL+YTFDCTGN  VMR+ALEACHKGW       
Sbjct: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300

Query: 340 XXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFT 399
                    TRPFQLVTGRVW+G+AFG IKGR++M  L+ DY+ G LK+DEFITHRR F 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360

Query: 400 EINNAFEDLHHGDCLRTVL 418
           EIN+ FEDLH G CLRTVL
Sbjct: 361 EINDGFEDLHMGTCLRTVL 379

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  405 bits (1041), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 215/387 (55%), Positives = 246/387 (63%), Gaps = 59/387 (15%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           M+ T+G+ ITCTAAVAY AGKPLTVE I V+ P       +       H   Y   G   
Sbjct: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQD------HQHCYLPHGCVH 54

Query: 146 EGAFPS-------ILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSGXXX- 197
              F S                        T+VKVGDHVIALYTAEC ECK CKSG    
Sbjct: 55  SVWFGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNL 114

Query: 198 ---------------------------------------------XXXXAVDKNAPMDSI 212
                                                            A+D++AP++ +
Sbjct: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174

Query: 213 CLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKK 272
           CLLGCGVTTGYGAA+KTANVQKGDTVAVFGAGT+GLSVVQGAKAR ASKIIVVD+ND KK
Sbjct: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234

Query: 273 QWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGW 332
           +++ DFGATDF+NPKTDLK+G+TIV KL+EMTDGGL++TFD TGN +VMRDALEACHKGW
Sbjct: 235 KFAFDFGATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGW 294

Query: 333 XXXXXXXXXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFI 392
                           TRPFQLVTGRVWKGSAFGG+KGRSEMG LI+DY  GNLK+DEFI
Sbjct: 295 GQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFI 354

Query: 393 THRRPFTEINNAFEDLHHGDCLRTVLD 419
           T++RPF EIN  FEDLHHGDCLRTVL+
Sbjct: 355 TNKRPFKEINEGFEDLHHGDCLRTVLN 381

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  314 bits (804), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 166/381 (43%), Positives = 218/381 (57%), Gaps = 49/381 (12%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           M   +G+PI CTAAVAY   KPL +E I+VDPP+ HEVR+K+  TA+C TD +TL G++P
Sbjct: 1   MFYKEGEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNP 60

Query: 146 EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKS------------ 193
           EG FP +L                 VK GDHV+ LY  ECG C  CKS            
Sbjct: 61  EGKFPCVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKAT 120

Query: 194 -------------------------GXXXXXXXAV---------DKNAPMDSICLLGCGV 219
                                    G       AV           +AP+D ICLLGCGV
Sbjct: 121 QAQGVMPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGV 180

Query: 220 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFG 279
           TTG+GA I    V+ GD VAVFG+GTVGLSVVQ        ++IVVDV D K++W++ FG
Sbjct: 181 TTGFGAPI-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFG 239

Query: 280 ATDFINPKTDLKEGETIVSKLIEMTDG-GLEYTFDCTGNTKVMRDALEACHKGWXXXXXX 338
           ATDFINP+  + + ++++  LI+ + G G ++TFDCTG+T VMR ALE+C KGW      
Sbjct: 240 ATDFINPQ-KIPKNKSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVII 298

Query: 339 XXXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPF 398
                     T P+ L+ GR W+G AFGG+KGRSE+  L++ Y N  +K+DE+IT++RP 
Sbjct: 299 GLAGAGEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPL 358

Query: 399 TEINNAFEDLHHGDCLRTVLD 419
            EIN A ++L  G  L+TVLD
Sbjct: 359 KEINEALKELEDGLVLKTVLD 379

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 121/282 (42%), Gaps = 39/282 (13%)

Query: 72  SRSPLTQFIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTA 131
           SR PL      R  + +T   P +    + YE G  L  +D+ V  PK +E+ I + Y+ 
Sbjct: 13  SRRPL------RLRLQSTLSIPQSQKGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSG 66

Query: 132 VCHTDAYTLSGVDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECK 189
           VCHTD +   G  P GA  P +                TN ++GD+  I      C  C+
Sbjct: 67  VCHTDLHAWHGDWPLGAKLPLVGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCE 126

Query: 190 FCKSGXXXXXXXA------------------------VDKNAPMDSICLLGCGVTTGYGA 225
           FC+ G       A                        + K   +  +  + C   T Y  
Sbjct: 127 FCEQGNESNCAKADLSGYTHDGSFQQYATADAIQAAQIPKGTDLAQVAPILCAGVTVY-K 185

Query: 226 AIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFI 284
           A+K ++V+ G  VA+ G AG +G   VQ AKA G  +++ +D  D+K++     G   F+
Sbjct: 186 ALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFESLGGNHFV 244

Query: 285 NPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALE 326
               D  + + +VS++ E+T+GG     + + + K +  ++E
Sbjct: 245 ----DFTKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSVE 282

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score = 83.6 bits (205), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 108/256 (42%), Gaps = 33/256 (12%)

Query: 79  FIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAY 138
           F++  S  +T+   P T  A V YE G PL    I V  PK +E+ I + Y+ VCHTD +
Sbjct: 19  FLRLNSTTATSFKIPTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLH 78

Query: 139 TLSGVDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXX 196
              G  P     P +                 N ++GD+  I      C  C+ C+ G  
Sbjct: 79  AWKGDWPLAVKLPLVGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFE 138

Query: 197 XXXXXA------------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANV 232
                A                        + KN  +  +  + C   T Y  A+KTA+V
Sbjct: 139 SNCEQADLSGYTHDGSFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY-KALKTADV 197

Query: 233 QKGDTVAVFGA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLK 291
           + G  VA+ GA G +G   VQ AKA G  +++ +D  D+KK+     G   F+    D  
Sbjct: 198 KPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIFV----DFT 252

Query: 292 EGETIVSKLIEMTDGG 307
           +  +IV  + ++T+GG
Sbjct: 253 KTHSIVKDIQDVTNGG 268

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 87/390 (22%), Positives = 149/390 (38%), Gaps = 65/390 (16%)

Query: 64  ISIGKLPISRSPLTQFIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEV 123
           I+IG + + R+  +  I+  +       +P    A V Y A   L  ED  +  PK  + 
Sbjct: 6   IAIGGISLRRTFASSMIRKAN-------QPGMMKAMVYYGA-NDLRFEDRAI--PKIIDQ 55

Query: 124 R---IKIDYTAVCHTDAYTLSGVDPE---------GAFPS-ILXXXXXXXXXXXXXXXTN 170
           R   IK+  T++C TD     G  PE         G+F   +L                N
Sbjct: 56  RDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVKNEGSFNGRVLGHEGTGIVTEVGDAVRN 115

Query: 171 VKVGDHVIALYTAECGECKFCKSGXXX----------------------------XXXXA 202
           +K GD VI      CG C+ C  G                                   A
Sbjct: 116 IKKGDKVIISCITRCGTCENCARGMYAHCMNDGGWALGYSIDGTQAEYVRTPFADTSLYA 175

Query: 203 VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKI 262
           + +    ++  LL   + T +   ++  NV+ GD+VA+ GAG VG+  V  ++    S +
Sbjct: 176 LPEGLSDENAVLLSDALPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLL 235

Query: 263 IVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMR 322
           IVVD++D + + + + GAT  IN        E  V+K++E+T+G      DC       +
Sbjct: 236 IVVDMDDNRLEMAKEMGATHTINSGK-----EDAVAKILEITNG---RGVDCAMEAVGAQ 287

Query: 323 DALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVW--KGSAFGGIKGRSEMGGLIKD 380
              + C +                   +P      ++W    +   G+   +    L+K+
Sbjct: 288 PTWDICQQ----IIKEGGHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKN 343

Query: 381 YQNGNLKVDEFITHRRPFTEINNAFEDLHH 410
             +G L+ D+ ++H   F ++ N +    H
Sbjct: 344 CCSGKLQSDKLVSHHCNFKDMANNYNIFKH 373

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/326 (22%), Positives = 124/326 (38%), Gaps = 52/326 (15%)

Query: 125 IKIDYTAVCHTDAYTLSGVDPE---------GAFPS-ILXXXXXXXXXXXXXXXTNVKVG 174
           IK+ +T++C TD     G +PE         G+F   IL                N K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 175 DHVIALYTAECGECKFC----------------------------KSGXXXXXXXAVDKN 206
           D VI    + CG C+ C                            ++        +V +N
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHCTNGGGWILGYMIDGTQAEYVRTPFADTSLYSVPEN 179

Query: 207 APMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVD 266
              ++  +L   + T +   ++  NV+ GDTVA+ GAG VG+  V  ++    S +IVVD
Sbjct: 180 LSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGAGPVGMGCVLTSQLYSPSLLIVVD 239

Query: 267 VNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALE 326
           ++D +   + + G+T  IN        E  VSK++E T+G      DC       +   +
Sbjct: 240 IDDNRLAMAKEMGSTHTINSAK-----EDAVSKILEYTNG---RGVDCVMEAVGAQATWD 291

Query: 327 ACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVW--KGSAFGGIKGRSEMGGLIKDYQNG 384
            C +                   +P      ++W    +   G+   +  G L+K   +G
Sbjct: 292 ICQR----VIKEGGHLANVGVHGKPVNFEIDKLWIKNLTITSGLVNTNTTGMLMKSCCSG 347

Query: 385 NLKVDEFITHRRPFTEINNAFEDLHH 410
            LK +  +TH   F E++  +    H
Sbjct: 348 KLKSERLVTHHCNFGEMSGNYNIFKH 373

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 98/242 (40%), Gaps = 33/242 (13%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA-FPS 151
           P      + YE G  L  +D+ V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 45  PSMQKGVIFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 104

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                TN ++GD+  I      C  C+ C+ G       A        
Sbjct: 105 VGGHEGAGVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHADLSGYTHD 164

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGT 245
                           + K   +  I  + C   T Y  A+KTA+V+ G  VA+ G AG 
Sbjct: 165 GSFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY-KALKTADVRPGQWVAISGAAGG 223

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  +++ +D  + KK+   D G   FI    D +  + +V  + E T 
Sbjct: 224 LGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETFI----DFRTTKDMVGAIQEATQ 278

Query: 306 GG 307
           GG
Sbjct: 279 GG 280

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 101/367 (27%), Positives = 149/367 (40%), Gaps = 57/367 (15%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVV----DPPKAHEVRIKIDYTAVCHTDA-YTLSGVDPEG 147
           P T  A V  + G  +T EDI V    DP   H V++ I  T +C +D  Y  +G    G
Sbjct: 2   PETHKAVVLQKQGL-ITFEDIPVPQIEDP---HYVKLAIKKTGICGSDVHYYKTGAI--G 55

Query: 148 AF----PSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKSGXXXX-XXXA 202
            F    P +L               T+VKVGD V           K  KSG        A
Sbjct: 56  NFVVKDPMVLGHESSGVVVEVGSKVTSVKVGDRVAIEPGVPSRYSKATKSGHYNLCPSMA 115

Query: 203 VDKNAPMDSICL------------LGCGVTTGYGAAI----------KTANVQKGDTVAV 240
                P+D   L            L   V+   GA +          K A+V+ G  V V
Sbjct: 116 FAATPPIDGTLLKYYLSPEDFLVKLPDSVSFEEGACVEPLSVGVHANKLADVRFGSKVVV 175

Query: 241 FGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKL 300
           FGAG VGL     ++A GA+ ++ VDV D K + + +FGAT  +N  +  K  + +V ++
Sbjct: 176 FGAGPVGLLAGAVSRAFGATDVVFVDVFDHKLERTNEFGATQTVN-SSKFKSEDDLVKEI 234

Query: 301 IEMTDGGL-EYTFDCTGNTKVMRDALEACHKGWXXXXXXXXXXXX----XXXXTRPFQLV 355
             +  G   E  F+C+G    +R  ++AC  G                     ++  Q++
Sbjct: 235 QRVLSGEQPEVVFECSGAEVCIRAGIKACKAGGRYVQVGMGKDNVNFPISEVVSKELQVL 294

Query: 356 -TGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEINNAFE-DLHHG-D 412
            T R   G     +K  SE          G + V   ITHR  F +   A+E ++ HG D
Sbjct: 295 GTFRYCFGDYNDSVKLISE----------GKVNVKPLITHRFKFQDAIKAYEFNIEHGED 344

Query: 413 CLRTVLD 419
            ++T++D
Sbjct: 345 VVKTIID 351

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 115/283 (40%), Gaps = 45/283 (15%)

Query: 52  FNTQLNQNKLTNISIGKLPISRSPLTQFIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVE 111
           F     Q  L N    K  +SRS    F++  S  +     P T    + YE G  L  +
Sbjct: 2   FRLARAQTALAN----KASVSRS----FLRLNSSFAI----PETQKGVIFYENGGKLEYK 49

Query: 112 DIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA-FPSILXXXXXXXXXXXXXXXTN 170
           D+ V  PKA+E+ I + Y+ VCHTD +   G  P     P +                 N
Sbjct: 50  DLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGAGIVVAKGENVKN 109

Query: 171 VKVGDHV-IALYTAECGECKFCKSGXXXXXXXA------------------------VDK 205
            ++GD+  I      C  C+ C+ G       A                        + K
Sbjct: 110 FEIGDYAGIKWLNGSCMSCELCEQGYESNCLQADLSGYTHDGSFQQYATADAVQAAQIPK 169

Query: 206 NAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASKIIV 264
              +  I  + C   T Y  A+KTA+++ G  VA+ G AG +G   VQ AKA G  +++ 
Sbjct: 170 GTDLAEIAPILCAGVTVY-KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLG 227

Query: 265 VDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGG 307
           +D  D K++     G   FI    D ++ + +V+ + E T+GG
Sbjct: 228 IDGGDGKEELFKQCGGEVFI----DFRKSKDMVADIQEATNGG 266

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 90/343 (26%), Positives = 142/343 (41%), Gaps = 56/343 (16%)

Query: 114 VVDPPKAHEVRIKIDYTAVCHTDA-YTLSGVDPEGAF----PSILXXXXXXXXXXXXXXX 168
           + DP   H V+++I  T +C +D  Y ++G    G F    P IL               
Sbjct: 26  ITDP---HYVKLQIKKTGICGSDVHYYVAGAI--GDFVVKKPMILGHESSGLVVEVGSEV 80

Query: 169 TNVKVGDHVI------ALYTAE--CGECKFCKSGXXXXXXXAVDKN------APMDSICL 214
           + V+VGD V       + Y+ E   G    C           +D        AP D +  
Sbjct: 81  SRVRVGDRVAIEPGVPSRYSDETKAGRYNLCPH-MQFAATPPIDGTLVKYYLAPEDFLVK 139

Query: 215 LGCGVTTGYGAAI----------KTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIV 264
           L   V+   GA +          K A V     VAVFGAG VGL     A+A GAS+++ 
Sbjct: 140 LPDHVSYEEGALVEPLSVGVHANKLAGVAFNQRVAVFGAGPVGLLTGAVARAFGASEVVY 199

Query: 265 VDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGL--EYTFDCTGNTKVMR 322
           +DV + K   S +FG T F+N   ++K+ + +V K IE   GG   +  FDCTG    +R
Sbjct: 200 IDVFEHKLSLSSNFGGTQFVN-SANIKDEDDLV-KEIERVLGGARPDVVFDCTGAEICIR 257

Query: 323 DALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGL 377
             ++ C+ G                   P   +  +  K       AFG  +   ++   
Sbjct: 258 TGIKVCNSGG----TYVQVGMGHDDVNFPIGAIGAKELKVLGCFRYAFGDYRDAVQL--- 310

Query: 378 IKDYQNGNLKVDEFITHRRPFTEINNAFE-DLHHG-DCLRTVL 418
                +G++ V   +THR  F +   A+E ++ HG + ++T++
Sbjct: 311 ---IASGDVNVKPLVTHRFKFEDAEAAYEFNIKHGSEVIKTII 350

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 101/249 (40%), Gaps = 30/249 (12%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           + +T   P      + YE G PLT +D+ V  PK +E+ I + Y+ VCHTD +   G  P
Sbjct: 23  LQSTIAIPKMQKGVIFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWP 82

Query: 146 EGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA- 202
                P +                 N ++GD   I      C  C+ C+ G       A 
Sbjct: 83  LPVKLPLVGGHEGAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNCEHAD 142

Query: 203 -----------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVA 239
                                  + +   +  +  + C   T Y  A+KTA +Q G+ VA
Sbjct: 143 LSGYTHDGSFQQYATADATQAAQIPRGTDLAEVAPILCAGVTVY-KALKTAALQPGEWVA 201

Query: 240 VFGA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVS 298
           + GA G +G   +Q AKA G  +++ +D  + K +   + G   FI+  T  K  E ++ 
Sbjct: 202 ISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFKELGGETFID-FTKYKNNEAMIK 259

Query: 299 KLIEMTDGG 307
            + E T GG
Sbjct: 260 DIQEATKGG 268

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 106/262 (40%), Gaps = 37/262 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T  A + YE G PL   DI V  PKA E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 7   PRTQKAVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   K+GD   I      C  C++C+         A        
Sbjct: 67  VGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNCPEADLSGYTHD 126

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GT 245
                           +     +  +  + C   T Y  A+K+AN++ GD VA+ GA G 
Sbjct: 127 GSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKSANLRAGDWVAISGACGG 185

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   +Q A A G  +++ +D  ++K+Q     G   FI    D ++ + IV+ +++ T+
Sbjct: 186 LGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQLGGEVFI----DFRKSKDIVADVVKATN 240

Query: 306 GGLEYTFDCTGNTKVMRDALEA 327
           GG         N  V   A+E+
Sbjct: 241 GGAHGVI----NVSVSEAAIES 258

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 113/274 (41%), Gaps = 34/274 (12%)

Query: 80  IQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYT 139
           I T+   ST Q  P T    + YE   PL  +DI V  PK++E+ I ++Y+ VCHTD + 
Sbjct: 21  ILTKCYESTYQ-IPKTQKGVIFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHA 79

Query: 140 LSGVDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXX 197
             G  P     P +                 N K+GD   I      C  C+ C++G   
Sbjct: 80  WKGDWPLPVKLPLVGGHEGAGVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEA 139

Query: 198 XXXXA------------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQ 233
               A                        +     + ++  + C   T Y  A+KTA+++
Sbjct: 140 NCEHADLSGYTHDGSFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY-KALKTADLK 198

Query: 234 KGDTVAVFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKE 292
            GD VA+ G AG +G   VQ A A G  ++I +D  + KK+     G   FI    D  +
Sbjct: 199 PGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKCGGEVFI----DFTK 253

Query: 293 GETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALE 326
            + IV  + E T GG     + + + K +  +++
Sbjct: 254 SKDIVKDIQEATHGGPHGVINVSVSDKAISQSVQ 287

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 101/242 (41%), Gaps = 33/242 (13%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T  A + YE G  L   DI V  PK  E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   K+GD   I      C  C++C+         A        
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNCPDADLSGYTHD 123

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GT 245
                           + +   +  +  + C   T Y  A+K+A +Q G+ VA+ GA G 
Sbjct: 124 GSFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY-KALKSARLQAGEWVAISGASGG 182

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  +I+ +D  ++KK+   + G   FI    D  E + +V+++I++T+
Sbjct: 183 LGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYFI----DFAESKDVVAEVIKVTN 237

Query: 306 GG 307
           GG
Sbjct: 238 GG 239

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 106/267 (39%), Gaps = 37/267 (13%)

Query: 88  TTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-E 146
           ++Q  P +  A V YE    L  +DI V  PKA+E+ + + Y+ VCH+D +   G  P +
Sbjct: 2   SSQAIPESQKAIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPFQ 61

Query: 147 GAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSG----------- 194
             FP I                   KVGD   I      C  C++C+ G           
Sbjct: 62  LKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHLDGT 121

Query: 195 -------------XXXXXXXAVDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVF 241
                                + +N  +  +  + C   T Y  A+K AN+  G  V + 
Sbjct: 122 GFTHDGTFQEYATADAVQAAHLPENVDLAEVAPILCAGVTVY-KALKRANLIPGQWVTIS 180

Query: 242 GA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKL 300
           GA G +G   +Q A A G  ++I +D  + KKQ     G   FI    D  + + IV  +
Sbjct: 181 GACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEGLGGEVFI----DFTKEKDIVGAV 235

Query: 301 IEMTDGGLEYTFDCTGNTKVMRDALEA 327
           I+ TDGG         N  V   A+EA
Sbjct: 236 IKATDGGSHGVI----NVSVSEAAIEA 258

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 106/262 (40%), Gaps = 37/262 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA-FPS 151
           P T    + YE G  L  +DI V  PKA+E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKGVIFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPLPVKLPL 66

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   KVGD   I      C  C+ C+ G       A        
Sbjct: 67  VGGHEGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNCPEADLSGYTHD 126

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGT 245
                           +   A +  I  + C   T Y  A+K+AN+Q GD VA+ G AG 
Sbjct: 127 GSFQQYATADAVQAAKIPAGADLAEIAPILCAGITVY-KALKSANLQAGDWVAISGAAGG 185

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  +++ +D  ++K+Q     G   FI    D +  + I  ++I+ T+
Sbjct: 186 LGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQLGGEVFI----DFRTCKDIEGEIIKATN 240

Query: 306 GGLEYTFDCTGNTKVMRDALEA 327
           GG         N  V   A+E+
Sbjct: 241 GGAHGVI----NVSVSEAAIES 258

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 115/275 (41%), Gaps = 38/275 (13%)

Query: 60  KLTNISIGKLPISRSPLTQFIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPK 119
           K+T   +G+   S S L  F++   + ST+ G P+T  A + YE G  L  +DI V  PK
Sbjct: 3   KVTGACVGRSFASSSKL--FVR---LSSTSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPK 57

Query: 120 AHEVRIKIDYTAVCHTDAYTLSGVDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV- 177
            +E+ + + Y+ VCHTD +   G  P     P +                TN ++GD+  
Sbjct: 58  PNEILVNVKYSGVCHTDIHAWKGDWPLATKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAG 117

Query: 178 IALYTAECGECKFCKSGXXXXXXXA------------------------VDKNAPMDSIC 213
           +      C  C++C++G       A                        + +   +  + 
Sbjct: 118 VKWLNKSCMSCEYCETGHESNCAEADLSGYTRDGSFQQYATADAVQAAKIPQGTDLAQVA 177

Query: 214 LLGCGVTTGYGAAIKTANVQKGDTVAV-FGAGTVGLSVVQGAKARGASKIIVVDVNDQKK 272
            + C   T Y  A+KTAN+  G  VA+    G +G   VQ AKA G  +++ +D    K 
Sbjct: 178 PILCAGVTVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKD 235

Query: 273 QWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGG 307
                 G   FI    D  + + IV+ + E T+GG
Sbjct: 236 ALFKKLGGEVFI----DFTKSKDIVADIQEATNGG 266

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 106/270 (39%), Gaps = 44/270 (16%)

Query: 76  LTQFIQTRSIMSTTQGK-----------PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVR 124
           + +F  TR++  T+  K           P      + YE G PL  +DI V  PKA+E+ 
Sbjct: 1   MLRFTNTRTLQQTSLMKSFLRLQSTVTIPKMQKGVIFYETGGPLHYKDIPVPKPKANEIL 60

Query: 125 IKIDYTAVCHTDAYTLSGVDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYT 182
           I + Y+ VCHTD +   G  P     P +                   K+GD   I    
Sbjct: 61  INVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGSGEVVAMGENVKGWKIGDLAGIKWLN 120

Query: 183 AECGECKFCKSGXXXXXXXA------------------------VDKNAPMDSICLLGCG 218
             C  C+ C+SG       A                        + K   M  +  + C 
Sbjct: 121 GSCMSCELCESGHESNCEHADLSGYTHDGSFQQYATADAVQAARIPKGTNMAEVAPILCA 180

Query: 219 VTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMD 277
             T Y  A+K A+++ G  V + G AG +G   VQ AKA G  ++I +D    K++    
Sbjct: 181 GITVY-KALKEADMRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGPGKEELFKS 238

Query: 278 FGATDFINPKTDLKEGETIVSKLIEMTDGG 307
            G   F+    D  + + IV+++ E T GG
Sbjct: 239 LGGEIFV----DFTKTKDIVAEIQEATRGG 264

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 101/243 (41%), Gaps = 35/243 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T    + YE G  L  +DI V  PKA+E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 6   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 65

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   K+GD   I      C  C++C+         A        
Sbjct: 66  VGGHEGAGVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNCPEADLSGYTHD 125

Query: 203 --VDKNAPMDSI---------------CLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AG 244
               + A  D++                +L  GVT     A+K+AN++ GD VA+ G AG
Sbjct: 126 GSFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVY--KALKSANLKAGDWVAISGAAG 183

Query: 245 TVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMT 304
            +G   VQ AKA G  +++ +D  ++K +   D G   FI    D  + + I  ++IE T
Sbjct: 184 GLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDLGGEYFI----DFTKSKNIPEEVIEAT 238

Query: 305 DGG 307
            GG
Sbjct: 239 KGG 241

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 99/249 (39%), Gaps = 33/249 (13%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           + +T   P T    + YE    L  +DI V  PK +E+ I + Y+ VCHTD +   G  P
Sbjct: 24  LQSTAAIPKTQKGVIFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 146 EGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA- 202
                P +                   KVGD   I      C  C+FC+SG       A 
Sbjct: 84  LAVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNCPEAD 143

Query: 203 -----------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVA 239
                                  +     +  +  + C   T Y  A+K AN++ GD VA
Sbjct: 144 LSGYTHDGSFQQFATADAIQAAKIQPGTDLAEVAPILCAGVTVY-KALKEANLKAGDWVA 202

Query: 240 VFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVS 298
           + G AG +G   VQ A A G  +++ +D  ++K++     G   FI    D  + + +VS
Sbjct: 203 ISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKQLGGEVFI----DFTKTKDMVS 257

Query: 299 KLIEMTDGG 307
            + E T GG
Sbjct: 258 DIQEATKGG 266

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 104/258 (40%), Gaps = 35/258 (13%)

Query: 77  TQFIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTD 136
           T F+ T    ST    P T    + YE G  L  +D+ V  PK +E+ I + Y+ VCHTD
Sbjct: 29  TGFMGTLRFASTN--IPTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTD 86

Query: 137 AYTLSGVDP-EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSG 194
            +   G  P +   P +                TN ++GD   I      C  C+ C+ G
Sbjct: 87  LHAWKGDWPLDVKLPLVGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQG 146

Query: 195 XXXXXXXA------------------------VDKNAPMDSICLLGCGVTTGYGAAIKTA 230
                  A                        + K   +  +  + C   T Y  A+KTA
Sbjct: 147 HEPNCEHADLSGYTHDGSFQQYATADAVQAAQLPKGINLAEVAPILCAGVTVY-KALKTA 205

Query: 231 NVQKGDTVAVFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTD 289
           ++  G  VA+ G AG +G   VQ AKA G  +++ +D  D+KK+     G   FI+  T 
Sbjct: 206 DLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKLGGEIFIDYTTT 264

Query: 290 LKEGETIVSKLIEMTDGG 307
               + +V  + E T GG
Sbjct: 265 ----KDMVGAIQEATQGG 278

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/269 (24%), Positives = 106/269 (39%), Gaps = 37/269 (13%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           M+T    P T    + YE    L  +DI V  PKA+E+ I + Y+ VCHTD +   G  P
Sbjct: 1   MATLHAVPETQKGVIFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWP 60

Query: 146 EGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA- 202
                P +                   K+GD+  I      C  C++C+         A 
Sbjct: 61  LATKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNCPEAD 120

Query: 203 -----------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVA 239
                                  + +   +  +  + C   T Y  A+K+AN+  G+ VA
Sbjct: 121 LSGYTHDGSFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY-KALKSANLNAGEWVA 179

Query: 240 VFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVS 298
           + G AG +G   VQ AKA G  +I+ +D  D+KK    + G   F+    D  + + +  
Sbjct: 180 ISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIFV----DFTKSKNVEQ 234

Query: 299 KLIEMTDGGLEYTFDCTGNTKVMRDALEA 327
            ++  T+GG         N  V   A+E+
Sbjct: 235 DILVATNGGAHGVI----NVSVSEAAIES 259

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 97/242 (40%), Gaps = 33/242 (13%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T    + YE+G  L  +DI V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 33  PTTQKGVIFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 92

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                 N ++GD   I      C  C+ C+ G       A        
Sbjct: 93  VGGHEGAGVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNCLHADLSGYTHD 152

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGT 245
                           + K   +  +  + C   T Y  A+KTA+++ G  VA+ G AG 
Sbjct: 153 GSFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY-KALKTADLKPGQWVAISGAAGG 211

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  +I+ +D    K++     G   FI    D  + + IVS + E T 
Sbjct: 212 LGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVFI----DFTKTKDIVSAIQEATK 266

Query: 306 GG 307
           GG
Sbjct: 267 GG 268

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 113/269 (42%), Gaps = 38/269 (14%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           MS  Q  P T  A + YE G  L  +DI V  PK++E+ I I Y+ VCHTD +   G  P
Sbjct: 1   MSAPQ-IPETQKAVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWP 59

Query: 146 -EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCK----------- 192
                P +                   K+GD+  I      C  C++C+           
Sbjct: 60  LPTKLPLVGGHEGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNCPDAD 119

Query: 193 --------SGXXXXXXXAVD--KNAP---MDSICLLGCGVTTGYGAAIKTANVQKGDTVA 239
                   S        AV   + AP   +  +  + C   T Y  A+K+AN++ G+ VA
Sbjct: 120 LSGYTHDGSFQQYATADAVQAARIAPGTDLAEVAPVLCAGITVY-KALKSANLRAGEWVA 178

Query: 240 VFGA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVS 298
           + GA G +G   +Q AKA G  +++ +D  D+K     + G   FI    D  + + +V 
Sbjct: 179 ISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALFKELGGEVFI----DFTKTKDVVK 233

Query: 299 KLIEMTDGGLEYTFDCTGNTKVMRDALEA 327
            +++ T+GG         N  V   A+EA
Sbjct: 234 AVVDATNGGAHGVI----NVSVSEAAIEA 258

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 110/263 (41%), Gaps = 33/263 (12%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T  A +    G  L  +DI V  PK++E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFETNGGKLEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   K+GD+  I      C  C++C+ G       A        
Sbjct: 67  VGGHEGAGVVVAMGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNCPHADLSGYTHD 126

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GT 245
                           +   + +  +  + C   T Y  A+K+AN++ G+ VA+ GA G 
Sbjct: 127 GSFQQYATADAVQAARIAPGSDLAEVAPVLCAGITVY-KALKSANLRAGEWVAISGACGG 185

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   +Q AKA G  +++ +D  D+K +   D G   FI    D  + + IV  +I+ T+
Sbjct: 186 LGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKDLGGEVFI----DFTKTKDIVGDIIKATN 240

Query: 306 GGLEYTFDCTGNTKVMRDALEAC 328
           GG     + + + + +  +++ C
Sbjct: 241 GGAHGVINVSVSEQAIDASVKYC 263

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 106/262 (40%), Gaps = 37/262 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T    + YE G  L  +DI V  PKA+E+ I + Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKGVIFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPLDVKLPL 66

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   K+GD+  I      C  C++C+         A        
Sbjct: 67  VGGHEGAGVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNCPEADLSGYTHD 126

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GT 245
                           + +   +  +  + C   T Y  A+K+AN+  G+ VA+ GA G 
Sbjct: 127 GSFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSANLSAGEWVAISGACGG 185

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   +Q AKA G  +I+ +D  D+K     + G   FI    D  + + I + +IE T+
Sbjct: 186 LGSLAIQYAKAMG-YRILGIDGGDEKAALFKELGGEVFI----DFTKTKDIEAAVIEATN 240

Query: 306 GGLEYTFDCTGNTKVMRDALEA 327
           GG         N  V   A+E+
Sbjct: 241 GGAHGVI----NVSVSEAAIES 258

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 111/275 (40%), Gaps = 35/275 (12%)

Query: 79  FIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAY 138
           F Q R  +S+T   P T    + YE+G  L  +D+ V  P+ +E+ + + Y+ VCHTD +
Sbjct: 14  FGQLR--LSSTISIPSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLH 71

Query: 139 TLSGVDP-EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXX 196
              G  P +   P +                 N ++GD   I      C  C+ C+ G  
Sbjct: 72  AWKGDWPLDTKLPLVGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHE 131

Query: 197 XXXXXA------------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANV 232
                A                        + K   +  +  + C   T Y  A++++  
Sbjct: 132 SNCAHADLSGYTHDGTFQQYATADAIQAAHIPKGTDLAGVAPILCAGVTVY-KALRSSGA 190

Query: 233 QKGDTVAVFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLK 291
           + G+ VA+ G AG +G    Q A+A G  +++ +D  + K +     G   FI    D  
Sbjct: 191 RPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFKSLGGEIFI----DFT 245

Query: 292 EGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALE 326
           + + I + ++E T GG     + + + K M  ++E
Sbjct: 246 KEKDIPAAILEATQGGAHGVINVSVSEKAMSQSVE 280

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 100/251 (39%), Gaps = 34/251 (13%)

Query: 85  IMSTTQGK-PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGV 143
           + ST  G  P T  A V YE G PL  +DI V  PKA+E+ I + Y+ VCHTD +   G 
Sbjct: 28  LQSTAAGSIPKTQKAVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGD 87

Query: 144 DP-EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXX 201
            P     P +                   KVGD   I      C  C+ C++G       
Sbjct: 88  WPLPTKLPLVGGHEGSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNCEH 147

Query: 202 A------------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDT 237
           A                        + +   +  +  + C   T Y  A+K A+++ G  
Sbjct: 148 ADLSGYTHDGSFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY-KALKEADLKAGQW 206

Query: 238 VAVFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETI 296
           V + G AG +G   VQ AKA G  ++I +D    K++     G   FI    D  + + +
Sbjct: 207 VCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFKSMGGEVFI----DFTKSKDM 261

Query: 297 VSKLIEMTDGG 307
           V  + E T GG
Sbjct: 262 VKDIQEATKGG 272

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 113/266 (42%), Gaps = 44/266 (16%)

Query: 74  SPLTQ--FIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTA 131
           SPL +  F   R++ ++    P T    + YE G  L  +DI V  PK +E+ I + Y+ 
Sbjct: 12  SPLRKGAFGSIRTLATSV---PETQKGVIFYENGGKLEYKDIPVPKPKPNEILINVKYSG 68

Query: 132 VCHTDAYTLSGVDPEGAFPSIL-XXXXXXXXXXXXXXXTNVK---VGDHV-IALYTAECG 186
           VCHTD +   G  P    P+ L                 NVK   +GD   I      C 
Sbjct: 69  VCHTDLHAWKGDWP---LPTKLPLVGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCM 125

Query: 187 ECKFCKSGXXXXXXXA------------------------VDKNAPMDSICLLGCGVTTG 222
            C++C+         A                        + K   +  +  + C   T 
Sbjct: 126 SCEYCELSNESNCPDADLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTV 185

Query: 223 YGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGAT 281
           Y  A+K+AN++ GD VA+ G AG +G   VQ AKA G  +++ +D  ++K +     G  
Sbjct: 186 Y-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGGE 243

Query: 282 DFINPKTDLKEGETIVSKLIEMTDGG 307
            F+    D  + + +V+++ E+T+GG
Sbjct: 244 AFV----DFTKTKDMVAEIQEITNGG 265

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 93/211 (44%), Gaps = 41/211 (19%)

Query: 228 KTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN-- 285
           K A V+ G TV VFGAG VGL     AKA GAS ++ VDV DQK + + +FGAT  IN  
Sbjct: 163 KLAKVRFGQTVVVFGAGPVGLLTGAVAKAFGASDVVFVDVFDQKLERAKNFGATHVINST 222

Query: 286 --PKTDLKEGETIVSKLIEMTDGGL-EYTFDCTGNTKVMRDALEACHKGWXXXXXXXXXX 342
             PK D +     V KL+    G L +  F+C+G    +   ++A   G           
Sbjct: 223 KLPKNDPQALADEVEKLL---GGALADVVFECSGAESCIDAGVKATKNGGTM-------- 271

Query: 343 XXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMG---------GLIKDYQN----GNLKVD 389
                     Q+  G+ +       + G+ EM          G  KD  N    G + V 
Sbjct: 272 ---------VQIGMGKNYVNFPIAEVSGK-EMTLVGCFRYSYGDYKDAVNLVSTGRVDVK 321

Query: 390 EFITHRRPFTEINNA--FEDLHHGDCLRTVL 418
           + ITHR  F +   A  F   H G+ ++T++
Sbjct: 322 KLITHRFSFEDAAKAYDFNIAHGGEVVKTII 352

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 100/249 (40%), Gaps = 33/249 (13%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           + +T   P T    + YE    L  +DI V  PK +E+ I + Y+ VCHTD +   G  P
Sbjct: 24  LQSTAAIPKTQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 146 EGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA- 202
                P +                   KVGD   I      C  C+FC+SG       A 
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNCPDAD 143

Query: 203 -----------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVA 239
                                  + +   +  +  + C   T Y  A+K A+++ GD VA
Sbjct: 144 LSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALKEADLKAGDWVA 202

Query: 240 VFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVS 298
           + G AG +G   VQ A A G  +++ +D  ++K++     G   FI    D  + + +VS
Sbjct: 203 ISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVFI----DFTKTKNMVS 257

Query: 299 KLIEMTDGG 307
            + E T GG
Sbjct: 258 DIQEATKGG 266

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 99/249 (39%), Gaps = 33/249 (13%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           + +T   P T    + YE    L  +DI V  PK +E+ I + Y+ VCHTD +   G  P
Sbjct: 24  LQSTIAIPQTQKGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 146 EGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA- 202
                P +                   KVGD   I      C  C+FC+SG       A 
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNCPDAD 143

Query: 203 -----------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVA 239
                                  + +   +  +  + C   T Y  A+K AN++ GD VA
Sbjct: 144 LSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALKEANLKAGDWVA 202

Query: 240 VFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVS 298
           + G AG +G   VQ A A G  +++ +D   +K++     G   FI    D  + + +VS
Sbjct: 203 ISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEKEKLFKQLGGEVFI----DFTKTKDMVS 257

Query: 299 KLIEMTDGG 307
            + E T GG
Sbjct: 258 DIQEATKGG 266

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 92/201 (45%), Gaps = 16/201 (7%)

Query: 121 HEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIAL 180
           +++ IK  Y  V + ++Y   G+ P  A P+IL                N ++GD V   
Sbjct: 52  NDIIIKNKYAGVNYIESYFRKGIYP-CALPAILGREASGVVVDKGTNIKNFEIGDKV--A 108

Query: 181 YTAECGECKFCKSGXXXXXXXAVDKNAPMDSICLLGCGVTTGYGA---AIKTANVQKGDT 237
           Y   C   +F K         + D  +  + + L   G+  G  A     +   V+KGD 
Sbjct: 109 YIGNCSMAQFTKIDNSMIMKLSSD--STNEDLKLYAAGILQGLTALSFVTEAYEVKKGDY 166

Query: 238 VAVFGA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETI 296
           + V+ A G  GL   Q  KARGA  +I V  +D+K Q + + GA   IN KTD      I
Sbjct: 167 ILVYAAAGGAGLIFDQLIKARGAH-VIAVCSSDEKLQLAKENGAEYLINSKTD-----DI 220

Query: 297 VSKLIEMTDG-GLEYTFDCTG 316
           ++K++E+TD  G++  FD  G
Sbjct: 221 LTKVMEITDNKGVQAAFDSVG 241

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 100/239 (41%), Gaps = 31/239 (12%)

Query: 121 HEVRIKIDYTAVCHTDAYTLSGVDPEGAF----PSILXXXXXXXXXXXXXXXTNVKVGDH 176
           H V+++I  T +C +D +  +     G+F    P +L               T V VGD 
Sbjct: 31  HFVKVQIKATGICGSDVHFCTH-GAIGSFIVKEPMVLGHESSGIVVEVGSEVTKVAVGDR 89

Query: 177 VI------ALYTAE--CGECKFCKSGXXXXXXXAVDK------NAPMDSICLLGCGVTTG 222
           V       + Y+ E   G    C  G        VD         P D +  L   VT  
Sbjct: 90  VAIEPGYPSRYSEETVSGHYNLC-PGMKFAATPPVDGTLLKYFQVPEDFVYKLPDDVTFE 148

Query: 223 YGA----------AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKK 272
            GA          A+K A V+ GD V VFGAG VGL V    KA GA++++ +DV D+K 
Sbjct: 149 EGALVEPLAVAVHAVKLAGVKFGDKVVVFGAGPVGLLVGSVCKAFGATEVVSIDVVDKKL 208

Query: 273 QWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKG 331
             S++ G+T  IN K D+ E    +    ++         DCTG    +R ++ AC  G
Sbjct: 209 DKSLEMGSTIAINSK-DMAEEALALEIQNDLNGQHPNKVIDCTGAEPCLRSSILACKPG 266

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 115/286 (40%), Gaps = 37/286 (12%)

Query: 68  KLPISRSPLTQFIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKI 127
           +LP S S   +  +  S  +     P T    + YE G  L  +DI V  PK +E+ I I
Sbjct: 8   RLPRSVSLFGRLTRLNSSFTI----PATQKGVIFYENGGELHYKDIAVPKPKPNEILINI 63

Query: 128 DYTAVCHTDAYTLSGVDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAEC 185
            Y+ VCHTD +   G  P     P +                TN ++GD   +    + C
Sbjct: 64  KYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGAGVVVAKGKDVTNFEIGDLAGVKWLNSSC 123

Query: 186 GECKFCKSGXXXXXXXA------------------------VDKNAPMDSICLLGCGVTT 221
             C++C+ G       A                        + K+  +  +  + C   T
Sbjct: 124 MACEYCELGHESNCAKADLSGYTHDGSFQQYATADAIQAAPIPKDTDLAEVAPILCAGVT 183

Query: 222 GYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGA 280
            Y  A+KT+  + G  VA+ G AG +G   VQ A A G  +++ +D  + K++     G 
Sbjct: 184 VY-KALKTSGAKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGG 241

Query: 281 TDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALE 326
             F+    D  + + +VS + E T+GG     + + +   ++ + E
Sbjct: 242 EVFV----DFTKTKDMVSAIQEATNGGPHAVVNVSVSEAAIQQSTE 283

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 110/269 (40%), Gaps = 38/269 (14%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           MS +Q  P T  A + YE G  L  +DI V  PK++E+ I + Y+ VCHTD +   G  P
Sbjct: 1   MSASQ-IPKTQKAVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWP 59

Query: 146 -EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA- 202
                P +                   K+GD+  I      C  C++C+         A 
Sbjct: 60  LPTKLPLVGGHEGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNCPEAD 119

Query: 203 -----------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVA 239
                                  +     +  +  + C   T Y  A+K+AN++ G+ VA
Sbjct: 120 LSGYTHDGSFQQYATADAVQAARIPAGTDLAEVAPVLCAGITVY-KALKSANLRAGEWVA 178

Query: 240 VFGA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVS 298
           + GA G +G   +Q AKA G  +++ +D  ++K     + G   FI    D  + + +V 
Sbjct: 179 ISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALFKELGGEVFI----DFTKTKDVVK 233

Query: 299 KLIEMTDGGLEYTFDCTGNTKVMRDALEA 327
            +++ T+GG         N  V   A+EA
Sbjct: 234 AVVDATNGGAHGVI----NVSVSEAAIEA 258

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 105/262 (40%), Gaps = 37/262 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA-FPS 151
           P T    + YE+   L  +DI V  PKA+E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   K+GD+  I      C  C++C+ G       A        
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHD 123

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGT 245
                           + +   +  +  + C   T Y  A+K+AN+  G  VA+ G AG 
Sbjct: 124 GSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY-KALKSANLMAGHWVAISGAAGG 182

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  +++ +D  + K++     G   FI    D  + + IV  +++ TD
Sbjct: 183 LGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFI----DFTKEKDIVGAVLKATD 237

Query: 306 GGLEYTFDCTGNTKVMRDALEA 327
           GG         N  V   A+EA
Sbjct: 238 GGAHGVI----NVSVSEAAIEA 255

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 100/249 (40%), Gaps = 33/249 (13%)

Query: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145
           + +T   P T    + YE    L  +DI V  PK +E+ I + Y+ VCHTD +   G  P
Sbjct: 24  LQSTAAIPETQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 146 EGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA- 202
                P +                   K+GD   I      C  C+FC+SG       A 
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNCPDAD 143

Query: 203 -----------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVA 239
                                  + +   +  +  + C   T Y  A+K A+++ GD VA
Sbjct: 144 LSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALKEADLKAGDWVA 202

Query: 240 VFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVS 298
           + G AG +G   VQ A A G  +++ +D  ++K++     G   FI    D  + + +VS
Sbjct: 203 ISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVFI----DFTKTKDMVS 257

Query: 299 KLIEMTDGG 307
            + E T GG
Sbjct: 258 DIQEATKGG 266

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 109/262 (41%), Gaps = 37/262 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T  A + YE+G  L  +D+ V  PK +E+ I I Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKAVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           I                   K+GD+  +      C  C+ C+         A        
Sbjct: 67  IGGHEGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNCPEADLSGYTHD 126

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GT 245
                           + + A +  +  + C   T Y  A+K+A++  G+ VA+ GA G 
Sbjct: 127 GSFQEYCTADAVQAARIPQGADLAEVAPILCAGVTVY-KALKSADLAAGEWVAISGACGG 185

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  +++ +D  ++KK+   + G   F+    D +  + + + +I+ T+
Sbjct: 186 LGSLAVQFAKAMGL-RVLGIDGGEEKKKMFHEMGGEVFL----DFRLEKDMEAAVIKATN 240

Query: 306 GGLEYTFDCTGNTKVMRDALEA 327
           GG         N  V   A+EA
Sbjct: 241 GGAHGVI----NVSVSEAAIEA 258

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 106/262 (40%), Gaps = 37/262 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T    + YE+   L  +DI V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   KVGD   I    + C  C++C+ G       A        
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLSGYTHD 123

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGT 245
                           + +   +  +  + C   T Y  A+K+AN++ G  VA+ G AG 
Sbjct: 124 GSFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY-KALKSANLRAGHWVAISGAAGG 182

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  +++ +D  + K++     G   FI    D  + + IVS +++ TD
Sbjct: 183 LGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVFI----DFTKEKDIVSAVVKATD 237

Query: 306 GGLEYTFDCTGNTKVMRDALEA 327
           GG         N  V   A+EA
Sbjct: 238 GGAHGIV----NVSVSEAAIEA 255

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 71/265 (26%), Positives = 109/265 (41%), Gaps = 43/265 (16%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSI 152
           P T    + YE+   L  +DI V  PKA+E+ I + Y+ VCHTD +   G  P    P+ 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWP---LPTK 60

Query: 153 L-XXXXXXXXXXXXXXXTNVK---VGDHV-IALYTAECGECKFCKSGXXXXXXXA----- 202
           L                 NVK   +GD+  I      C  C++C+ G       A     
Sbjct: 61  LPLVGGHEGAGVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGY 120

Query: 203 -------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG- 242
                              + +   +  +  + C   T Y  A+K+AN+  G  VA+ G 
Sbjct: 121 THDGSFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY-KALKSANLMAGHWVAISGA 179

Query: 243 AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIE 302
           AG +G   VQ AKA G  +++ +D  + K++     G   FI    D  + + IV+ +++
Sbjct: 180 AGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFI----DFTKEKDIVNAVLK 234

Query: 303 MTDGGLEYTFDCTGNTKVMRDALEA 327
            TDGG         N  V   A+EA
Sbjct: 235 ATDGGAHGVI----NVSVSEAAIEA 255

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 102/250 (40%), Gaps = 37/250 (14%)

Query: 105 GKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA-FPSILXXXXXXXXXX 163
           G PL  ++I V  PKA+E+ I + Y+ VCHTD +   G  P     P +           
Sbjct: 18  GGPLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGIVVA 77

Query: 164 XXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------------------- 202
                 N  +GD+  I      C  C+ C+         A                    
Sbjct: 78  MGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNCPQADLSGYTHDGSFQQYATADAV 137

Query: 203 ----VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKAR 257
               +     +  +  + C   T Y  A+K+AN++ GD VA+ GA G +G   +Q A A 
Sbjct: 138 QAAKIPHGTDLAEVAPILCAGVTVY-KALKSANLKAGDWVAISGACGGLGSLAIQYATAM 196

Query: 258 GASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGN 317
           G  +++ +D  ++K +     G   FI    D  + + ++++++E+TDGG         N
Sbjct: 197 G-YRVLGIDGGEEKAELFKKLGGEYFI----DFTKCKDVIAEILEVTDGGAHGVI----N 247

Query: 318 TKVMRDALEA 327
             V   A+EA
Sbjct: 248 VSVSEAAIEA 257

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 103/265 (38%), Gaps = 35/265 (13%)

Query: 72  SRSPLTQ--FIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDY 129
           +R+ LT   F Q       T   P      + YE G  L  EDI V  PK +E+ I + Y
Sbjct: 6   TRASLTARPFFQGSFRTMATASIPEKQKGIIFYENGGELKYEDIPVPKPKPNELLINVKY 65

Query: 130 TAVCHTDAYTLSGVDP-EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGE 187
           + VCHTD +   G  P     P +                   K+GD   I      C  
Sbjct: 66  SGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGENVKGWKIGDLAGIKWLNGSCLS 125

Query: 188 CKFCKSGXXXXXXXA------------------------VDKNAPMDSICLLGCGVTTGY 223
           C++C+         A                        + +   +  +  + C   T Y
Sbjct: 126 CEYCEKSNESNCPHADLSGYTHDGSFQQYATADYVQAARIPEGTDLAEVSPILCAGVTVY 185

Query: 224 GAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATD 282
             A+K+AN++ GD VA+ G AG +G   VQ AKA G  +++ +D   +K +     G   
Sbjct: 186 -KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGAEKGELVKKLGGEV 243

Query: 283 FINPKTDLKEGETIVSKLIEMTDGG 307
           FI    D  + + +V  + E T+GG
Sbjct: 244 FI----DFTKHKNLVEAVQEATNGG 264

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 107/264 (40%), Gaps = 33/264 (12%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA-FPS 151
           P T  A +    G  L  +DI V  PK+ E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFETNGGKLEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPLATKLPL 66

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   KVGD   I      C  C++C+ G       A        
Sbjct: 67  VGGHEGAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNCPNADLSGYTHD 126

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGT 245
                           + +   +  +  + C   T Y  A+K+AN++ G+ VA+ G AG 
Sbjct: 127 GSFQQYATADAVQAARIPQGTDLAEVAPVLCAGITVY-KALKSANLRAGEWVAISGAAGG 185

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  +I+ +D  ++K++   + G   FI    D  + + IV  +I+ T+
Sbjct: 186 LGSLAVQYAKAMG-YRILGIDGGEEKEKLFRELGGEIFI----DFTKTKDIVGDIIKATN 240

Query: 306 GGLEYTFDCTGNTKVMRDALEACH 329
           GG     + + +   +  + E C 
Sbjct: 241 GGAHGVINVSVSEAAIGASTEYCR 264

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 107/262 (40%), Gaps = 37/262 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T  A + Y+ G PL  +D+ V  PK +E+ I I Y+ VCHTD +   G  P +   P 
Sbjct: 7   PQTQKAVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           I                   K+GD+  +      C  C+ C+         A        
Sbjct: 67  IGGHEGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNCPEADLSGYTHD 126

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GT 245
                           + +   +  +  L C   T Y  A+K+A++  G  VA+ GA G 
Sbjct: 127 GSFQEYCTADAVQAARIPQGTDLAQVAPLLCAGVTVY-KALKSADLAAGQWVAISGACGG 185

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   +Q AKA G  +++ +D  ++KK+   + G   F+    D +  + + + +I+ T+
Sbjct: 186 LGSLAIQFAKAMGL-RVLGIDGGEEKKKMFHELGGEVFL----DFRLEKDMEAAIIKATN 240

Query: 306 GGLEYTFDCTGNTKVMRDALEA 327
           GG         N  V   A+E+
Sbjct: 241 GGAHGVI----NVSVSEAAIES 258

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 104/262 (39%), Gaps = 37/262 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA-FPS 151
           P T    + YE+   L  +DI V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPL 63

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   KVGD   I    + C  C++C+ G       A        
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLSGYTHD 123

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGT 245
                           + +   +  +  + C   T Y  A+K+AN++ G  VA+ G AG 
Sbjct: 124 GSFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY-KALKSANLRAGHWVAISGAAGG 182

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  +++ +D    K++     G   FI    D  + + IV  +I+ TD
Sbjct: 183 LGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVFI----DFTKEKDIVGAVIKATD 237

Query: 306 GGLEYTFDCTGNTKVMRDALEA 327
           GG         N  V   A+EA
Sbjct: 238 GGAHGIV----NVSVSEAAIEA 255

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 105/262 (40%), Gaps = 37/262 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T  A + YE+   L  +DI V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   K+GD+  I      C  C++C+ G       A        
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHD 123

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGT 245
                           + +   +  +  + C   T Y  A+K+AN++ G   A+ G AG 
Sbjct: 124 GSFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY-KALKSANLRAGHWAAISGAAGG 182

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  +++ +D    K++     G   FI    D  + + IVS +++ T+
Sbjct: 183 LGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVFI----DFTKEKDIVSAVVKATN 237

Query: 306 GGLEYTFDCTGNTKVMRDALEA 327
           GG         N  V   A+EA
Sbjct: 238 GGAHGII----NVSVSEAAIEA 255

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 108/263 (41%), Gaps = 39/263 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA-FPS 151
           P T    + YE+   L  +DI V  PKA+E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                    +GD   I      C  C++C+ G       A        
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHD 123

Query: 203 --VDKNAPMDSI-------------C--LLGCGVTTGYGAAIKTANVQKGDTVAVFG-AG 244
               + A  DS+             C  +L  G+T  Y  A+K+AN+  G  VA+ G AG
Sbjct: 124 GSFQQYATADSVQAAHIPKGTDLAECAPVLCAGITV-Y-KALKSANLSAGQWVAISGAAG 181

Query: 245 TVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMT 304
            +G   VQ AKA G  +++ +D  + K++     G   FI+  T+    + IV  +I+ T
Sbjct: 182 GLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVFIDFTTE----KDIVGAVIKAT 236

Query: 305 DGGLEYTFDCTGNTKVMRDALEA 327
           DGG         N  V   A+EA
Sbjct: 237 DGGAHGII----NVSVSEAAIEA 255

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 99/257 (38%), Gaps = 37/257 (14%)

Query: 98  AAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPSILXXX 156
           A V YE    L  +D+ V  PK +E+ + + Y+ VCH+D +   G  P +  FP I    
Sbjct: 12  AIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 157 XXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSG--------------------- 194
                          KVGD   I      C  C++C+ G                     
Sbjct: 72  GAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYLDGTGFTHDGTFQE 131

Query: 195 ---XXXXXXXAVDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSV 250
                      +  N  +  +  + C   T Y  A+K ANV  G  V + GA G +G   
Sbjct: 132 YATADAVQAAHIPPNVNLAEVAPILCAGITVY-KALKRANVIPGQWVTISGACGGLGSLA 190

Query: 251 VQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEY 310
           +Q A A G  ++I +D  + K++     G   FI    D  E + IV  +I+ T+GG   
Sbjct: 191 IQYALAMG-YRVIGIDGGNAKRKLFEQLGGEIFI----DFTEEKDIVGAIIKATNGGSHG 245

Query: 311 TFDCTGNTKVMRDALEA 327
                 N  V   A+EA
Sbjct: 246 VI----NVSVSEAAIEA 258

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 103/244 (42%), Gaps = 37/244 (15%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSI 152
           P T  A +  E G  L  +DI V  PK++E+ I + Y+ VCH+D +   G         +
Sbjct: 7   PKTQKAIIFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQG--DLPLPLKL 64

Query: 153 LXXXXXXXXXXXXXXXTNV---KVGDHV-IALYTAECGECKFCKSGXXXXXXXA------ 202
                           +NV   K+GD+  I      C  C+FC+         A      
Sbjct: 65  PLVGGHEGAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADFTGTV 124

Query: 203 ------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA- 243
                             + +   + +I  L C   T Y  A+K+AN++ G  VA+ GA 
Sbjct: 125 HDGSFQQYATADAVQAARIPQGTDLAAIAPLLCAGLTAY-KALKSANMRPGQWVAISGAC 183

Query: 244 GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEM 303
           G +G   +Q A A G  +++ +D  ++K ++    G   FI    D K+ + +V+ +I+ 
Sbjct: 184 GGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKTLGGEVFI----DYKKSKDVVADVIKA 238

Query: 304 TDGG 307
           TDGG
Sbjct: 239 TDGG 242

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 104/262 (39%), Gaps = 34/262 (12%)

Query: 73  RSPLTQFIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAV 132
           RS   QF++ +S +S     P T    + YE G  L  +DI V  PK +E+ + + Y+ V
Sbjct: 11  RSNFKQFLRLQSTVSI----PQTQKGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGV 66

Query: 133 CHTDAYTLSGVDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKF 190
           CHTD +   G  P     P +                 N ++GD   I      C  C+ 
Sbjct: 67  CHTDLHAWKGDWPLSVKLPLVGGHEGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCEL 126

Query: 191 CKSGXXXXXXXA------------------------VDKNAPMDSICLLGCGVTTGYGAA 226
           C+SG       A                        + +   +  +  + C   T Y  A
Sbjct: 127 CESGHESNCEHADLSGYTHDGSFQQYATADAVQAAKIPEGTNLAEVAPVLCAGITVY-KA 185

Query: 227 IKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           +K A++  G  V + G AG +G   VQ  KA G  ++I +D    K++     G   FI+
Sbjct: 186 LKEASLSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFKSLGGEVFID 244

Query: 286 PKTDLKEGETIVSKLIEMTDGG 307
             T  K    +V+ + + T+GG
Sbjct: 245 -FTKQKTDSDMVAAIQKATNGG 265

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 105/267 (39%), Gaps = 37/267 (13%)

Query: 88  TTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-E 146
           ++Q  P T  A V YE    L  +D+ V  PK +E+ + + Y+ VCH+D +   G  P +
Sbjct: 2   SSQVVPKTQKAIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQ 61

Query: 147 GAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSG----------- 194
             FP I                   KVGD   I      C  C++C+ G           
Sbjct: 62  LKFPLIGGHEGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHLDGT 121

Query: 195 -------------XXXXXXXAVDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVF 241
                                + +N  +  +  + C   T Y  A+K AN+  G  V + 
Sbjct: 122 GFTHDGTFQEYATADAVQAAHIPQNVDLAEVAPILCAGITVY-KALKRANLMPGQWVTIS 180

Query: 242 GA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKL 300
           GA G +G   VQ A A G  ++I +D  + K++   +     FI    D  + + +V  +
Sbjct: 181 GACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEELHGEIFI----DFTKEKDVVGAV 235

Query: 301 IEMTDGGLEYTFDCTGNTKVMRDALEA 327
           I+ TDGG         N  V   A+EA
Sbjct: 236 IKATDGGSHGVI----NVSVSEAAIEA 258

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 106/262 (40%), Gaps = 37/262 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA-FPS 151
           P T  A V    G  L  +DI V  P A+E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKAVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPL 63

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   K+GD   I      C  C+ C+         A        
Sbjct: 64  VGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESNCPHADLSGYTHD 123

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGT 245
                           + +   +  +  + C   T Y  A+K+AN++ G+ VA+ G AG 
Sbjct: 124 GSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALKSANLRAGNWVAISGAAGG 182

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  ++I +D  D+K+Q     G   F+    D ++ + +V++++E+T 
Sbjct: 183 LGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYFV----DFRKSKDVVAEILEVTG 237

Query: 306 GGLEYTFDCTGNTKVMRDALEA 327
           GG         N  V   A+E+
Sbjct: 238 GGAHGVV----NVSVSEAAIES 255

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 107/265 (40%), Gaps = 37/265 (13%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T  A +    G PL  +DI V  PK++E+ + I Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKAIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   K+GD+  +      C  C++C+ G       A        
Sbjct: 67  VGGHEGAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNCPNADLSGYTHD 126

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GT 245
                           +     +  +  + C   T Y  A+K+AN++ G+ VA+ GA G 
Sbjct: 127 GSFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY-KALKSANLRAGEWVAISGACGG 185

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   +Q A A G  +++ +D  D K +         FI    D  + + ++S++ ++T+
Sbjct: 186 LGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQLHGEVFI----DFTKTKDVISEVNKVTN 240

Query: 306 GGLEYTFDCTGNTKVMRDALEACHK 330
           GG         N  V   A+EA  K
Sbjct: 241 GGAHGVI----NVSVSEAAIEASTK 261

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 103/267 (38%), Gaps = 37/267 (13%)

Query: 88  TTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-E 146
           ++Q  P T  A V YE    L  +D+ V  PK +E+ + + Y+ VCH+D +   G  P +
Sbjct: 2   SSQAIPKTQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQ 61

Query: 147 GAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSG----------- 194
             FP I                   KVGD   I      C  C++C+ G           
Sbjct: 62  LKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHLDGT 121

Query: 195 -------------XXXXXXXAVDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVF 241
                                + +N  +  +  + C   T Y  A+K AN+  G  V + 
Sbjct: 122 GFTHDGTFQEYATADAVQAAHIPQNVNLAEVAPILCAGITVY-KALKRANLMPGQWVTIS 180

Query: 242 GA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKL 300
           GA G +G   +Q A A G  ++I +D  + K++     G   FI    D  +   +   +
Sbjct: 181 GACGGLGSLAIQYALAMG-FRVIGIDGGEAKRKLFEKLGGEIFI----DFTKERDVAGAV 235

Query: 301 IEMTDGGLEYTFDCTGNTKVMRDALEA 327
           I+ T+GG         N  V   A+EA
Sbjct: 236 IKATNGGSHGII----NVSVSEAAIEA 258

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 102/245 (41%), Gaps = 39/245 (15%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSI 152
           P T    + YE G  L  +DI V  PKA+E+ I + Y+ VCHTD +   G  P    P+ 
Sbjct: 4   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWP---LPTK 60

Query: 153 L-XXXXXXXXXXXXXXXTNVK---VGDHV-IALYTAECGECKFCKSGXXXXXXXA----- 202
           L                 NVK   +GD   I      C  C++C+         A     
Sbjct: 61  LPLVGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNCPDADLSGY 120

Query: 203 -------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA 243
                              + K   +  +  + C   T Y  A+K+A+++ GD VA+ GA
Sbjct: 121 THDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALKSADLKAGDWVAISGA 179

Query: 244 -GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIE 302
            G +G   +Q AKA G  +++ +D   +K +   + G   F+    D    + ++ ++++
Sbjct: 180 CGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEYFV----DYAVSKDLIKEIVD 234

Query: 303 MTDGG 307
            T+GG
Sbjct: 235 ATNGG 239

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 95/200 (47%), Gaps = 15/200 (7%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           A + A ++ G    VFGAG VGL   + A   GA+ ++ VD+++ K + +  FGAT  +N
Sbjct: 163 ANRLAKMRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGATHMVN 222

Query: 286 PKTDLKEG---ETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWXXXXXXXXXX 342
              DL +G   ET++ K I     G +  F+C+G    +R  +E C  G           
Sbjct: 223 -SGDLPQGVSAETVIRKAI--GKKGADVVFECSGAQPCIRTGIEVCKAGGTYVQVGMGQE 279

Query: 343 XXXXXXTR-PFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEI 401
                 ++ P + +T   ++GS F   +G  +    I+   +G L +   IT R  F E 
Sbjct: 280 EIQFPISKIPAKEIT---FQGS-FRYCQG--DYSDSIELVSSGKLSLKPLITRRYQFKEA 333

Query: 402 NNAFEDL--HHGDCLRTVLD 419
             AF++   H  D ++T+++
Sbjct: 334 IEAFDENRDHPLDNVKTIIE 353

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/265 (26%), Positives = 106/265 (40%), Gaps = 43/265 (16%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSI 152
           P T    + YE+   L  +DI V  PKA+E+ I + Y+ VCHTD +   G  P    P+ 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWP---LPTK 60

Query: 153 L-XXXXXXXXXXXXXXXTNVK---VGDHV-IALYTAECGECKFCKSGXXXXXXXA----- 202
           L                 NVK   +GD   I      C  C++C+ G       A     
Sbjct: 61  LPLVGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLSGY 120

Query: 203 -------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG- 242
                              V     +  +  + C   T Y  A+K+AN+  G  VA+ G 
Sbjct: 121 THDGSFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY-KALKSANLMAGHWVAISGA 179

Query: 243 AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIE 302
           AG +G   VQ AKA G  ++I +D  + K++     G   F+    D  + + IV  +++
Sbjct: 180 AGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVFV----DFTKEKDIVGAVLK 234

Query: 303 MTDGGLEYTFDCTGNTKVMRDALEA 327
            T+GG         N  V   A+EA
Sbjct: 235 ATNGGAHGVI----NVSVSEAAIEA 255

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 84/337 (24%), Positives = 133/337 (39%), Gaps = 53/337 (15%)

Query: 121 HEVRIKIDYTAVCHTDA--YTLSGVDPEGAF----PSILXXXXXXXXXXXXXXXTNVKVG 174
           H V++ I  T +C +D   Y   G+   G +    P +L               T VKVG
Sbjct: 31  HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGEVVEVGNAVTRVKVG 87

Query: 175 DHVI------ALYTAECGECKF--CKSGXXXXXXXAVDKN------APMDSICLLGCGVT 220
           D V       + Y+ E  E ++  C           +D        +P D +  L  GV+
Sbjct: 88  DRVAIEPGVPSRYSDETKEGRYNLCPH-MAFAATPPIDGTLVKYYLSPEDFLVKLPEGVS 146

Query: 221 TGYGAAI----------KTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQ 270
              GA +          K A V+    V VFGAG VGL     A+A GAS ++ VDV D 
Sbjct: 147 YEEGACVEPLSVGVHSNKLAGVRFSTRVVVFGAGPVGLLTGAVARAFGASDVVFVDVFDN 206

Query: 271 KKQWSMDFGATD-FINPKTDLKEGETIVSKLIEMTDGG-LEYTFDCTGNTKVMRDALEAC 328
           K Q + DFGAT+ F + K    + + + S++ ++  G   +  F+C+G    +   ++  
Sbjct: 207 KLQRAKDFGATNTFNSSKIPTDKAQELASEVEKLLGGNHADVVFECSGADVCIDAGVKVT 266

Query: 329 HKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLIKDYQN 383
             G                   P   V+G+  K       +FG  +    +         
Sbjct: 267 KVGG----TMVQVGMGKNYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNL------VAT 316

Query: 384 GNLKVDEFITHRRPFTEINNAFED--LHHGDCLRTVL 418
           G + V   ITHR  F +   A++    H GD ++T++
Sbjct: 317 GKVNVKPLITHRFKFEDAAKAYDYNISHGGDVVKTII 353

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 106/265 (40%), Gaps = 37/265 (13%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T    + YE+   L  ++I V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   KVGD   +    + C  C++C+ G       A        
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNCPHADLSGYTHD 123

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGT 245
                           + +   +  +  + C   T Y  A+K+AN++ G+ VA+ G AG 
Sbjct: 124 GSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALKSANLRAGNWVAISGAAGG 182

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  +++ +D    K++     G   FI    D  + + I+  +++ TD
Sbjct: 183 LGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVFI----DFTKEKDIIGAVVKATD 237

Query: 306 GGLEYTFDCTGNTKVMRDALEACHK 330
           GG         N  V   A+EA  K
Sbjct: 238 GGAHGII----NVSVSEAAIEASTK 258

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 113/284 (39%), Gaps = 38/284 (13%)

Query: 73  RSPLTQFIQTRSIMS-TTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTA 131
           RS  T    TR ++  ++   P T  A V YE G  L   DI V  PK +E+ + I Y+ 
Sbjct: 8   RSTQTVSRATRLVIRLSSTAIPTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSG 67

Query: 132 VCHTDAYTLSG---VDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGE 187
           VCHTD +   G   + P+   P +                TN ++GD+  +      C E
Sbjct: 68  VCHTDLHAWKGDWAIKPK--LPLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCME 125

Query: 188 CKFCKSG------------------------XXXXXXXAVDKNAPMDSICLLGCGVTTGY 223
           C+FC+ G                                +     +  +  + C   T Y
Sbjct: 126 CEFCQKGFEPNCETPTLSGYTHDGTFQQYATADAIHAAHIPPGTDLAKVAPILCAGITVY 185

Query: 224 GAAIKTANVQKGDTVAV-FGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATD 282
             A+KTA +  G  VA+    G +G   VQ A A G  +++ +D  ++K+      G   
Sbjct: 186 -KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMG-YRVVGIDGGNEKEALFRSLGGET 243

Query: 283 FINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALE 326
           F+    D  + + IVS + E T GG     + + +T  +  ++E
Sbjct: 244 FV----DFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQSVE 283

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 110/287 (38%), Gaps = 69/287 (24%)

Query: 99  AVAYEAGKPLTVEDIVVDPPKAHEVRIKID--YTAVCHTD----------------AYTL 140
           A+AY   K +   D +  P  +HE  ++ID  +  VC +D                 + +
Sbjct: 3   ALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTHAM 62

Query: 141 SGVDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVI--ALYTAE-------------- 184
           SG       P  +               + VKVGDHV+  A  T E              
Sbjct: 63  SG----QGLPQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHEREG 118

Query: 185 -CGECKF---------------CKSGXXXXXXXAVDKNA-------PMDSICLLGCGVTT 221
            C  CK                C+SG         ++N        P+D   L+     +
Sbjct: 119 LCIACKTGNPNCCTDLGFCGLGCQSGGFAEKIVLSERNVVKIPNSLPLDVAALVEPISVS 178

Query: 222 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGAT 281
            +  A++ + +Q G T  V GAG +GL+ V   ++ GA  IIV +  D ++Q +   GA 
Sbjct: 179 WH--AVRISKLQPGQTALVLGAGPIGLAAVLALQSHGAGTIIVSEPADTRRQKAEALGAQ 236

Query: 282 DFINPKTDLKEGETIVSKLIEMTDG--GLEYTFDCTGNTKVMRDALE 326
            F NP    + G+ ++  L ++  G  G  +++DC G ++     L 
Sbjct: 237 TF-NPT---EHGDNVIEALRKLAPGGEGFNFSYDCCGTSETFSAGLH 279

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 95/242 (39%), Gaps = 33/242 (13%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T  A V  E G  L   DI V   KA+E+ I + Y+ VCH+D Y      P     P 
Sbjct: 17  PKTQKAMVFSEYGGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPL 76

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGX--------------- 195
           +                 N K+GD   +    + C  C+ C+ G                
Sbjct: 77  VGGHEGAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSCLKSEYNGFTRN 136

Query: 196 -XXXXXXAVDK--------NAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GT 245
                  AVD         N  +  +    C   T Y  AIK+AN++ G  +A+ GA G 
Sbjct: 137 GSFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY-KAIKSANIRAGQWMAITGACGG 195

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   +Q  KA G  +++ +D  + K     + G   FI    D  + + +V+ ++  T+
Sbjct: 196 LGSVAIQYCKAMG-YRVVGIDAGEAKANLFKELGGEVFI----DFTKSKDLVADVVSATN 250

Query: 306 GG 307
           GG
Sbjct: 251 GG 252

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 102/246 (41%), Gaps = 40/246 (16%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSI 152
           P T  A V    G  L  +DI V  P+ +E+ I + Y+ VCHTD +   G  P    P+ 
Sbjct: 6   PKTQKAVVFDTNGGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWP---LPTK 62

Query: 153 LXXXXXXXXXXXXXXXTNV-----KVGDHV-IALYTAECGECKFCKSGXXXXXXXA---- 202
           L                ++     ++GD   I      C  C++C+         A    
Sbjct: 63  LPLVGGHEGAGIVVAKGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNCPQADLSG 122

Query: 203 --------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG 242
                               V K   +  +  + C   T Y  A+K+AN++ G+ VA+ G
Sbjct: 123 YTHDGSFQQYATADAVQAARVPKGTDLAEVAPILCAGITVY-KALKSANLRAGEWVAISG 181

Query: 243 A-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLI 301
           A G +G   VQ AKA G  +++ +D  D+K +     G   FI    D  + + +++++I
Sbjct: 182 ASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQLGGEYFI----DFTKSKDVIAEVI 236

Query: 302 EMTDGG 307
           + TDGG
Sbjct: 237 KATDGG 242

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 82/188 (43%), Gaps = 11/188 (5%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           A K A ++ G    VFGAG +GL   + A   GA+ ++ VD+ + K + +  FGAT  +N
Sbjct: 163 ANKLAKIKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHIVN 222

Query: 286 PKTDLKEGETIVSKLIEMTDG--GLEYTFDCTGNTKVMRDALEACHKGWXXXXXXXXXXX 343
              DL  G T V  +I+   G  G +  F+C+G    +R  +E C  G            
Sbjct: 223 -SGDLPHGVT-VDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAGGTIVQVGMGQEE 280

Query: 344 XXXXXTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEIN 402
                  P  ++ T  +     F   +G  +    I+   +  L +  FITHR  F +  
Sbjct: 281 IQF----PISIIPTKELTFQGCFRYCQG--DYSDSIELVSSRKLSLKPFITHRYSFKDAV 334

Query: 403 NAFEDLHH 410
            AFE+  H
Sbjct: 335 EAFEETSH 342

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 104/262 (39%), Gaps = 37/262 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA-FPS 151
           P T    + YE   PL  +DI V  P  +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 6   PKTQKGVIFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPL 65

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   KVGD+  I      C  C+ C+         A        
Sbjct: 66  VGGHEGAGVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNCPEADLSGYTHD 125

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GT 245
                           +   A + +I  + C   T Y  AIK+AN++ GD +A+ GA G 
Sbjct: 126 GSFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVY-KAIKSANLKAGDWLAISGACGG 184

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   +Q  KA G  +I+ +D   +K++     G   FI    D  + + I++++ + T+
Sbjct: 185 LGSLAIQYGKAMG-FRILGIDGGAEKEELFKKLGGEYFI----DFTQCKDIIAEVKKATN 239

Query: 306 GGLEYTFDCTGNTKVMRDALEA 327
           GG         N  V   A+EA
Sbjct: 240 GGAHGVI----NVSVSEAAIEA 257

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 103/244 (42%), Gaps = 40/244 (16%)

Query: 121 HEVRIKIDYTAVCHTDAYTLSGVDPEGAF-------PSILXXXXXXXXXXXXXXXTNVKV 173
           H+V+I+I  T +C +D +  +    +G+        P +L               ++VKV
Sbjct: 29  HDVKIQIKATGICGSDVHYFT----QGSIGDFVVKSPLVLGHESAGVVVEVGDAVSSVKV 84

Query: 174 GDHVI------ALYTAE--CGECKFCKSGXXXXXXXAVDKN------APMDSICLLGCGV 219
           GD V       + Y+ E   G    C            D        +P D +  L   +
Sbjct: 85  GDRVAVEPGVPSRYSKETMSGHYNLCPH-MAFAATPPYDGTLVKYYLSPEDFVYKLADHI 143

Query: 220 TTGYGAAI----------KTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVND 269
           +   GA +          + AN   G  V V GAG VGL     AKA GA+ ++ VD+ +
Sbjct: 144 SFEEGAVVEPLSVAVHANRLANTAFGQAVLVLGAGPVGLLAGAVAKAFGATDVVFVDIFE 203

Query: 270 QKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGL--EYTFDCTGNTKVMRDALEA 327
            K + +  FGAT  +  K D  E + +   L+  + GGL  +  F+C+G  K +R A+++
Sbjct: 204 SKLEKAKQFGATRTVLFKPDSDENDLV--SLVTKSLGGLHPDVVFECSGAEKCIRAAVKS 261

Query: 328 CHKG 331
             +G
Sbjct: 262 VKRG 265

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 53/93 (56%), Gaps = 2/93 (2%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           A K A V  G  V VFGAG VGL     AKA GAS++I VDV D K + +  FGAT  IN
Sbjct: 161 ANKLAKVHFGSVVVVFGAGPVGLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTIN 220

Query: 286 PKTDLK-EGETIVSKLIEMTDGGL-EYTFDCTG 316
            K+  + EG+ + + +     G L +  F+C+G
Sbjct: 221 SKSLPRGEGDAVSAAVSNYLGGALADVVFECSG 253

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 89/347 (25%), Positives = 134/347 (38%), Gaps = 60/347 (17%)

Query: 113 IVVDPPKAHEVRIKIDYTAVCHTDA--YTLSGVDPEGAF----PSILXXXXXXXXXXXXX 166
           I+ DP   H V+I I  T +C +D   Y   G+   G +    P +L             
Sbjct: 26  IIEDP---HYVKIAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGS 79

Query: 167 XXTNVKVGDHVI------ALYTAECGECKF--CKSGXXXXXXXAVDKN------APMDSI 212
             T VKVGD V       + Y+ E  E ++  C           +D        +P D +
Sbjct: 80  AVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPH-MAFAATPPIDGTLVKYYLSPEDFL 138

Query: 213 CLLGCGVTTGYGAAI----------KTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKI 262
             L  GV+   GA +          K A V+ G  V VFGAG VGL     A+A GAS +
Sbjct: 139 VKLPEGVSYEEGACVEPLSVGVHSNKLAGVRFGSRVVVFGAGPVGLLTGAVARAFGASDV 198

Query: 263 IVVDVNDQKKQWSMDFGATDFIN----PKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNT 318
           + +DV D K   + +FGAT   N    P    +E    V KL  ++    +  F+C+G  
Sbjct: 199 VFIDVFDNKLDRAKEFGATHTFNSSKFPADKTQELADEVEKL--LSGHHADIVFECSGAD 256

Query: 319 KVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVWK-----GSAFGGIKGRSE 373
             +   ++    G                   P   V+G+  K       +FG  +    
Sbjct: 257 ACIDAGVKITKVGG----TMVQIGMGKNYTNFPIAEVSGKEMKLIGCFRYSFGDYR---- 308

Query: 374 MGGLIKDYQNGNLKVDEFITHRRPFTEINNA--FEDLHHGDCLRTVL 418
               +K   +G + V   ITHR  F +   A  F   H G+ ++T++
Sbjct: 309 --DAVKLVASGKVNVKAMITHRFKFEDAAKAYDFNIAHGGEVVKTII 353

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 101/262 (38%), Gaps = 37/262 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T  A + YE G PL  +DI V  P A E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   K+GD+  I      C  C+ C+         A        
Sbjct: 67  VGGHEGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNCPEADLSGYTHD 126

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GT 245
                           + +   +  +  + C   T Y  A+K+AN+  GD VA+ GA G 
Sbjct: 127 GSFQQYATADAVQAAKIPQGTDLAEVAPVLCAGITVY-KALKSANLSAGDWVAISGACGG 185

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   +Q A A G  +++ +D   +K +     G   FI    D    + +  ++I+ T+
Sbjct: 186 LGSLCIQYATAMG-YRVLGIDGGAEKAELFKQLGGEVFI----DFTTCKDVEGEIIKATN 240

Query: 306 GGLEYTFDCTGNTKVMRDALEA 327
           GG         N  V   A+E+
Sbjct: 241 GGAHGVI----NVSVSEAAIES 258

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 84/343 (24%), Positives = 135/343 (39%), Gaps = 55/343 (16%)

Query: 115 VDPPKAHEVRIKIDYTAVCHTDA--YTLSGVDPEGAF----PSILXXXXXXXXXXXXXXX 168
           +D P  H V++ I  T +C +D   Y   G+   G +    P +L               
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAV 81

Query: 169 TNVKVGDHVI------ALYTAECGECKF--CKSGXXXXXXXAVDKN------APMDSICL 214
           T VK+GD V         Y+ E  E ++  C           +D        +P D +  
Sbjct: 82  TRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPH-MAFAATPPIDGTLVRYYLSPEDFLVK 140

Query: 215 LGCGVTTGYGAAI----------KTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIV 264
           L  GV+   GA +          K A V+ G  V VFGAG VGL     A A GAS +I 
Sbjct: 141 LPDGVSYEEGACVEPLSVGVHSNKLAGVRFGTRVVVFGAGPVGLLTGAVAHAFGASDVIF 200

Query: 265 VDVNDQKKQWSMDFGATD-FINPKTDLKEGETIVSKLIEMTDG-GLEYTFDCTGNTKVMR 322
           VDV D + Q + DFGA+  F + K  + E + +  ++ ++  G   +  F+C+G    + 
Sbjct: 201 VDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVEKLLGGHHADVVFECSGADVCID 260

Query: 323 DALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGL 377
             ++    G                   P   V+G+  +       +FG  +    +   
Sbjct: 261 AGVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEMRLIGCFRYSFGDYRDAVNL--- 313

Query: 378 IKDYQNGNLKVDEFITHRRPFTEINNAFED--LHHGDCLRTVL 418
                +G + V   ITHR  F +   A++    H GD ++T++
Sbjct: 314 ---VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDVVKTII 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 84/343 (24%), Positives = 135/343 (39%), Gaps = 55/343 (16%)

Query: 115 VDPPKAHEVRIKIDYTAVCHTDA--YTLSGVDPEGAF----PSILXXXXXXXXXXXXXXX 168
           +D P  H V++ I  T +C +D   Y   G+   G +    P +L               
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAV 81

Query: 169 TNVKVGDHVI------ALYTAECGECKF--CKSGXXXXXXXAVDKN------APMDSICL 214
           T VK+GD V         Y+ E  E ++  C           +D        +P D +  
Sbjct: 82  TRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPH-MAFAATPPIDGTLVRYYLSPEDFLVK 140

Query: 215 LGCGVTTGYGAAI----------KTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIV 264
           L  GV+   GA +          K A V+ G  V VFGAG VGL     A A GAS +I 
Sbjct: 141 LPDGVSYEEGACVEPLSVGVHSNKLAGVRFGTRVVVFGAGPVGLLTGAVAHAFGASDVIF 200

Query: 265 VDVNDQKKQWSMDFGATD-FINPKTDLKEGETIVSKLIEMTDG-GLEYTFDCTGNTKVMR 322
           VDV D + Q + DFGA+  F + K  + E + +  ++ ++  G   +  F+C+G    + 
Sbjct: 201 VDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVEKLLGGHHADVVFECSGADVCID 260

Query: 323 DALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGL 377
             ++    G                   P   V+G+  +       +FG  +    +   
Sbjct: 261 AGVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEMRLIGCFRYSFGDYRDAVNL--- 313

Query: 378 IKDYQNGNLKVDEFITHRRPFTEINNAFED--LHHGDCLRTVL 418
                +G + V   ITHR  F +   A++    H GD ++T++
Sbjct: 314 ---VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDVVKTII 353

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 104/266 (39%), Gaps = 38/266 (14%)

Query: 74  SPLTQFIQTRSIMSTTQGK-----PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKID 128
           +P   F   R I +  Q +     P      V  E    L   DI V  PK++E+ I + 
Sbjct: 12  TPSKSFYLGRLIGARYQSQFAPNIPKVQKGVVFTEHNGELKYTDIPVPTPKSNEILINVK 71

Query: 129 YTAVCHTDAYTLSGVDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECG 186
           Y+ VCHTD +   G  P     P +                   K+GD   I      C 
Sbjct: 72  YSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCM 131

Query: 187 ECKFCKSGXXXXXXXA------------------------VDKNAPMDSICLLGCGVTTG 222
            C+ C++G       A                        + + + +  I  + C   T 
Sbjct: 132 SCELCETGHEANCEHADLSGYTHDGSFQQYATADAVQAARIPEGSDLAQIAPILCAGITV 191

Query: 223 YGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGAT 281
           Y  A+KTAN++ G+ VA+ G AG +G   VQ AKA G  +++ +D  ++K++     G  
Sbjct: 192 Y-KALKTANLKPGEWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGE 249

Query: 282 DFINPKTDLKEGETIVSKLIEMTDGG 307
            F+    D  + + IV+ +   T GG
Sbjct: 250 VFV----DFTKSKDIVADIQNATKGG 271

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 58/104 (55%), Gaps = 6/104 (5%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           A++ +  +KG +  + GAG +GL+ +   KA GASKI+V ++ ++++  +   G   F +
Sbjct: 184 AVRVSKFEKGKSALILGAGPIGLAAILALKAHGASKIVVSELAERRRILASKMGVEVF-D 242

Query: 286 PKTDLKEGETIVSKLIEMTDG--GLEYTFDCTGNTKVMRDALEA 327
           P    K G+  V++L  +  G  G +Y FDC+G       AL+A
Sbjct: 243 PS---KHGDNAVTELRNIPRGQHGFDYAFDCSGVKATFNTALKA 283

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 97/242 (40%), Gaps = 33/242 (13%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA-FPS 151
           P T    + YE    L  +DI V  P  +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 7   PETQKGVIFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPLPVKLPL 66

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                 N KVGD+  I      C  C+ C+ G       A        
Sbjct: 67  VGGHEGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQADLSGYTHD 126

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GT 245
                           +     +  +  + C   T Y  A+K+A ++ G  VA+ GA G 
Sbjct: 127 GSFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLTVY-KALKSAELEAGQWVAISGACGG 185

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  +++ +D  D+K +   + G   FI    D  + + I+ ++++ T+
Sbjct: 186 LGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKELGGEYFI----DFTKCKDIIGEVVKATN 240

Query: 306 GG 307
           GG
Sbjct: 241 GG 242

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 109/275 (39%), Gaps = 38/275 (13%)

Query: 80  IQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYT 139
           +Q  + MS+    P T  A V  + G PL   +I V  PK  E+ I + Y+ VCHTD + 
Sbjct: 29  LQPVATMSSPS-IPKTQHAIVFDKNGGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHA 87

Query: 140 LSGVDP-EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXX 197
             G  P     P +                   +VGD   I      C  C+ C+ G   
Sbjct: 88  WKGDWPLPTKLPLVGGHEGAGVVVAMGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHES 147

Query: 198 XXXXA------------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQ 233
               A                        +     +  +  + C   T Y  A+K+AN++
Sbjct: 148 NCPEADLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKSANLR 206

Query: 234 KGDTVAVFGA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKE 292
            G+ VA+ GA G +G   +Q A+A G  +++ +D  D+K+      G   F+    D ++
Sbjct: 207 AGNWVAISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRKLGGEVFV----DFRK 261

Query: 293 GETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEA 327
            + +V+ +++ T GG         N  V   A+E+
Sbjct: 262 SKDVVADVVKATGGGAHGVI----NVSVSEAAIES 292

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 103/262 (39%), Gaps = 37/262 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T    + YE    L  +D+ V  PK  E+ I + Y+ VCHTD +   G  P +   P 
Sbjct: 9   PKTQKGVIFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPL 68

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   K+GD   I      C  C+ C+         A        
Sbjct: 69  VGGHEGAGVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNCPEADLSGYTHD 128

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGT 245
                           + + A M  +  + C   T Y  A+K+A ++ GD VA+ G AG 
Sbjct: 129 GSFQQYATADAVQAAHIPQGADMAEVAPILCAGVTVY-KALKSAELKAGDWVAISGAAGG 187

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ AKA G  +++ +D  D+K+++    G   F+    D    + IV  + E T+
Sbjct: 188 LGSLAVQYAKAMG-YRVLGIDGGDEKEKFFKSMGGEVFV----DFMTCKDIVGAVKEATN 242

Query: 306 GGLEYTFDCTGNTKVMRDALEA 327
           GG      C  N  V   A+EA
Sbjct: 243 GG---AHGCI-NVSVSEKAIEA 260

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 89/344 (25%), Positives = 134/344 (38%), Gaps = 67/344 (19%)

Query: 121 HEVRIKIDYTAVCHTDA--YTLSGVDPEGAF----PSILXXXXXXXXXXXXXXXTNVKVG 174
           H V++ I  T +C +D   Y   G+   G +    P +L               T VKVG
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAVTRVKVG 87

Query: 175 DHVI------ALYTAECGECKF--CKSGXXXXXXXAVDKN------APMDSICLLGCGVT 220
           D V       + Y+ E  E ++  C           +D        +P D +  L  GV+
Sbjct: 88  DRVAIEPGVPSRYSDETKEGRYNLCPH-MAFAATPPIDGTLVKYYLSPEDFLVKLPEGVS 146

Query: 221 TGYGAAI----------KTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQ 270
              GA +          K A V+ G  V VFGAG VGL     A+A GA+ +I VDV D 
Sbjct: 147 YEEGACVEPLSVGVHSNKLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDN 206

Query: 271 KKQWSMDFGATDFINPK-------TDLKEGETIVSKLIEMTDGG--LEYTFDCTGNTKVM 321
           K Q + DFGAT+  N          DL +G   V KL+    GG   +  F+C+G    +
Sbjct: 207 KLQRAKDFGATNTFNSSQFSTDKAQDLADG---VQKLL----GGNHADVVFECSGADVCI 259

Query: 322 RDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVWK-----GSAFGGIKGRSEMGG 376
             A++    G                   P   V+G+  K       +FG  +    +  
Sbjct: 260 DAAVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNL-- 313

Query: 377 LIKDYQNGNLKVDEFITHRRPFTEINNAFED--LHHGDCLRTVL 418
                  G + V   ITH+  F +   A++    H G+ ++T++
Sbjct: 314 ----VATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 94/258 (36%), Gaps = 60/258 (23%)

Query: 122 EVRIKIDYTAVCHTDAYTLS----------GVDPEGA--FPSILXXXXXXXXXXXXXXXT 169
           EV I++ +  +C TD +  S          G  P      P  +               T
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 170 NVKVGDHVIALYTAECGE--------------CKFCKSGXXXXXXXA------------- 202
            VKVGDHV+      C +              C  C+ G       A             
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFTGLGTSGGGFA 147

Query: 203 ------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSV 250
                       + K+ P+D   L+     T + A  K A  QKG T  V GAG +GL+ 
Sbjct: 148 ERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KVAGFQKGQTACVLGAGPIGLAT 205

Query: 251 VQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDG--GL 308
           +   K  GASKI+V ++   ++  +   G   F NP     E +  +++L ++ +G  G 
Sbjct: 206 ILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NP----AEHKDAIAELRKIPEGATGF 260

Query: 309 EYTFDCTGNTKVMRDALE 326
           +  FDC+G       AL 
Sbjct: 261 DAAFDCSGVKATFNTALH 278

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 104/277 (37%), Gaps = 39/277 (14%)

Query: 83  RSIMSTTQGK--PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTL 140
            +IMS       P T    V  E+  PL  ++I V  PK +E+ I + Y+ VCHTD +  
Sbjct: 23  NNIMSAAPAPVIPKTQKGVVFNESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAW 82

Query: 141 SGVDP-EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXX 198
            G  P     P +                 N KVGD   I      C  C+ C+      
Sbjct: 83  KGDWPLPTKLPLVGGHEGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESN 142

Query: 199 XXXA------------------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQK 234
              A                        +     +  +  + C   T Y  A+K+AN++ 
Sbjct: 143 CPDADLSGYTHDGSFQQYATADAVQAAHIPPGTDLAEVAPVLCAGITVY-KALKSANLKA 201

Query: 235 GDTVAVFG-AGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEG 293
           G  VA+ G AG +G   VQ AKA G  +++ +D    K++     G   FI    D ++ 
Sbjct: 202 GQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEELFKTLGGEVFI----DFQKE 256

Query: 294 ETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHK 330
             IV  ++  T+GG         N  V   A+ A  K
Sbjct: 257 SDIVGAVVNATNGGAHGVV----NVSVSEGAISASTK 289

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 80/338 (23%), Positives = 126/338 (37%), Gaps = 47/338 (13%)

Query: 99  AVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDA-YTLSGVDPEGAF----PSIL 153
           A+ YE  +P+ V   + DP   H V++KI+ T +C +D  Y L G    G F    P +L
Sbjct: 16  AIVYE-HRPVPV---IEDP---HYVKVKIEKTGICGSDVHYYLHG--SIGPFVVRSPMVL 66

Query: 154 XXXXXXXXXXXXXXXTNVKVGDHVI------ALYTAE--------CGECKFCKSGXXXXX 199
                          T V++GD V       + Y+ E        C E +F  +      
Sbjct: 67  GHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMRFAATPPYDGT 126

Query: 200 XXAVDKNAPMDSICLLGCGVTTGYGA----------AIKTANVQKGDTVAVFGAGTVGLS 249
                  +P D +  L   V+   GA          A + A  Q    V VFGAG VGL 
Sbjct: 127 LVKY-YISPEDFLVKLPDSVSLEEGALCEPLAVAVHANRLAGTQFPSRVVVFGAGPVGLL 185

Query: 250 VVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLE 309
               AKA GA+ + +VD++  K   +   G T  ++  +D    E + +KL       ++
Sbjct: 186 TASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVD-SSDCSSPEALANKLRAELRSDVD 244

Query: 310 YTFDCTGNTKVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVWKGSAFGGIK 369
             FDC+G    +  A+  C  G                    F L    V +    G  +
Sbjct: 245 IAFDCSGAEICIAAAVLICRPGGTHVQVGSSRDYVS------FPLAEATVKQLRILGSFR 298

Query: 370 -GRSEMGGLIKDYQNGNLKVDEFITHRRPFTEINNAFE 406
               +    ++   +  +     +THR PF     A++
Sbjct: 299 YAAGDYATAVELLASKRVDAARLVTHRFPFDRAVEAYK 336

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 80/198 (40%), Gaps = 43/198 (21%)

Query: 169 TNVKVGDHVIALYTAECGE--------------CKFCKSGXXXXXXXA------------ 202
           T VKVGDHV+    + C +              C  C+ G       A            
Sbjct: 87  TKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGF 146

Query: 203 -------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLS 249
                        V K  P+D   L+     T +  A+K +  +KG +  V GAG +GL 
Sbjct: 147 AEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLC 204

Query: 250 VVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLE 309
            +   K  GASKI+V ++ +++ + +   G   F NP     +   I+  L +  D G +
Sbjct: 205 TILVLKGMGASKIVVSEIAERRIEMAKKLGVEVF-NPSKHGHKSIEILRGLTKSHD-GFD 262

Query: 310 YTFDCTGNTKVMRDALEA 327
           Y++DC+G       +L+A
Sbjct: 263 YSYDCSGIQVTFETSLKA 280

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 89/344 (25%), Positives = 132/344 (38%), Gaps = 67/344 (19%)

Query: 121 HEVRIKIDYTAVCHTDA--YTLSGVDPEGAF----PSILXXXXXXXXXXXXXXXTNVKVG 174
           H V++ I  T +C +D   Y   G+   G +    P +L               T VKVG
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAVTRVKVG 87

Query: 175 DHVI------ALYTAEC--GECKFCKSGXXXXXXXAVDKN------APMDSICLLGCGVT 220
           D V       + Y+ E   G    C           +D        +P D +  L  GV+
Sbjct: 88  DRVAIEPGVPSRYSDETKEGSYNLCPH-MAFAATPPIDGTLVKYYLSPEDFLVKLPEGVS 146

Query: 221 TGYGAAI----------KTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQ 270
              GA +          K A V+ G  V VFGAG VGL     A+A GA+ +I VDV D 
Sbjct: 147 YEEGACVEPLSVGVHSNKLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDN 206

Query: 271 KKQWSMDFGATDFINPK-------TDLKEGETIVSKLIEMTDGG--LEYTFDCTGNTKVM 321
           K Q + DFGAT+  N          DL +G   V KL+    GG   +  F+C+G    +
Sbjct: 207 KLQRAKDFGATNTFNSSQFSTDKAQDLADG---VQKLL----GGNHADVVFECSGADVCI 259

Query: 322 RDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVWK-----GSAFGGIKGRSEMGG 376
             A++    G                   P   V+G+  K       +FG  +    +  
Sbjct: 260 DAAVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNL-- 313

Query: 377 LIKDYQNGNLKVDEFITHRRPFTEINNAFED--LHHGDCLRTVL 418
                  G + V   ITH+  F +   A++    H G+ ++T++
Sbjct: 314 ----VATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 81/198 (40%), Gaps = 43/198 (21%)

Query: 169 TNVKVGDHVIALYTAECGE--------------CKFCKSGX------------------- 195
           T VKVGDHV+    + C +              C+ CK G                    
Sbjct: 87  TKVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKGSENLCTHGGFIGLGVISGGF 146

Query: 196 ------XXXXXXAVDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLS 249
                        V K  P+D   L+     T +  A+K +  +KG +  V GAG +GL 
Sbjct: 147 AEQVAVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLC 204

Query: 250 VVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLE 309
            +   K  GA KI+V +V +++ + + + G   F NP    ++   ++  L +  D G +
Sbjct: 205 TILVLKGMGAGKIVVSEVAERRIEMAKNLGVEVF-NPSKHGQKSIEVLRGLTKSHD-GFD 262

Query: 310 YTFDCTGNTKVMRDALEA 327
           Y++DC+G       +L+A
Sbjct: 263 YSYDCSGIQVTFETSLKA 280

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 83/348 (23%), Positives = 131/348 (37%), Gaps = 42/348 (12%)

Query: 105 GKPLTV-EDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPSILXXXXXXXXX 162
           G PL   ED+ V  P ++EV I + Y+ VCHTD +T  G  P +   P +          
Sbjct: 38  GGPLLYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVV 97

Query: 163 XXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA------------------- 202
                    ++GD   +    + C  C+ C+ G       A                   
Sbjct: 98  AKGKDVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGCEQAEMSGSSHDGTFQQYVAIDA 157

Query: 203 -----VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKA 256
                +  N  + ++  + C   + Y  A+K  N+Q    VA+FGA G +G   VQ AKA
Sbjct: 158 LQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQWVAIFGATGGLGSIAVQYAKA 216

Query: 257 RGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTG 316
            G   + +    +++KQ     G   F+    D  + + I + + + T GG     + T 
Sbjct: 217 MGYRVLGIDGPGEERKQLFHSLGGEVFL----DYTQVDNIPAAVKQATQGGAHCVLNVTA 272

Query: 317 NTKVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVT-GRVWKGSAFGGIKGRSEMG 375
           +       ++ C +                  T  F +V  G   KGSA G    R++  
Sbjct: 273 SLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTIVQHGFSIKGSASG---SRADTR 328

Query: 376 GLIKDYQNGNLKVDEFITHRRPFTEINNAFEDLHHGDCL-RTVLDLSK 422
             +  +  G +K    I      +E+  AFE L  G    R VLD SK
Sbjct: 329 EAVDFFTRGLIKSPIKILG---LSELPKAFELLESGQTTGRLVLDTSK 373

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 81/200 (40%), Gaps = 47/200 (23%)

Query: 169 TNVKVGDHVIALYTAECGE--------------CKFCKSGXXXXXXXA------------ 202
           T VKVGDHV+    + C +              C  CK G       A            
Sbjct: 87  TKVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKGCENLCTHAGFIGLGVISGGF 146

Query: 203 -------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLS 249
                        V K  P+D   L+     T +  A++ +  +KG +  V GAG +GL 
Sbjct: 147 AEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVRLSGFKKGSSALVLGAGPIGLC 204

Query: 250 VVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDG--G 307
            +   K  GA +I+V +V +++ + +   G   F +P+   K GE  V  L  +T    G
Sbjct: 205 TILVLKGMGAGQIVVSEVAERRMELARRLGVEIF-DPR---KHGEKSVESLRALTKSHDG 260

Query: 308 LEYTFDCTGNTKVMRDALEA 327
            +Y++DC+G       +L+A
Sbjct: 261 FDYSYDCSGIQATFDASLKA 280

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 100/242 (41%), Gaps = 38/242 (15%)

Query: 121 HEVRIKIDYTAVCHTDA--YTLSGVDPEGAF----PSILXXXXXXXXXXXXXXXTNVKVG 174
           H V++ I  T +C +D   YT   +   G F    P +L               TNVKVG
Sbjct: 29  HYVKLHIKATGICGSDVHYYTQGAI---GQFVVKSPMVLGHESSGIVAEVGSAVTNVKVG 85

Query: 175 DHVI------ALYTAE--CGECKFCKSGXXXXXXXAVDKN------APMDSICLLGCGVT 220
           D V       + Y+ E   G    C            D        AP D +  +   ++
Sbjct: 86  DRVAIEPGIPSRYSDETMSGNYNLCPH-MVFAATPPYDGTLTKYYLAPEDFVYKMPDHLS 144

Query: 221 TGYGA----------AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQ 270
              GA          A K A  + G  V V GAG VGL     A+A GA++++ VD+ ++
Sbjct: 145 FEEGALAEPMSVGVHANKLAGTRFGSKVLVSGAGPVGLLAGAVARAFGATEVVFVDIAEE 204

Query: 271 KKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGL-EYTFDCTGNTKVMRDALEACH 329
           K + S  FGAT  ++  +D    E  VS++ ++  G L     +C+G    +R  ++AC 
Sbjct: 205 KLERSKQFGATHTVSSSSDE---ERFVSEVSKVLGGDLPNIVLECSGAQPAIRCGVKACK 261

Query: 330 KG 331
            G
Sbjct: 262 AG 263

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 99/265 (37%), Gaps = 37/265 (13%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T  A +  E   PL  +DI V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                 N K+GD   I      C  C+ C+         A        
Sbjct: 64  VGGHEGAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNCPDADLSGYTHD 123

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGT 245
                           +     +  +  + C   T Y  A+K+AN++ G  VA+ G AG 
Sbjct: 124 GSFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY-KALKSANLKAGQWVAISGAAGG 182

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTD 305
           +G   VQ A+A G  +++ +D    K++     G   FI    D  +   I   +I+ T+
Sbjct: 183 LGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECFI----DFTKEHDIAEAVIKATN 237

Query: 306 GGLEYTFDCTGNTKVMRDALEACHK 330
           GG         N  V   A+ A  K
Sbjct: 238 GGAHGVI----NVSVSEGAISASTK 258

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 54/104 (51%), Gaps = 6/104 (5%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           A+K +N++ G +  V GAG +GL+ +   +  GA KI+V +    +++ +   G   F N
Sbjct: 182 AVKISNLKPGQSALVLGAGPIGLATILALQGHGAGKIVVSEPAQIRREQAAKLGVETF-N 240

Query: 286 PKTDLKEGETIVSKLIEMTDG--GLEYTFDCTGNTKVMRDALEA 327
           P    + GE  V +L ++  G  G +++FDC+G        L A
Sbjct: 241 P---FEHGEKAVEELRKIPPGGDGFDFSFDCSGMKATFDTGLHA 281

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 94/257 (36%), Gaps = 55/257 (21%)

Query: 122 EVRIKIDYTAVC------HTDAYTLSGVDPE------GAFPSILXXXXXXXXXXXXXXXT 169
           EV I + +  +C      +TD       D E       A P  +               T
Sbjct: 28  EVIIDVSWCGICGSDLHEYTDGPIFMPKDGECHALSNAALPLAMGHEMSGIIAKVGPRVT 87

Query: 170 NVKVGDHVIALYTAECGE--------------CKFCKSGXXXXXXXA------------- 202
            VKVGDHV+    + C +              C+ CK G       +             
Sbjct: 88  KVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKGSENLCAHSGFVGLGVISGGFA 147

Query: 203 ------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSV 250
                       V K  P+D   L+     T +  A+K +  +KG +  V GAG +GL  
Sbjct: 148 EQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVKLSGFKKGSSALVLGAGPIGLCT 205

Query: 251 VQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEY 310
           +   K  GA KI+V +V +++ + +       F NP     +   ++  L E  D G +Y
Sbjct: 206 ILVLKGMGAGKIVVSEVAERRLKMAKSLDVEVF-NPAQHGHKSVELLRGLTESHD-GFDY 263

Query: 311 TFDCTGNTKVMRDALEA 327
           ++DC+G       +L+A
Sbjct: 264 SYDCSGIQATFETSLKA 280

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 54/108 (50%), Gaps = 2/108 (1%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           A K A  + GD V VFGAG VGL     AK  GA +++ +DV D+K + +  FGAT  IN
Sbjct: 162 ANKQAGTRFGDKVVVFGAGPVGLLNGAVAKVFGALQVVFIDVVDEKLERAKHFGATAVIN 221

Query: 286 PKTDLKEGETIVSKLIEMTDGGL--EYTFDCTGNTKVMRDALEACHKG 331
                   E  ++  I+   GG+  +   +CTG    +R  + A   G
Sbjct: 222 SSKLRINDEFELAVAIKEKLGGVDPDIVLECTGAEPCIRAGIRALKTG 269

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 85/200 (42%), Gaps = 15/200 (7%)

Query: 122 EVRIKIDYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALY 181
           EV IK  YT V + ++Y   G+ P    P +L                ++KVGD V   Y
Sbjct: 37  EVIIKNRYTGVNYIESYFRKGIYP-AELPYVLGREAVGTVVAIGKSVRDLKVGDKVS--Y 93

Query: 182 TAECGECKFCKSGXXXXXXXAVDKNAPMDSICLLGCGVTTGYGAAI---KTANVQKGDTV 238
            A     +F K           D  +  + + L   G+  G  A     +  +V+KGD V
Sbjct: 94  IAGATFAQFTKVPNSTHVFKLPDTTS-TEQLKLYAAGMIQGLTALTFVNEAYDVKKGDYV 152

Query: 239 AVFGA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIV 297
            ++ A G VGL   Q  + RGA  I V   N +K   + + GA   IN K D      I+
Sbjct: 153 LLYAAAGGVGLIFNQLLRMRGAHTIAVASTN-EKLSLAKENGAEFLINSKED-----NIL 206

Query: 298 SKLIEMTDG-GLEYTFDCTG 316
            K+ ++T G G++  FD  G
Sbjct: 207 EKVQQITKGNGVDVAFDSVG 226

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 4/103 (3%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           A++  N +KG +  V G+G +GL ++      G + I+V +    ++ ++ + GAT F +
Sbjct: 181 ALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPAKIRRDFAKELGATVF-D 239

Query: 286 PKTDLKEGETIVSKLIEMTDG--GLEYTFDCTGNTKVMRDALE 326
           P + L   E  +  L  +  G  G +YTFDC+GN      ++E
Sbjct: 240 PSS-LPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 92/214 (42%), Gaps = 15/214 (7%)

Query: 108 LTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXX 167
           +  ED  V      E+ IK  YT V + ++Y   G+ P    P +L              
Sbjct: 23  IKYEDYPVPSISEEELLIKNKYTGVNYIESYFRKGIYP-CEKPYVLGREASGTVVAKGKG 81

Query: 168 XTNVKVGDHVIALYTAECGECKFCKSGXXXXXXXAVDKNAPMDSICLLGCG---VTTGYG 224
            TN +VGD V   Y +     ++ K          + K    + + L   G   V T   
Sbjct: 82  VTNFEVGDQVA--YISNSTFAQYSKISSQGPVMK-LPKGTSDEELKLYAAGLLQVLTALS 138

Query: 225 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDF 283
              +  +V+KGD V +F A G VGL + Q  K +GA  I V    D+K + + ++GA   
Sbjct: 139 FTNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHTIAVAS-TDEKLKIAKEYGAEYL 197

Query: 284 INPKTDLKEGETIVSKLIEMTDG-GLEYTFDCTG 316
           IN        E I+ ++++ T+G G++ +FD  G
Sbjct: 198 INASK-----EDILRQVLKFTNGKGVDASFDSVG 226

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 62/285 (21%), Positives = 103/285 (36%), Gaps = 64/285 (22%)

Query: 99  AVAYEAGKPLTVEDIVVDP--PKAHEVRIKIDYTAVCHTDAYT----------------L 140
           A+AY A   +     +V+P      E+ ++I+Y  +C TD +                 L
Sbjct: 3   ALAYFAKGDIHFTKDLVEPKISTPDELILEINYCGICGTDLHEYIDGPIFFPEDGETNEL 62

Query: 141 SGVDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGE------------- 187
           SG       P  +               T  KVGDHV+      C +             
Sbjct: 63  SG----SGLPQAMGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVNKP 118

Query: 188 -CKFCKSGXXXXXXX-------------------------AVDKNAPMDSICLLGCGVTT 221
            C  CK G                                 V K+ PMD   L+     +
Sbjct: 119 WCSACKKGHYNVCSNLGLIGNGVQSGGCAERMCINESHCFKVPKDMPMDIAALIQPIAVS 178

Query: 222 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGAT 281
            +  AIK A  ++G +V V G G +GL  +   +  G S I+V +    +++ +   GAT
Sbjct: 179 WH--AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGCSDIVVSEPAKVRRELAERMGAT 236

Query: 282 DFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALE 326
            +   + + ++    + K+I   D G +Y FD +G  + +  A+E
Sbjct: 237 TYDPSQHNTEKNIQNLRKMILGGD-GFDYVFDNSGTPETLETAIE 280

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/277 (21%), Positives = 106/277 (38%), Gaps = 69/277 (24%)

Query: 99  AVAYEAGKPLTVEDIVVDP--PKAHEVRIKIDYTAVCHTD----------------AYTL 140
           A+AY   K +   + + +P    + +V+I I +  VC +D                 + +
Sbjct: 3   ALAYFGQKDIRFTNDLPEPTIQASDDVQIAISWCGVCGSDLHEYLDGPIFFPKDGEKHAM 62

Query: 141 SGVDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTA----------------- 183
           SGV      P  +                N+KVGDHV+   T                  
Sbjct: 63  SGV----GLPQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVKHASDE 118

Query: 184 ECGECK-----------FCKSG-----------XXXXXXXAVDKNAPMDSICLLGCGVTT 221
           EC  CK           FC  G                   V K+ P+D   L+     +
Sbjct: 119 ECAACKKDFYNCCSELGFCGLGCHSGGFAEKVVISEKHVVKVPKDIPLDVAALVEPLAVS 178

Query: 222 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGAT 281
            +  A++ + ++ G +  + GAG +GL+ V   +  GA  I+V + +  +++ +   GA 
Sbjct: 179 WH--AVRISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVVSEPSASRRKQAEALGAL 236

Query: 282 DFINPKTDLKEGETIVSKLIEMTDG--GLEYTFDCTG 316
            F NP      G+  V +L ++  G  G ++++DC+G
Sbjct: 237 TF-NP---FDHGDKAVDELRKIPPGSDGFDFSYDCSG 269

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 5/105 (4%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           A+K ++ ++G +V + G G +GL  +   K  G   I+V +    +++ +   GA  F  
Sbjct: 181 AVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPALIRRELAEKMGARVFDP 240

Query: 286 PKTDLKEGETIVSKLIEMTDG--GLEYTFDCTGNTKVMRDALEAC 328
               L   +  +  L EM  G  G +YTFDC+G    ++ A+E C
Sbjct: 241 SNMSL---DNSIKTLTEMAPGSQGFDYTFDCSGIPATLKVAIECC 282

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 74/187 (39%), Gaps = 43/187 (22%)

Query: 169 TNVKVGDHVIALYTAEC--------------GECKFCKSG-------------------- 194
           TN+K GDHV+   T  C               EC  C+ G                    
Sbjct: 87  TNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAECAACQRGFYNCCAHLGFMGLGVHSGGF 146

Query: 195 -----XXXXXXXAVDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLS 249
                        +    P+D   L+     + +  A++ + +QKG +  V GAG +GL+
Sbjct: 147 AEKVVVSEKHVVKIPNTLPLDVAALVEPISVSWH--AVRISKLQKGQSALVLGAGPIGLA 204

Query: 250 VVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLE 309
            +   +  GASKI+V +  + ++  +   G   F +P    ++   I+ KL    + G +
Sbjct: 205 TILALQGHGASKIVVSEPAEIRRNQAAKLGVETF-DPSEHKEDAVNILKKLAPGGE-GFD 262

Query: 310 YTFDCTG 316
           + +DC+G
Sbjct: 263 FAYDCSG 269

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 55/105 (52%), Gaps = 4/105 (3%)

Query: 226 AIKTANVQKGD--TVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDF 283
           A+K A  +KG      V GAG +GL+ +   KA GASKI+V ++   +++ ++  G   F
Sbjct: 181 AVKVAGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVVSELAAIRRELALKMGVEVF 240

Query: 284 INPKT-DLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEA 327
              K  D K+G   + ++ E  D G ++ FDC+G       AL +
Sbjct: 241 DPSKHGDEKQGIKKLREIPEDHD-GFDFAFDCSGVETTFNTALHS 284

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 99/240 (41%), Gaps = 35/240 (14%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P+T  A +  +    L ++ I V  PKA+E+ I + ++ VCH+D +   G  P +   P 
Sbjct: 10  PLTQRAVIFKKHSGKLELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPL 69

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   K+GD+  I    + C  C+ C+         A        
Sbjct: 70  VGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYADISGFTRD 129

Query: 203 --VDKNAPMDSI---------------CLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-G 244
               + A  D++                +L  G+T     A+KTAN+  G+ VA+ GA G
Sbjct: 130 GSFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF--KALKTANLTAGNWVAISGACG 187

Query: 245 TVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMT 304
            +G   +Q AKA G S ++ +D   +K+    D G   F+    D  + E +V +++  T
Sbjct: 188 GLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDVFL----DFSKSENLVPEVVSAT 242

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 50/101 (49%), Gaps = 1/101 (0%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           A++ +  +KG +V + GAG +GL  +      G S+++V +    ++ ++   GA  +  
Sbjct: 220 AVRVSKFKKGASVLIVGAGPIGLGTILALNGHGVSEVVVSEPAKIRRDFAEKMGAIVYDP 279

Query: 286 PKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALE 326
              D  E    +  +    D G +Y FDC+GN   ++ A+E
Sbjct: 280 SAKDHDESIKYLRSIAPGGD-GFDYAFDCSGNPATLKAAIE 319

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 47/88 (53%), Gaps = 8/88 (9%)

Query: 231 NVQKGDTVAVFGA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTD 289
           NVQKGD + V+ A G VGL   Q  KARGA  I V    D+K Q + ++GA   IN   D
Sbjct: 164 NVQKGDFILVYAAAGGVGLIFDQLLKARGARTIAVAS-TDEKLQLAKEYGAEFLINSTKD 222

Query: 290 LKEGETIVSKLIEMTDG-GLEYTFDCTG 316
                 IV K+ E T+G G+   FD  G
Sbjct: 223 -----DIVEKVKEFTNGEGVAAAFDSIG 245

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 61/125 (48%), Gaps = 3/125 (2%)

Query: 203 VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKI 262
           + K+ P+D   L+     + +  AI+ + +  G +  V G G +GL  +   +A GASKI
Sbjct: 160 IPKHIPLDVAALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKI 217

Query: 263 IVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMR 322
           +V +    +++ +   GA  F   + +  E    + K+    D G +Y+FDC+G     R
Sbjct: 218 VVSEPAKNRRELAKLMGAEVFDPTEWEEHEAVEYLRKVAPGGD-GFDYSFDCSGLPVTFR 276

Query: 323 DALEA 327
            ++ A
Sbjct: 277 ASVHA 281

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 85/202 (42%), Gaps = 17/202 (8%)

Query: 121 HEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIAL 180
           +E+ IK  Y  +   +AY   G+ P    P IL                N  +GD V  +
Sbjct: 37  NELLIKNKYAGINFIEAYFRKGIYPV-QLPQILGREATGVVVAKGQSVKNFDIGDKVAYM 95

Query: 181 YTAECGE-CKFCKSGXXXXXXXAVDKNAPMDSICLLGCGVTTGYGAAI---KTANVQKGD 236
            ++   +  K+  SG        +      D + +    +  G  A     +   V++GD
Sbjct: 96  SSSTFAQYTKYSSSGLISK----LPSETTDDQLKVYAAALIQGLTALTFLDEAYKVKEGD 151

Query: 237 TVAVFGA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGET 295
            + ++ A G VGL + Q  K RGA  I VV   ++K++ +  FGA   IN        E 
Sbjct: 152 YILLYAAAGGVGLLMDQLLKERGAHAIAVVS-TEEKEELAKKFGAEYVINSSK-----ED 205

Query: 296 IVSKLIEMT-DGGLEYTFDCTG 316
           I+ + +E+T D G++  FD  G
Sbjct: 206 ILKRALEITNDKGVDAVFDSVG 227

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 81/208 (38%), Gaps = 29/208 (13%)

Query: 93  PITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP-EGAFPS 151
           P T  A V    G  L  +DI V  P + E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKAIVFASNGGELEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGECKFCKSGXXXXXXXA-------- 202
           +                   KVGD   I      C  C++C+ G       A        
Sbjct: 64  VGGHEGAGVVVALGENVKGWKVGDLAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHD 123

Query: 203 ----------------VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GT 245
                           + +   +  +  + C   T Y  A+K+A+++ G  VA+ GA G 
Sbjct: 124 GSFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSADLKAGQWVAISGACGG 182

Query: 246 VGLSVVQGAKARGASKIIVVDVNDQKKQ 273
           +G   VQ A+A G  +++ +D  D K++
Sbjct: 183 LGSLAVQYARAMG-YRVLGIDGGDDKRK 209

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (47%), Gaps = 4/120 (3%)

Query: 208 PMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDV 267
           P+D   L+     T + A  K     KG T  + G+G +GL+++   KA GASKI+V +V
Sbjct: 165 PLDVAALVEPLSVTWHAA--KVGKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEV 222

Query: 268 NDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEA 327
              +++ +       F +P    K     +  L E  D G ++ FDC+G    M  A+ A
Sbjct: 223 AQVRRKLAEKMKVEVF-DPSVHGKNTSNELRLLTENKD-GFDFAFDCSGLEVTMNTAIHA 280

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 91/221 (41%), Gaps = 16/221 (7%)

Query: 103 EAGKPLTV---EDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSILXXXXXX 159
           E G P  +   +D  V     +E+ IK  YT +   ++Y   G+ P    P +L      
Sbjct: 26  ETGGPEVIRYEQDYPVPELNDNEILIKNKYTGINFIESYFRKGIYPSQK-PYVLGREASG 84

Query: 160 XXXXXXXXXTNVKVGDHVIALYTAECGE-CKFCKSGXXXXX-XXAVDKNAPMDSICLLGC 217
                    +   + D V  L      +  K  ++G          DK   + +  L   
Sbjct: 85  TVVAKGKAVSKFNLADKVAYLSAGTFAQYTKIAETGHISKLPENTTDKQLELYAASL--V 142

Query: 218 GVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSM 276
            V T    A +   V+KGD V ++ A G VGL+  Q  K  GA  I V    D+K Q + 
Sbjct: 143 QVLTALTFAKEAYTVKKGDFVLLYAAAGGVGLAFNQILKRLGAHTIAVAS-TDEKLQLAK 201

Query: 277 DFGATDFINPKTDLKEGETIVSKLIEMTDG-GLEYTFDCTG 316
           +FGA   +N        E ++++++E+T G G++  +D  G
Sbjct: 202 EFGAEYLVN-----SSKEDVLARVLEITQGQGVDVAYDSIG 237

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 64/124 (51%), Gaps = 8/124 (6%)

Query: 208 PMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDV 267
           PMD   L+   ++  + AA + +    G +  V GAG +GL+++   KA+GASKIIV + 
Sbjct: 165 PMDVAALIE-PLSVAWHAA-RVSKFPPGKSALVLGAGPIGLAMILVLKAQGASKIIVSEP 222

Query: 268 NDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMT-DG-GLEYTFDCTGNTKVMRDAL 325
              +++ + D    +  +P T    G+  V+ L   T DG G ++ FDC+G        L
Sbjct: 223 ATMRRELA-DRMHVETFDPST---HGDKSVAMLRSKTFDGKGFDFAFDCSGVPATFNTGL 278

Query: 326 EACH 329
           +A H
Sbjct: 279 QAAH 282

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 57/121 (47%), Gaps = 3/121 (2%)

Query: 206 NAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVV 265
           + PM+ + L+     + +  A++ +  + G +V + G G +GLS +      G ++I+V 
Sbjct: 163 HIPMEVVALVQPIAVSWH--AVRVSKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVS 220

Query: 266 DVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDAL 325
           +    ++  +   GA  +   +   +E    +  L    D G +Y FDC+G    +R ++
Sbjct: 221 EPAKIRRDLAEKMGAVVYDPMQHSYEENIKYLRALAPDKD-GFDYCFDCSGTPATLRSSI 279

Query: 326 E 326
           E
Sbjct: 280 E 280

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 91/355 (25%), Positives = 135/355 (38%), Gaps = 44/355 (12%)

Query: 99  AVAYEAGKPLTVEDIVV-DPPKAHEVRIKIDYTAVCHTDA--YTLSGVDPEGAF----PS 151
           AV  +    +T EDI   +   +H V+I +  T +C +D   YT   +   G F    P 
Sbjct: 7   AVVLQKKGEITFEDIPAPEITDSHYVKIHVKKTGICGSDIHYYTHGSI---GEFVVKKPM 63

Query: 152 ILXXXXXXXXXXXXXXXTNVKVGDHVI------ALYTAE--CGECKFCKSGXXXXXXXAV 203
           +L               T V+VGD V       + Y+ E   G    C            
Sbjct: 64  VLGHESSGVVVEVGKDVTLVQVGDRVAIEPGVPSRYSDETKSGHYNLCPH-MAFAATPPY 122

Query: 204 DKN------APMDSICLLGCGVTTGYGA----------AIKTANVQKGDTVAVFGAGTVG 247
           D        AP D +  L   V+   GA          A + A    G  V VFGAG VG
Sbjct: 123 DGTLVKYYLAPEDFLVKLPDHVSFEEGACAEPLAVGVHANRLAETSFGKNVVVFGAGPVG 182

Query: 248 LSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGG 307
           L     A A GAS ++ VDV + K + S DFGAT+ IN      E E       E+    
Sbjct: 183 LVTGAVAAAFGASAVVYVDVFENKLERSKDFGATNTINSTKYKSEDELTEVIKSELKGEQ 242

Query: 308 LEYTFDCTGNTKVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVWKGSAFGG 367
            E   DC+G    +R A++    G                   P  ++  +  +    G 
Sbjct: 243 PEIAIDCSGAEICIRTAIKVLKAGG----SYVQVGMGKDNINFPIAMIGAKELR--VLGS 296

Query: 368 IKGR-SEMGGLIKDYQNGNLKVDEFITHRRPFTEINNAFE-DLHHG-DCLRTVLD 419
            +   ++    +K    G + V + ITH   F E  +A+  +L HG + ++T++D
Sbjct: 297 FRYYFNDYKIAVKLISEGKVNVKKMITHTFKFEEAIDAYNFNLEHGSEVVKTMID 351

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 51/104 (49%), Gaps = 5/104 (4%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           A + A  ++G    V G+G +GL+++   K   A KI+V +    +++ +       F N
Sbjct: 181 AARLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELAEKLNVVVF-N 239

Query: 286 PKTDLKEGETIVSKLIEMT--DGGLEYTFDCTGNTKVMRDALEA 327
           P       +  + KL E++  D G +YTFDC+G       A++A
Sbjct: 240 PTH--TRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKA 281

>NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253
          Length = 349

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 107/260 (41%), Gaps = 18/260 (6%)

Query: 74  SPLTQFIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVC 133
           S L +   + SI+S  Q   I    +  Y+  K  T++   V+   ++E+ IK  Y+ + 
Sbjct: 8   SILARRTMSNSIVSKQQSAIIFDGISDGYDVIKYKTIQTPTVE--NSNEMVIKNSYSGIN 65

Query: 134 HTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGECKFCKS 193
             +AY   G+ P    P +                 N ++GD V  L+     E    K 
Sbjct: 66  FIEAYFRKGIYP-CELPYLPGREASGIVAEVGKDVKNFQIGDKVAYLHGETMAEFTKIKE 124

Query: 194 GXXXXXXXAVDKNAPMDSICLLGCGVTTGYGAAI---KTANVQKGDTVAVFGA-GTVGLS 249
                    + K+A  +++ L   G+     A     +   V+KG+ V V+ A G VGL 
Sbjct: 125 ---TDPIIKLSKDASDENLKLYAAGLLQSLTAITLINEAHEVKKGEYVLVYAAAGGVGLL 181

Query: 250 VVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDG-GL 308
           + Q  K +GA  I V     +K + +   GA   IN K      E +V +++E+T+  G+
Sbjct: 182 LDQLLKMKGAHTIAVCSTK-EKLELAKANGAEFSINSKE-----ENVVQRVMEITNNKGV 235

Query: 309 EYTFDCTGNTKVMRDALEAC 328
           +  +D  G      D L A 
Sbjct: 236 DVAYDSIGKA-TFEDTLAAL 254

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           AI     + G T  + GAG +GL  +    A G   I+V +    +++ +   GA  +  
Sbjct: 181 AISVCEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPAKLRRELAEKMGARVYDP 240

Query: 286 PKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALE 326
            +   KE    +  + E  D G +YTFDC+G    +  A++
Sbjct: 241 TEHAAKESIDYLRSIAEGGD-GFDYTFDCSGLEITLNAAIQ 280

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 5/103 (4%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           AI+    + G T  + GAG +GL  +    A G   I+V +    +++ +   GA  +  
Sbjct: 181 AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEKMGARVYDP 240

Query: 286 PKTDLKEGETIVSKLIEMTDG--GLEYTFDCTGNTKVMRDALE 326
                KE    +  L  + DG  G +YTFDC+G    +  A++
Sbjct: 241 TAHAAKES---IDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQ 280

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           AI     + G T  + GAG +GL  +    A G   I+V +    +++ +   GA  +  
Sbjct: 181 AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPAKLRRELAEKMGARVYDP 240

Query: 286 PKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALE 326
            +   +E    +  + E  D G +YTFDC+G    +  A++
Sbjct: 241 TEHAARESIDYLRSVAEGGD-GFDYTFDCSGLEVTLNAAIQ 280

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 105/253 (41%), Gaps = 22/253 (8%)

Query: 73  RSPLTQFIQTRSIMSTTQ----GKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKID 128
           RS ++     R+ M+TT      K I      +Y+    L  +D  V     +E+ +K  
Sbjct: 3   RSTISSVFNKRATMATTTIPKTQKVILINDTGSYDV---LKYQDHPVPSITDNELLVKNK 59

Query: 129 YTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGEC 188
           Y+ +   ++Y   G+ P    P IL                +  +GD V   Y +     
Sbjct: 60  YSGINFIESYFRKGIYPSEK-PLILGRESSGTVVAKGNSVKDFDIGDKVA--YLSGSAFA 116

Query: 189 KFCKSGXXXXXXXAVDKNAPMDSICLLGCGVTTGYGAAI---KTANVQKGDTVAVFGA-G 244
           ++ K          + K+A  +++ L   G+     A     +  NV+KGD +  + A G
Sbjct: 117 QYTKVDAAGKVVK-LPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKKGDFILNYAAAG 175

Query: 245 TVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMT 304
            VGL + Q  K RGA  I VV   ++K + +   GA   I     +   E IV+++ E+T
Sbjct: 176 GVGLILDQLLKERGAHTIAVVS-TEEKLELAKKHGAEYGI-----ISSKEDIVTRVKEIT 229

Query: 305 DG-GLEYTFDCTG 316
           +  G++  FD  G
Sbjct: 230 NNQGVDAAFDSIG 242

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 1/91 (1%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           AI   + + G T  + GAG +GL  +    A G S I V +    +++ +   GA  F +
Sbjct: 181 AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPAKVRRELAEKMGARVF-D 239

Query: 286 PKTDLKEGETIVSKLIEMTDGGLEYTFDCTG 316
           P     +      + +     G +YTFDC+G
Sbjct: 240 PTAHAAKDSIDYLRSVAPGGDGYDYTFDCSG 270

>Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 87/210 (41%), Gaps = 13/210 (6%)

Query: 111 EDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXXXTN 170
           ED  V      ++ IK  Y  V + ++Y   G+ P    P +L                N
Sbjct: 26  EDYPVPLISDEDLLIKNKYAGVNYIESYFRKGLYP-CEKPYVLGREATGTVVAKGKDVNN 84

Query: 171 VKVGDHVIALYTAECGE-CKFCKSGXXXXXXXAV-DKNAPMDSICLLGCGVTTGYGAAIK 228
            ++GD V  +  +   +  KF   G          D+   + +  LL     T      +
Sbjct: 85  FQIGDQVAYISHSTFAQYTKFSSKGNVMRLPKCTSDEKMKLYAAGLLQA--LTALSFTNE 142

Query: 229 TANVQKGDTVAVFGA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPK 287
             +V+KGD + V+ A G VGL + Q  K +GA  I V    D+K   +   GA   IN  
Sbjct: 143 AYHVKKGDYILVYAAAGGVGLILNQLLKMKGAHAIAVAS-TDEKLDIAKKNGAEYLINSS 201

Query: 288 TDLKEGETIVSKLIEMTDG-GLEYTFDCTG 316
                 E ++ +++E+T+G G++ +FD  G
Sbjct: 202 K-----EDVLERVLEITNGEGVDSSFDSIG 226

>TPHA0M00930 Chr13 complement(180084..181115) [1032 bp, 343 aa] {ON}
           Anc_3.253 YBR046C
          Length = 343

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 87/227 (38%), Gaps = 24/227 (10%)

Query: 114 VVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXX-XXXXTNVK 172
           V D  K  E+ +K  Y+ V   +AY   G+ P    P IL                 + K
Sbjct: 32  VPDDIKDDEILVKNKYSGVNFIEAYFRKGIYP-CEHPYILGREAVGTVVYVGRRMAHDYK 90

Query: 173 VGDHVIALYTAECGECKF----CKSGXXXXXXXAVDK---NAPMDSICLLGCGVTTGYGA 225
           VGD V   Y       +F     KS         +++   +      C     V T    
Sbjct: 91  VGDSV--AYIGNSSMAQFTKVSAKSPIINMSKFYIEEELTDELFQKYCASLINVLTVMTF 148

Query: 226 AIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFI 284
             ++  V+K D + V+ A G VGL   Q     GA+ +I V  +D K Q +   GA   I
Sbjct: 149 IRESYKVKKNDNILVYAAAGGVGLIFDQLITKIGAT-VIAVASSDDKLQLAKLHGAKHLI 207

Query: 285 NPKTDLKEGETIVSKLIEMTDG-GLEYTFDCTGNTKVMRDALEACHK 330
           N  TD      IV K+ E T+G G+E  FD  G     +D  E   K
Sbjct: 208 NSSTD-----DIVEKVNEYTNGKGVEAVFDSIG-----KDTFETSMK 244

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 37.0 bits (84), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFI 284
           A++   V+ GD V V     +GL V    +  G  K++++   D KKQ S  FG T FI
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 74/201 (36%), Gaps = 35/201 (17%)

Query: 122 EVRIKIDYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXXXTN-VKVGDHV-IA 179
           ++ +KI+   VC +D +  SG   + A P I+               T+ VKVGD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 180 LYTAECGECKFCKSGXXXXXXXAVD-------------------------------KNAP 208
                C +CK C +G       A+                                +N P
Sbjct: 95  AQALSCMKCKRCLNGNESYCPNAIQTYSTPYEDGYVSKGGYADYVRVHEQFTVPIPENIP 154

Query: 209 MDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVN 268
                 L CG  T +   ++      G  VA+ G G +G   V  AKA GA ++  +   
Sbjct: 155 SHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLLAKAMGA-EVYAISRT 212

Query: 269 DQKKQWSMDFGATDFINPKTD 289
             KK+ +M  GA  FI  K +
Sbjct: 213 SSKKEDAMKLGADHFIATKEE 233

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 62/312 (19%), Positives = 115/312 (36%), Gaps = 23/312 (7%)

Query: 121 HEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIAL 180
           +E+ IK  Y  + + ++Y   G+ P    P +L               T   V D V  L
Sbjct: 59  NEILIKNKYAGINYIESYFRKGIYPSKK-PYVLGREASGVVVAKGDAVTKFDVNDKVAYL 117

Query: 181 YTAECGE-CKFCKSGXXXXXXXAVDKNAPMDSICLLGCGVT---TGYGAAIKTANVQKGD 236
            +    +  K  ++G        V +++  + + L    +    T      +   V+KGD
Sbjct: 118 SSNTFAQYTKISEAGTVSK----VPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKKGD 173

Query: 237 TVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETI 296
            + ++ A             +  +  I V   D+K Q + ++GA   IN   D      +
Sbjct: 174 YILLYAAAGGAGLAFNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSKD-----DV 228

Query: 297 VSKLIEMTDG-GLEYTFDCTGNTKVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLV 355
           +++++E+T+G G+E  FD  G       +L+A  +                         
Sbjct: 229 LARVLEITNGQGVEAAFDSVGK-DTFETSLKALKRKGTLVSFGNASGPVPPVAINILTPK 287

Query: 356 TGRVWKGSAFGGIKGRSEM----GGLIKDYQNGNLKVDEFITHRRPFTEINNAFEDLHHG 411
             ++ + S FG I    E       L     +G LK+   I+   P  E N A E L   
Sbjct: 288 NIKLLRPSLFGYIATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLESR 345

Query: 412 DCL-RTVLDLSK 422
             + + +L++S+
Sbjct: 346 KTVGKLMLEISQ 357

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 58/111 (52%), Gaps = 9/111 (8%)

Query: 209 MDSICLLGCGVTTGYGAAIKTANV----QKGDTVAVFGAGT-VGLSVVQGAKARGASKII 263
           +D    +G  + T   A     NV    ++  ++ ++G  T VG+ VVQ AK+ G +KII
Sbjct: 167 LDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIVIWGGSTGVGIFVVQLAKSLGFTKII 226

Query: 264 VVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDC 314
            +  + + +Q+ +  GAT  I+ +   ++ E IV+++ ++   G+ +  D 
Sbjct: 227 TI-TSKKHEQYLLSLGATHIIHRE---EKTEDIVNEIKKICPNGVSHGVDL 273

>Smik_14.193 Chr14 complement(352041..353171) [1131 bp, 376 aa] {ON}
           YNL134C (REAL)
          Length = 376

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 53/116 (45%), Gaps = 11/116 (9%)

Query: 211 SICLLGCGVTTGYGAAIK--TANVQKGDTVAVFGAGT-VGLSVVQGAKA-RGASKIIVVD 266
           S+   G  +T  +G  +K      Q+   +  +G  T VG  ++Q AK   G SKIIVV 
Sbjct: 149 SLTTAGMVLTHSFGLDMKWEPPKAQRDHPILFWGGATGVGQMLIQLAKKLHGFSKIIVVA 208

Query: 267 VNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMR 322
               +KQ   D+GA +      D  + + I  + I+     L Y  DC  NT+ ++
Sbjct: 209 SRKHEKQLK-DYGADELF----DYHDADVI--EQIKKKHNNLTYLVDCVSNTETIQ 257

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 260 SKIIVVDVNDQKKQWSMDFGATD-FINPKTDLKEGETIVSKLIEMTDG-GLEYTFDCTG 316
           S +I VDV D K Q + DFGAT  F + K  + E + +  +L ++  G   +  F+C+G
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSG 59

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 63/132 (47%), Gaps = 20/132 (15%)

Query: 215 LGCGVTTGYGAAIKT---------ANVQK-GDTVAVFGAGTVGLSVVQGAKARGASKIIV 264
           +G G+ T  G+AI +         A+ QK G+ V   G+ +VGL V+Q AKA    + IV
Sbjct: 182 VGVGLVTA-GSAISSLVDLSLRDQADHQKLGNIVIWGGSSSVGLYVIQLAKASKMFEKIV 240

Query: 265 VDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGN------T 318
           V    + K++ ++ GA+  I+     +  E I+  ++     G+++  D          T
Sbjct: 241 VVSASKHKEYLLELGASCIIDRH---QSEEEILDDILSHCPEGIDFGIDVISKETATLLT 297

Query: 319 KVMRDALEACHK 330
           K++++  E   K
Sbjct: 298 KILQNNNENVKK 309

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 1/74 (1%)

Query: 121 HEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IA 179
           ++V +KI+   VC +D +T SG   E   P ++                 +KVGD V I 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 180 LYTAECGECKFCKS 193
                C EC  CKS
Sbjct: 98  AQVFSCLECDRCKS 111

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 49/101 (48%), Gaps = 1/101 (0%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           A++ +  + G +V + G G +GL  +      G ++++V +    ++  +   GA  + +
Sbjct: 181 AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGVTEVVVSEPAKIRRDLAEKMGAVVY-D 239

Query: 286 PKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALE 326
           P T   +      + I     G +YTFDC+GN   ++ A+E
Sbjct: 240 PMTRDHDESIKYLRSIAPGGDGFDYTFDCSGNPATLKAAIE 280

>Smik_11.95 Chr11 (165566..166162) [597 bp, 198 aa] {ON} YKL141W
          (REAL)
          Length = 198

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 2/74 (2%)

Query: 1  MLPKTFNRKVFTTFSSVFQKRPPLCTSLRLITTTEGRGFLQSKSEKYKAKQFNTQ--LNQ 58
          ML    N+       SVF +   L +S RL+  T   GFL +   K  A + NT+  + +
Sbjct: 5  MLKLGLNKSALLLKPSVFSRAATLSSSRRLLFNTARTGFLSTSLLKNMASEMNTKAAIAE 64

Query: 59 NKLTNISIGKLPIS 72
           +L N    K PIS
Sbjct: 65 EQLLNKQRAKRPIS 78

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 5/105 (4%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           A+K A+ +KG +  + G G +GL  +   K  G   I++ +    +++++   GA  +  
Sbjct: 181 AVKVAHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPATIRREYAGKMGAKVYDP 240

Query: 286 PKTDLKEGETIVSKLIEM--TDGGLEYTFDCTGNTKVMRDALEAC 328
                 E    V  L EM     G +YTFDC+G    +  A+E C
Sbjct: 241 TGVPFDES---VKTLREMGPNGDGFDYTFDCSGLPITLNAAIECC 282

>Skud_11.86 Chr11 (165849..166445) [597 bp, 198 aa] {ON} YKL141W
          (REAL)
          Length = 198

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 1  MLPKTFNRKVFTTFSSVFQKRPPLCTSLRLITTTEGRGFLQSKSEKYKAKQFNTQ--LNQ 58
          M+    N+ V     SVF +   L TS RL+  T    FL + S K  A + NT+  + +
Sbjct: 5  MVKLGLNKSVLLLKPSVFSRAAALSTSRRLLFNTARTSFLYTSSLKNIATEMNTKAAIAE 64

Query: 59 NKLTNISIGKLPIS 72
           ++ N    K PIS
Sbjct: 65 EQVLNKQRAKRPIS 78

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 48/101 (47%), Gaps = 1/101 (0%)

Query: 226 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFIN 285
           AI  A  + G +V + G G +GL  +      G ++IIV +    ++ ++   GA  +  
Sbjct: 181 AINIAQFKPGSSVLILGGGPIGLGTILALNGHGCTEIIVSEPVKLRRDYAEKMGAVVYDP 240

Query: 286 PKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALE 326
            +   ++    + K+    D G +Y FDC+G    ++ ++E
Sbjct: 241 LQCSHEQSIPNLRKMAPGAD-GFDYCFDCSGTPATLKASIE 280

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

Query: 203 VDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKI 262
           +  + P + +  L CG  T Y    +     K   VA+ G G +G   +  +KA GA ++
Sbjct: 160 IPDDIPSELVAPLQCGGLTVYSPIKRNIEGVKDPKVAIIGIGGLGHMAIMISKALGA-EV 218

Query: 263 IVVDVNDQKKQWSMDFGATDFI 284
                   KK+ ++  GA  FI
Sbjct: 219 TAFSRGYSKKEDALKMGAHHFI 240

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,644,391
Number of extensions: 1521072
Number of successful extensions: 4264
Number of sequences better than 10.0: 171
Number of HSP's gapped: 4288
Number of HSP's successfully gapped: 227
Length of query: 422
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 310
Effective length of database: 40,638,807
Effective search space: 12598030170
Effective search space used: 12598030170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)