Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A006101.83ON56556527590.0
Suva_5.41.83ON59051522000.0
Smik_5.241.83ON59056321890.0
NCAS0B085701.83ON53251321690.0
YEL063C (CAN1)1.83ON59051521740.0
Skud_5.261.83ON59051521610.0
KNAG0C007901.83ON57951521400.0
TDEL0C061801.83ON58351520450.0
CAGL0J08184g1.83ON57251220320.0
TPHA0B044801.83ON60351520340.0
KAFR0D007001.83ON57452119670.0
TBLA0A054501.83ON60651619700.0
NCAS0A006001.83ON54451819290.0
Kpol_2000.651.83ON59551519330.0
SAKL0C02662g1.83ON54854419240.0
NDAI0F042001.83ON56656819040.0
Smik_14.671.83ON57351219020.0
YNL270C (ALP1)1.83ON57350918830.0
Skud_14.701.83ON57351118820.0
KNAG0C05920singletonON59951318760.0
Kwal_33.134011.83ON55956518680.0
SAKL0C02640gsingletonON54851418640.0
Suva_14.731.83ON49747918420.0
ZYRO0F16654g1.83ON58051518480.0
KLLA0C02343g1.83ON58151718460.0
SAKL0C02684gsingletonON58851518440.0
KLTH0F02398g1.83ON55551117900.0
Kpol_2000.641.84ON61056417950.0
TBLA0A054601.84ON60851517930.0
CAGL0J08162g1.84ON59751217860.0
TPHA0B044701.84ON59951417840.0
NCAS0A006101.84ON60751317780.0
NDAI0F041901.84ON59951117690.0
TDEL0C061701.84ON57356717620.0
Smik_14.681.84ON61150817630.0
Skud_14.711.84ON61251117490.0
Suva_14.751.84ON61156717470.0
YNL268W (LYP1)1.84ON61156317380.0
Ecym_10881.84ON56751617320.0
KNAG0F004801.84ON59751117270.0
Kwal_33.134111.84ON56056717220.0
Ecym_10871.83ON57050917190.0
KLTH0F02420g1.84ON62151617180.0
KAFR0D039401.83ON59751817150.0
SAKL0C02728g1.84ON56251617050.0
KLLA0C02365g1.84ON57951616980.0
AFR667C1.84ON56352416360.0
ZYRO0F16632g1.84ON60751616050.0
AFR668W1.83ON55650915530.0
Kwal_33.15545na 1ON5765018771e-110
SAKL0G14916gna 1ON5815048751e-110
CAGL0A01199gna 1ON6135028701e-108
Kpol_358.3na 1ON5755118641e-108
KLTH0B01166gna 1ON5775018621e-108
KLLA0E16281gna 1ON6055048581e-107
Ecym_2480na 1ON5865068551e-106
Smik_6.473na 1ON6065078551e-106
YPL265W (DIP5)na 1ON6085068541e-106
TPHA0M00130singletonON6115148531e-106
Skud_16.12na 1ON6075118521e-106
Suva_16.40na 1ON6065048441e-105
Kwal_26.69407.44ON5705328411e-105
TBLA0A07060na 1ON6255088431e-104
NCAS0D02260na 1ON5975028341e-103
KNAG0L02470singletonON6385068291e-102
KAFR0B06430singletonON5935058251e-102
SAKL0F09790gsingletonON5585178181e-101
Kwal_27.126811.244ON5935658121e-100
TPHA0H028507.44ON6015258081e-99
TDEL0H040707.44ON5775048043e-99
NDAI0I02660na 1ON5945488035e-99
KLTH0D01474g7.44ON6245198048e-99
SAKL0B10956g7.44ON5725047894e-97
YOR348C (PUT4)7.44ON6276017925e-97
AFR156W7.44ON5584857866e-97
KNAG0E003907.44ON5995297862e-96
TDEL0C00930singletonON5954997853e-96
Kpol_543.791.244ON6054967845e-96
CAGL0E05632g7.44ON5985227802e-95
ZYRO0D03762g1.244ON6004937774e-95
ZYRO0D17908gna 1ON5184937706e-95
Kpol_367.77.44ON5845347731e-94
SAKL0C01232gsingletonON6135077742e-94
Ecym_80357.44ON5634907675e-94
Smik_15.5327.44ON6315327717e-94
Suva_8.4027.44ON6835367741e-93
TPHA0B010901.244ON6064967681e-93
Ecym_60211.244ON6004967662e-93
SAKL0G14014g5.158ON6055017662e-93
NDAI0B052201.244ON6114967672e-93
NDAI0E038007.44ON6215017646e-93
Skud_11.2751.244ON6024987611e-92
KAFR0D005001.50ON6175297612e-92
Suva_2.716singletonON6034947574e-92
NDAI0D021605.158ON5875497557e-92
Ecym_47895.158ON5885087522e-91
TDEL0A08030singletonON5144927462e-91
KNAG0L02460singletonON5885027495e-91
KLTH0E15642g1.244ON5965717495e-91
TBLA0C01240singletonON6295147482e-90
KLLA0A11770g5.158ON5815247442e-90
Skud_15.5157.44ON6265367472e-90
CAGL0K05753g1.50ON6605157483e-90
ACL135Wna 1ON5885097424e-90
YCL025C (AGP1)1.50ON6335137456e-90
Suva_2.6881.50ON6615077467e-90
YKR039W (GAP1)1.244ON6025227427e-90
CAGL0B01012g1.50ON6235067438e-90
Kwal_33.154075.158ON5875067391e-89
AFR698C1.50ON6095087411e-89
SAKL0C01650g1.50ON6135197411e-89
Kwal_33.132041.50ON6074987392e-89
SAKL0D00836gna 2ON6014947382e-89
AFR230C1.244ON6045007374e-89
Smik_3.531.50ON6335067385e-89
CAGL0B03773g5.158ON6055007358e-89
NCAS0A071105.158ON5925007331e-88
NDAI0A006401.50ON6414967361e-88
Kwal_23.4026singletonON5345137282e-88
TDEL0C065101.50ON6425147343e-88
KNAG0C02140singletonON5984917313e-88
KAFR0C051607.44ON5845087293e-88
NCAS0B079001.244ON6194977306e-88
TDEL0F02830na 3ON5615067257e-88
Suva_3.1891.50ON6335067317e-88
Suva_11.2731.244ON6014987288e-88
Skud_3.381.50ON6335067301e-87
Skud_4.7841.50ON6635197311e-87
NCAS0E022607.44ON5935307252e-87
Smik_4.7901.50ON6634767302e-87
KAFR0D00510na 4ON6174977262e-87
YDR508C (GNP1)1.50ON6635477274e-87
Kpol_543.78singletonON6054967235e-87
KAFR0D00520na 5ON5985057226e-87
NDAI0A01340singletonON5544967186e-87
NCAS0J00140na 6ON5584967152e-86
KLTH0F01584g1.50ON5964997182e-86
Suva_7.4855.158ON6035007173e-86
YGR191W (HIP1)5.158ON6035007174e-86
SAKL0D04664g1.244ON5934937164e-86
Skud_7.5255.158ON6035007165e-86
NDAI0G060301.368ON5995087156e-86
KLTH0B02046g5.158ON5895107146e-86
Smik_16.1155.158ON6035007157e-86
NCAS0B085801.50ON6275047151e-85
KNAG0G009005.158ON6135027141e-85
AGR319W5.158ON6265047151e-85
Smik_11.3021.244ON5534777091e-85
KAFR0E018505.158ON5605267101e-85
KLLA0F23419g7.44ON5735267111e-85
SAKL0F16544gsingletonON5675257082e-85
Kwal_26.9612singletonON5434947063e-85
Ecym_10561.50ON6065067104e-85
TPHA0A002405.158ON6035007079e-85
KAFR0D04120na 5ON6485027109e-85
NDAI0C029505.158ON6095337062e-84
YBR068C (BAP2)3.284ON6095067062e-84
CAGL0M00154gsingletonON5504947012e-84
TBLA0A05190na 5ON6675097092e-84
AGR039Cna 7ON5865017033e-84
Ecym_26643.285ON5755057023e-84
Suva_4.3073.284ON6095117043e-84
SAKL0D02970g3.284ON6015837017e-84
KLLA0C01606g1.50ON6205057028e-84
TPHA0A047005.158ON5694966988e-84
KAFR0A011203.284ON5925587008e-84
Kwal_33.14276na 2ON5964947008e-84
NCAS0D018705.158ON5955227009e-84
CAGL0L03267g1.244ON5974966991e-83
TBLA0B077605.158ON6585027031e-83
TBLA0A051801.50ON6765127042e-83
Skud_2.1913.284ON6095066992e-83
Skud_15.1381.368ON5925146972e-83
KLLA0A06886gsingletonON5875036953e-83
TBLA0G031203.284ON6734936996e-83
Kpol_2000.921.50ON6374996977e-83
YOL020W (TAT2)1.368ON5925146939e-83
NCAS0A089201.368ON5995086939e-83
TPHA0E036601.50ON6475006933e-82
CAGL0H08393g3.284ON6125076895e-82
Kpol_1010.325.158ON5995076885e-82
KNAG0F002701.50ON6345586907e-82
AGR038C3.284ON5805136858e-82
KAFR0F02250singletonON5544956821e-81
Ecym_2663na 7ON5894956842e-81
KLLA0A06930g1.244ON5875036832e-81
CAGL0D02178g1.368ON5775356822e-81
NDAI0A056203.284ON5715136813e-81
TDEL0E05750singletonON5485106784e-81
YDR046C (BAP3)3.284ON6045506825e-81
NCAS0A004201.50ON6795076875e-81
Suva_2.2033.284ON6045506801e-80
Smik_2.2013.284ON6095066791e-80
SAKL0A09724gna 8ON5514976742e-80
Kpol_2002.441.50ON6274986802e-80
NCAS0A106803.284ON5935056772e-80
KLLA0F27093gsingletonON5634536752e-80
ZYRO0G07172gna 3ON5674946743e-80
Skud_6.2na 6ON5584926717e-80
Smik_13.1singletonON5234936687e-80
Suva_15.1481.368ON5925146738e-80
Smik_15.1461.368ON5935146738e-80
AEL030W1.368ON5825146711e-79
TBLA0C012101.368ON6005076721e-79
Smik_4.2843.284ON6045446721e-79
KLTH0F01606gna 5ON6044956721e-79
Ecym_27161.368ON5925146702e-79
KLTH0C05170g3.284ON5985056702e-79
SAKL0C13992gsingletonON5524896672e-79
Kwal_27.105383.284ON6025076702e-79
Sklu_YGOB_Anc_1.3681.368ON5414466653e-79
Skud_4.3003.284ON6045786694e-79
KNAG0L00110na 6ON5714936665e-79
SAKL0D02948gna 7ON5945066676e-79
Smik_6.482na 9ON5584976646e-79
ZYRO0F17446g1.50ON6334996697e-79
SAKL0D02926g3.285ON5835156659e-79
Kpol_534.221.368ON5925146651e-78
ZYRO0A00308gsingletonON5644916622e-78
KLTH0H13398g1.368ON5875046622e-78
Ecym_26623.284ON5895156614e-78
KLLA0A10813g1.368ON5845146605e-78
KNAG0H011503.284ON6174956625e-78
KAFR0C004003.284ON5825046596e-78
Kwal_23.2817na 10ON5805246597e-78
KLTH0F04048gsingletonON5835156581e-77
Suva_13.517singletonON5474976551e-77
NDAI0A074903.284ON5965066581e-77
ZYRO0C18502g7.44ON5755276552e-77
Kwal_8.590na 11ON6295156592e-77
KLTH0B00154gna 11ON5565166542e-77
YFL055W (AGP3)na 6ON5585006532e-77
KNAG0C005901.50ON6344976583e-77
KLLA0B14685gna 10ON5715186526e-77
KNAG0J022103.285ON5815096526e-77
Skud_16.2na 9ON4964606459e-77
NDAI0F043901.50ON6674966552e-76
NCAS0I015303.284ON5955086484e-76
KLTH0D07128gna 8ON5434956444e-76
TBLA0I020103.285ON6284956496e-76
KNAG0J022003.284ON6075046468e-76
AGR040C3.285ON5735036449e-76
Ecym_8297na 12ON5695136421e-75
ADL272Wna 12ON5644956421e-75
Kwal_26.8097na 8ON5445336401e-75
SAKL0H08184gna 12ON5984986441e-75
KAFR0D04130na 4ON6444946435e-75
TPHA0A025001.368ON5905156396e-75
Skud_2.1923.285ON6195536391e-74
KAFR0D041401.50ON6374946392e-74
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A00610
         (565 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...  1067   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   852   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   847   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            840   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   842   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   837   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              828   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   792   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   787   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   788   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   762   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   763   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   747   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   749   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   745   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            738   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   737   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   729   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   729   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            727   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   724   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   722   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   714   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   716   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   715   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   714   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   694   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   696   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   695   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   692   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   691   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              689   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   686   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   683   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   683   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   678   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   677   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   674   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   671   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                669   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   667   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   666   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   666   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   665   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   661   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   658   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   634   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   622   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   602   0.0  
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   342   e-110
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   341   e-110
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   339   e-108
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   337   e-108
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   336   e-108
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   335   e-107
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   333   e-106
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   333   e-106
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   333   e-106
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     333   e-106
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   332   e-106
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   329   e-105
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   328   e-105
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   329   e-104
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              325   e-103
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             323   e-102
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   322   e-102
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   319   e-101
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   317   e-100
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   315   1e-99
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   314   3e-99
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   313   5e-99
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   314   8e-99
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   308   4e-97
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   309   5e-97
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   307   6e-97
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   307   2e-96
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   306   3e-96
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   306   5e-96
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   305   2e-95
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   303   4e-95
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   301   6e-95
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   302   1e-94
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   302   2e-94
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   300   5e-94
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   301   7e-94
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   302   1e-93
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   300   1e-93
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   299   2e-93
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   299   2e-93
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   300   2e-93
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     298   6e-93
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   297   1e-92
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      297   2e-92
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   296   4e-92
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    295   7e-92
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   294   2e-91
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            291   2e-91
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             293   5e-91
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   293   5e-91
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   292   2e-90
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   291   2e-90
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   292   2e-90
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   292   3e-90
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   290   4e-90
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   291   6e-90
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   291   7e-90
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   290   7e-90
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   290   8e-90
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   289   1e-89
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   290   1e-89
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   290   1e-89
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   289   2e-89
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   288   2e-89
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   288   4e-89
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   288   5e-89
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   287   8e-89
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   286   1e-88
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   288   1e-88
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   285   2e-88
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   287   3e-88
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   286   3e-88
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   285   3e-88
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   285   6e-88
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   283   7e-88
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   286   7e-88
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   285   8e-88
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   285   1e-87
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   286   1e-87
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     283   2e-87
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   285   2e-87
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      284   2e-87
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   284   4e-87
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   283   5e-87
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   282   6e-87
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              281   6e-87
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      280   2e-86
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   281   2e-86
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   280   3e-86
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   280   4e-86
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   280   4e-86
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   280   5e-86
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   280   6e-86
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   279   6e-86
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   280   7e-86
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   280   1e-85
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   279   1e-85
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   280   1e-85
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   277   1e-85
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   278   1e-85
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   278   1e-85
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   277   2e-85
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   276   3e-85
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   278   4e-85
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   276   9e-85
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   278   9e-85
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    276   2e-84
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   276   2e-84
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   274   2e-84
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   277   2e-84
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   275   3e-84
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   275   3e-84
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   275   3e-84
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   274   7e-84
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   275   8e-84
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   273   8e-84
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   274   8e-84
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   274   8e-84
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   274   9e-84
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   273   1e-83
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   275   1e-83
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   275   2e-83
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   273   2e-83
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   273   2e-83
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   272   3e-83
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              273   6e-83
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   273   7e-83
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   271   9e-83
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   271   9e-83
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   271   3e-82
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   270   5e-82
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   269   5e-82
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   270   7e-82
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   268   8e-82
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              267   1e-81
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   268   2e-81
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   267   2e-81
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   267   2e-81
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            266   3e-81
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            265   4e-81
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   267   5e-81
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   269   5e-81
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   266   1e-80
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   266   1e-80
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   264   2e-80
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   266   2e-80
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   265   2e-80
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   264   2e-80
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   264   3e-80
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      263   7e-80
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    261   7e-80
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   263   8e-80
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   263   8e-80
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   263   1e-79
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   263   1e-79
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   263   1e-79
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   263   1e-79
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   262   2e-79
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   262   2e-79
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   261   2e-79
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   262   2e-79
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   260   3e-79
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   262   4e-79
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   261   5e-79
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   261   6e-79
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   260   6e-79
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   262   7e-79
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   260   9e-79
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   260   1e-78
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   259   2e-78
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   259   2e-78
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   259   4e-78
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   258   5e-78
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              259   5e-78
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                258   6e-78
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   258   7e-78
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   258   1e-77
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   256   1e-77
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   258   1e-77
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   256   2e-77
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   258   2e-77
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   256   2e-77
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   256   2e-77
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   258   3e-77
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   255   6e-77
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   255   6e-77
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   253   9e-77
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   256   2e-76
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              254   4e-76
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   252   4e-76
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   254   6e-76
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   253   8e-76
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   252   9e-76
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   251   1e-75
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   251   1e-75
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   251   1e-75
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   252   1e-75
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              252   5e-75
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   250   6e-75
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   250   1e-74
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              250   2e-74
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                248   2e-74
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   248   6e-74
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   247   1e-73
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   243   2e-73
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   246   2e-73
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   247   3e-73
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   243   3e-73
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   246   3e-73
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   245   1e-72
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   243   8e-72
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   241   1e-71
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   239   4e-71
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   239   2e-70
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   238   5e-70
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   238   6e-70
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              238   6e-70
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   236   2e-69
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   234   9e-69
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   233   3e-68
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   233   4e-68
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              232   4e-68
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   229   4e-67
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   229   5e-67
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   231   6e-67
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    228   2e-66
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   227   4e-66
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   227   4e-66
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   221   6e-65
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   221   2e-64
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   221   3e-64
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   221   4e-64
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   221   7e-64
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   220   1e-63
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      220   1e-63
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   219   2e-63
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   219   2e-63
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              220   2e-63
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   223   3e-63
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   223   4e-63
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   223   7e-63
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   218   1e-62
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   217   2e-62
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   217   2e-62
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   217   3e-62
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                216   3e-62
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   215   4e-62
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   216   5e-62
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   215   9e-62
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   219   1e-61
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   219   1e-61
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   215   1e-61
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   214   2e-61
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   218   3e-61
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   213   4e-61
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   213   5e-61
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   212   1e-60
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   217   1e-60
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   212   1e-60
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   216   1e-60
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   212   2e-60
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   211   2e-60
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   210   5e-60
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   209   1e-59
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   209   3e-59
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   213   3e-59
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   207   4e-59
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   207   6e-59
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   205   1e-58
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   207   1e-58
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   211   2e-58
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                206   2e-58
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   204   1e-57
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   206   4e-57
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   202   7e-57
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   201   9e-57
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   204   2e-56
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   199   4e-56
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   201   4e-55
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   201   6e-55
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   199   1e-54
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   197   7e-54
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   194   8e-53
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   193   2e-52
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   190   2e-51
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     181   3e-51
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     180   5e-51
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   171   5e-45
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         139   2e-36
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   133   6e-35
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    89   5e-20
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          89   2e-19
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      89   4e-19
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     90   7e-19
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          85   1e-18
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      73   1e-14
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      68   2e-13
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    59   4e-09
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    37   0.17 
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    36   0.26 
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              34   0.37 
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    35   0.49 
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    35   0.52 
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    35   0.60 
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    35   0.71 
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    34   1.1  
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    33   2.4  
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    32   2.8  
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              30   5.6  
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    32   6.5  
KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {O...    31   9.4  

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score = 1067 bits (2759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/565 (93%), Positives = 530/565 (93%)

Query: 1   MDKKQEEPLKNGKIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIREAEVK 60
           MDKKQEEPLKNGKIKSSSYELDDYPLHRRTNSVH               ANGQIREAEVK
Sbjct: 1   MDKKQEEPLKNGKIKSSSYELDDYPLHRRTNSVHSIPSQITIESQEEEIANGQIREAEVK 60

Query: 61  RELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMAT 120
           RELKQRH                    PLTNAGPVGALIAYLFMGTLVYSVTQSLGEMAT
Sbjct: 61  RELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMAT 120

Query: 121 FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWI 180
           FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWI
Sbjct: 121 FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWI 180

Query: 181 SIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRN 240
           SIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRN
Sbjct: 181 SIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRN 240

Query: 241 PGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVV 300
           PGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVV
Sbjct: 241 PGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVV 300

Query: 301 FRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILST 360
           FRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILST
Sbjct: 301 FRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILST 360

Query: 361 IISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGG 420
           IISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGG
Sbjct: 361 IISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGG 420

Query: 421 EAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFF 480
           EAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFF
Sbjct: 421 EAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFF 480

Query: 481 MTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDR 540
           MTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDR
Sbjct: 481 MTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDR 540

Query: 541 RDIEEVVWEDPPPVTFWDKFWNVVA 565
           RDIEEVVWEDPPPVTFWDKFWNVVA
Sbjct: 541 RDIEEVVWEDPPPVTFWDKFWNVVA 565

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/515 (78%), Positives = 456/515 (88%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G+++ AEVKRELKQRH                    PLTNAGPVGALI+YLFMG+L YS
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           VTQSLGEMATFIPVTSSFTVFSQRFLSP+FGAANGYMYWFSWA+TFALELSVVGQ+IQFW
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T AVP+ AWISIFWV++ AMNMFPV++YGEFEFWVASIKV+AI+GFLIYC CMVCGAGVT
Sbjct: 196 TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GPVGFRYWRNPG  GPGII+KN NEA+FLGWVSSLINAAFT+QGTELVGITAGEAANPRK
Sbjct: 256 GPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILP 350
           +VPRAIKKVVFRIL FYIGSL FIGLLVPYNDPKLTS  SYV+ SPFII+I+NSGT +LP
Sbjct: 316 TVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLP 375

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           HIFNAVIL+TIISAANSN+YVGSR++FGLSKSKLAP+  S+T K GVP+++V  T +FGA
Sbjct: 376 HIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGA 435

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           LAYMETSTGG   F WLLNITGVAGFF+WLFIS+SH+RFMQAL+YRGISRD+LPFKAK M
Sbjct: 436 LAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLM 495

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
           PGLAYYA FFM +II+IQGFTSF P+F+G++FLAAYIS FLF+AIWI+F+L FRCR +WK
Sbjct: 496 PGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWK 555

Query: 531 IEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           IEDVDID+DRRDIE +VWE+P P T WDKFWNVV 
Sbjct: 556 IEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/563 (73%), Positives = 468/563 (83%), Gaps = 7/563 (1%)

Query: 3   KKQEEPLKNGKIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIREAEVKRE 62
           ++   PLK+ K K      + YPLH  +  V                  G++R AEVKRE
Sbjct: 35  RRGSLPLKDEKNK------ELYPLHSFSTRVDGEDTFSMGDVIRDED-QGEVRNAEVKRE 87

Query: 63  LKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFI 122
           LKQRH                    PL NAGPVGALI+YLFMG+L YSVTQSLGEMATFI
Sbjct: 88  LKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQSLGEMATFI 147

Query: 123 PVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISI 182
           PVTSSFTVFSQRFLSP+FGAANGYMYWFSWAITFALELSVVGQ+I+FWT+ VP+ AWISI
Sbjct: 148 PVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNKVPLAAWISI 207

Query: 183 FWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPG 242
           FWV++  MN+FPV++YGEFEFWVASIKVLAI+GFLIYC CMVCGAGVTGPVGFRYWRNPG
Sbjct: 208 FWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPG 267

Query: 243 PMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFR 302
             GPGII+K+ NE +FLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPRAIKKVVFR
Sbjct: 268 AWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFR 327

Query: 303 ILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTII 362
           IL FYIGSL FIGLLVPYNDPKLT+  SYV+ SPFII+I+NSGT +LPHIFNAVIL+TII
Sbjct: 328 ILTFYIGSLLFIGLLVPYNDPKLTTATSYVSVSPFIIAIENSGTKVLPHIFNAVILTTII 387

Query: 363 SAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEA 422
           SAANSN+YVGSRI+FGLSK+KLAP+ LSRT K GVP+++V  T +FGALAYMETSTGG+ 
Sbjct: 388 SAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALAYMETSTGGDK 447

Query: 423 AFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMT 482
            F WLLNITGVAGFF+WL ISISH+RFMQAL+YRGISRD+LPFKAK MPGLAY+A  FM 
Sbjct: 448 VFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPGLAYFAATFMI 507

Query: 483 LIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRD 542
           +II+IQGFT+F P FDGIDFLAAYIS FLF+AIWI+F++ FRCR IWKIEDVDID+DRRD
Sbjct: 508 IIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFIWKIEDVDIDSDRRD 567

Query: 543 IEEVVWEDPPPVTFWDKFWNVVA 565
           IE +VWED  P TFWDKFWNVVA
Sbjct: 568 IEAIVWEDHEPKTFWDKFWNVVA 590

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/513 (79%), Positives = 451/513 (87%), Gaps = 1/513 (0%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
           ++    V+RELKQRH                    PL NAGPVGALIAYLFM TL YSVT
Sbjct: 21  EVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVT 80

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
           QSLGEMATFIPVTSSFTVFSQRF+SP+FGAANGYMYWFSW ITFALELSVVGQ+IQFWT 
Sbjct: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
           AVP+ AWISIFWVLL  MNMFPV++YGEFEFWVA +KV+AIMGFLIYC CMVCGAGVTGP
Sbjct: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           VGFRYWR+PG  GPGIIAK+ N+A+FLGWVSSLINAAFT+QGTELVGITAGEAANPRK+V
Sbjct: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHI 352
           PRAIKKVVFRILFFYI SLFFIGLLVPY+D KLTS DSYV+ASPFII+I+NSGT +LPHI
Sbjct: 261 PRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHI 320

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
           FNAVI++TIISA NSN+YVGSRIM+GLS S+LAP ILSRT ++GVPWV+V+ T LFGALA
Sbjct: 321 FNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALA 380

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           YMETSTGG+ AFNWLLNITGVAGFF+WLFIS+SH+RFMQALE RGISRDDLPFKAK+MPG
Sbjct: 381 YMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPG 440

Query: 473 LAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIE 532
           LAYY +FFMTLIIIIQGFTSFCP ++GIDFL AYIS F+FIAIWI FQ WFRCRLIW++E
Sbjct: 441 LAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVE 499

Query: 533 DVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           DVDIDTDRR +EE VW +  P  FWDKFWNVVA
Sbjct: 500 DVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/515 (78%), Positives = 449/515 (87%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G+++ AEVKRELKQRH                    PLTNAGPVGALI+YLFMG+L YS
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           VTQSLGEMATFIPVTSSFTVFSQRFLSP+FGAANGYMYWFSWAITFALELSVVGQ+IQFW
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T  VP+ AWISIFWV++  MN+FPV++YGEFEFWVASIKVLAI+GFLIYC CMVCGAGVT
Sbjct: 196 TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT 255

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GPVGFRYWRNPG  GPGII+K+ NE +FLGWVSSLINAAFT+QGTELVGITAGEAANPRK
Sbjct: 256 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILP 350
           SVPRAIKKVVFRIL FYIGSL FIGLLVPYNDPKLT   SYV+ SPFII+I+NSGT +LP
Sbjct: 316 SVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLP 375

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           HIFNAVIL+TIISAANSN+YVGSRI+FGLSK+KLAP+ LSRT K GVP+++V  T  FGA
Sbjct: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           LAYMETSTGG+  F WLLNITGVAGFF+WLFISISH+RFMQAL+YRGISRD+LPFKAK M
Sbjct: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
           PGLAYYA  FMT+IIIIQGFT+F P F+G+ F AAYIS FLF+A+WI+FQ  FRCR IWK
Sbjct: 496 PGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWK 555

Query: 531 IEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           I DVDID+DRRDIE +VWED  P TFWDKFWNVVA
Sbjct: 556 IGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/515 (78%), Positives = 451/515 (87%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G+++ AEVKRELKQRH                    PL NAGPVGALIAYLFMG+L +S
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFS 135

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           VTQSLGEMATFIPVTSSFTVFSQRFLSP+FGAANGYMYWFSWAITFALELSVVGQ+IQFW
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T  VP+ AWISIFWVL+  MN+FPV++YGEFEFWVASIKV+AI+GFLIYC CMVCGAGVT
Sbjct: 196 THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GPVGFRYWRNPG  GPGII+KN NE +FLGWVSSLINAAFT+QGTELVGITAGEAANPRK
Sbjct: 256 GPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILP 350
           +VPRAIKKVVFRIL FYIGSL FIGLLVPYNDPKLT   SYV+ SPFI++IQNSGT +LP
Sbjct: 316 TVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLP 375

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           HIFNAVIL+TIISAANSN+YVGSRI+FGLSK+KLAP+ LSRT+K GVP+++V  T +FGA
Sbjct: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGA 435

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           LAYMETSTGG+  F WLLNITGVAGFF+WLFISISH+RFMQAL+YRGISRD+LPFKAK M
Sbjct: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
           PGLAYY+ FFM +IIIIQGFT+F P F+G  FLAAYIS FLFIA+WI+F+  FRCR IWK
Sbjct: 496 PGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWK 555

Query: 531 IEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           IEDVDID+DRRDIE +VWED  P TFWDKFWNVVA
Sbjct: 556 IEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/515 (76%), Positives = 444/515 (86%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G + +AEVKRELKQRH                    PL  AGPVGALI+Y+FMGTLVYS
Sbjct: 65  TGYVHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYS 124

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           VTQSLGEMATFIPVTSSFTVF+QRFLSPS GAA GYMYWFSWA+TFALELSV+GQ+IQ+W
Sbjct: 125 VTQSLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYW 184

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T AVP+ AWISIFWV++ A NMFPV++YGE EFW+A IKV+AI+GFL+YCLCMVCGAGVT
Sbjct: 185 TYAVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVT 244

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GPVGFRYWRNPGP GPGII+K+ NEA+FLGWVSSLIN AFTYQGTELVGI+AGEAANPRK
Sbjct: 245 GPVGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRK 304

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILP 350
           +VPRAIKKVVFRILFFYIGSLFFIGLLVPYND  L + DSYVA+SPFII+I+NSGTP+LP
Sbjct: 305 AVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVLP 364

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           HIFNAVI  TI+SA NSNVYVGSRI+FGLSK+KLAP+ILSRT K GVPW++V+ T + GA
Sbjct: 365 HIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGA 424

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           LAYMETSTGG+ AFNWLLNIT VAGFF+WLFIS+SH+RFMQAL+YRGISRDDLPFKA  M
Sbjct: 425 LAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALM 484

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
           PGLAYYA F M +IIIIQGFT+F P F G DF AAYIS FLFI IW +FQ+ FRCR I K
Sbjct: 485 PGLAYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHK 544

Query: 531 IEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           +EDVDIDTDRRDIE VVWED  P T WDKFWN++A
Sbjct: 545 VEDVDIDTDRRDIEAVVWEDAEPKTVWDKFWNIIA 579

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/515 (74%), Positives = 439/515 (85%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            GQ+ EAEVKR LKQRH                    PL+NAGPVG LIAYLFM TLVYS
Sbjct: 69  EGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYS 128

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           V QSLGEMATFIPVTS+FTVFS RFLSP+FGAA+GYMYWFSWAITFALELSVVGQII+FW
Sbjct: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T+AVP+ AWI+IFWVLL   N+FPV++YGEFEFW+A IKV+A++GF+IYCLCMVCGAG+T
Sbjct: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GPVGFRYWRNPG  GPGII+K+ NE +FLGWVSSLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILP 350
           SVPRAIKKVVFRIL FY     FIGLLVPYNDPKL S DSYV++SPFII+I+NSGT +LP
Sbjct: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLP 368

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           HIFNAV+L+TIISA NSNVYVGSRIM+GL+K KLAP    RTN  GVP+ +V FT  FGA
Sbjct: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           LAYME STGG +AFNWLLNITGVAGFF+W+ IS  H+RFMQAL+YRGISRDDLPFKAKFM
Sbjct: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
           P LAYYA+FFM +II+IQGFT+F P+F G+DF AAY+S FLFIAIW+  Q+WFRCR+  +
Sbjct: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHR 548

Query: 531 IEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           +++VDIDTDRRDIE VVW+D PP T WDKFWN+VA
Sbjct: 549 LDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/512 (74%), Positives = 432/512 (84%)

Query: 54  IREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQ 113
           +   +VKR LKQRH                    PL NAGPVGAL+AYLFMGT+V+SVTQ
Sbjct: 61  LEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQ 120

Query: 114 SLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
           SLGEMATFIPVTSSF+VF+QRFLSP+ GAANGYMY+ SW  TFALELSVVGQIIQFWT  
Sbjct: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPV 233
           VP+ AWISIFWVLL A NMFPV+FYGEFEFW+ASIKVLA+MGFLIY LC+VCGAG TGP+
Sbjct: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPI 240

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           GFRYWRNPG MGPGII+ N  EA+FLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VP
Sbjct: 241 GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIF 353
           RAI+KV+ RIL FYIGSLFFIGL VPYNDPKLTS DSYV++SPFII+IQN+GT +LPHIF
Sbjct: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIF 360

Query: 354 NAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAY 413
           NAVIL+TIISA NSNVYVGSRI+F ++K+ LAP+ L++T   GVP++SV+    FG+L+Y
Sbjct: 361 NAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSY 420

Query: 414 METSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGL 473
           ME STGG  AFNWLLNITGVAGFF+WL IS SHVRFMQAL++RGISRDDLP+KA +MP L
Sbjct: 421 MELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWL 480

Query: 474 AYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIED 533
           AYYAIFFM +II+IQGFTSF P F G DF+AAYIS  LF+  W  FQ++FRCR+IWK+ED
Sbjct: 481 AYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLED 540

Query: 534 VDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           VDIDTDRR+IE VVWED  P T WDKFW+ VA
Sbjct: 541 VDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/515 (75%), Positives = 447/515 (86%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G ++EAEVKR+LKQRH                    PL NAGPVGALIAYLFM T+V+S
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           VTQSLGEMATFIPVTSSFTVFS RFLSP+ GAANGYMYWFSWA+TFALELSVVGQIIQFW
Sbjct: 149 VTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFW 208

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T AVP+ AWI I+WV+L  MN+FPV+FYGEFEFWVASIKVLAI+GFLIYCLCMVCGAGVT
Sbjct: 209 THAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVT 268

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GPVGFRYWRNPGP GPGII+K++NE +FLGWVSSLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 269 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 328

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILP 350
           +VPRAIKKV FRIL FYI SLFFIGLLVPY+D KLTS DSY++ASPFII+I+NSGT ILP
Sbjct: 329 TVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISASPFIIAIENSGTKILP 388

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           HIFNAVILSTIISA NSNVYVGSRI+FGL+K+KLAP+    T++ GVP+ SV FT  FGA
Sbjct: 389 HIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGA 448

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           LA++E S+GG  AFNWLLNI  VAGFF+WL ISI+HVRFMQAL++RGISRDDLPFKA+FM
Sbjct: 449 LAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFM 508

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
           P LAYY+IFFMT+IIIIQGFT+F P+F+G DF+AAYIS FLF  +W+ FQL+FR +L+W 
Sbjct: 509 PHLAYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWT 568

Query: 531 IEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           +E+VDIDTDRRD++ ++WED  P TFWDKFW+VVA
Sbjct: 569 VEEVDIDTDRRDVDAIIWEDSGPKTFWDKFWDVVA 603

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/521 (72%), Positives = 441/521 (84%), Gaps = 6/521 (1%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G + +AEVKRELKQRH                    PL ++GPVG+LIAY+F+GTL Y+
Sbjct: 54  SGSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYA 113

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           VTQSLGEMATFIPVTSSFTVF+ RFLSPS GAA GYMYWFSWA+TFALELSVVGQI+ +W
Sbjct: 114 VTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW 173

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T AVPI AWISIFWV+L A+NMFPV+FYGE EFWVA++KV+AI+GFLIYCLCMVCGAGVT
Sbjct: 174 TFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVT 233

Query: 231 GPVGFRYWRNPGPMGPGI------IAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGE 284
           GPVGFRYWRNPGP G G+      I+KN N  +FLGW +SLINAAFTYQGTELVGITAGE
Sbjct: 234 GPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGE 293

Query: 285 AANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNS 344
           AANPRK+VPRAIKKVVFRIL FYIGSLFFIGLLVP++DPKL+SDDSYV++SPFII+I+NS
Sbjct: 294 AANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIENS 353

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           GT ILP IFNA+IL TIISA NSN+YVGSRI+F L+K+ LAP+ILSRT K GVPWVSV+ 
Sbjct: 354 GTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLA 413

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           T +FG LAYMET+ GG+  F+WL+NIT +AGF++WLFI ISH+RFMQ L++RGISRDDLP
Sbjct: 414 TAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLP 473

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFR 524
           FKA  MPGLAYYA+F M +III QGFT+F P+FD  DF AAYIS  LF  IW  FQLWF+
Sbjct: 474 FKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFK 533

Query: 525 CRLIWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           CR IWK+EDVDID++RRD+E+++WEDP P TFWDKFWNVVA
Sbjct: 534 CRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/516 (74%), Positives = 440/516 (85%), Gaps = 2/516 (0%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
           A G + EA+VKRELK RH                    P+ NAGPVG+LIAY+FMGTLV+
Sbjct: 93  ATGVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVF 152

Query: 110 SVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
           SVTQSLGEMATFIPVTSSFTVF+ RF+S  FGAA GYMYWFSWAITFALELSVVGQ+I+F
Sbjct: 153 SVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEF 212

Query: 170 WTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGV 229
           WT  VP+ AWISIFWVL+V MN FPV+ YGEFEFWVASIKV+AI+GF+IYCLCMVCGAG+
Sbjct: 213 WTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGI 272

Query: 230 TGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
           TGPVGFRYWR+PGP GPGII+K+ NEA+FLGWVSSLINAAFTYQGTELVGITAGEAANPR
Sbjct: 273 TGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 332

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           KSVPRAIKKV  RIL FYI SLFFIGLLVPYNDPKL+S DSYV+ASPFII+IQNSGT +L
Sbjct: 333 KSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVL 392

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           PHIFNAVIL+TIISAANSNVYVGSRI++GLS +KLAP+   +T +NGVP+++V+FT  FG
Sbjct: 393 PHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFG 451

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
           ALAYMETS GG+ AFNWLLNITGVAGFF+WL ISISH+RFMQ L++RG+SRDDLP+KA  
Sbjct: 452 ALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAAL 511

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIW 529
           MPGLAYY  FF+TLII+IQGFT+F P FD   FL AYISCFLF+ I+IV Q +FR RL  
Sbjct: 512 MPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571

Query: 530 KIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
            ++DVDIDTDRRDI+ V+WE+ P  TFWDKFW V+A
Sbjct: 572 TLDDVDIDTDRRDIDTVIWEEGPQ-TFWDKFWAVIA 606

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/518 (70%), Positives = 432/518 (83%), Gaps = 3/518 (0%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           + Q ++ +VKRELK+RH                    PL  AGP+GALIAYLFMGT+V+S
Sbjct: 27  DDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFS 86

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           VTQSLGEM TFIPVT+SFTVF+QRFLSP+FGAANGYMYWFSWA+TFALELSVVGQIIQFW
Sbjct: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T AVP+ AWISI WVLL   N+FPVR YGE EFW+AS+KVLAI+GF+IY +C++CGAGVT
Sbjct: 147 TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAGVT 206

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GPVGFRYW+NPGP G GII+ N+NEA+F GWVSSLINAAFT+QGTELVGITAGE   PRK
Sbjct: 207 GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRK 266

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILP 350
           +VP+AIKKVVFRIL FYIGSL  IGLLVPYNDPKL S+DSYV++SPFII+IQN+GT ILP
Sbjct: 267 TVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILP 326

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           HIFNAVIL TIISA NSNVY+GSRI++GL+K+K AP+  + T+K GVP+V+V+FT +FG+
Sbjct: 327 HIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGS 386

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           LAYMET+TGG+ AF WLLNI GVAGFF+WL IS SH+RFM+AL+ RGISR+DLP+KA  M
Sbjct: 387 LAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLM 446

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
           P LAYYA+FFM +II+IQGFTSF P F   +F AAYIS FLFI  W+ FQ+WF+CRL+WK
Sbjct: 447 PWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWK 506

Query: 531 IEDVDIDTDRRDIEEVVWED---PPPVTFWDKFWNVVA 565
           ++DVD+DTDRRDIEE VW D        +WD+FWN VA
Sbjct: 507 LQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/515 (75%), Positives = 444/515 (86%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G +++AEVKRELKQRH                    PL NAGPVG+LIAYLFM T+V+S
Sbjct: 81  QGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFS 140

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           VTQSLGEMATFIPVTSSFTVFS RF+SPS GAANGYMYWFSWAITFALELSVVGQIIQFW
Sbjct: 141 VTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFW 200

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T AVP+ AWI I+W +L  MNMFPV+FYGEFEFWVASIKV+AIMGFLIYCLCMVCGAGVT
Sbjct: 201 TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT 260

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GPVGFRYWRNPGP GPGII+  + E +FLGWVSSLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 261 GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 320

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILP 350
           +VPRAIKKV FRIL FYI SLFFIGLLVP++DPKL+SDDSYV++SPFII+IQNSGT +LP
Sbjct: 321 TVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIQNSGTKVLP 380

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           HIFNAVILSTIISA NSN+YVGSR+MFGL+K+KLAPR    T K+GVP+++V+FT  FGA
Sbjct: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           LA++E S+GG  AFNWLLNI GVAGFF+WL ISI+HVRF+Q LE+RGISRDDLPFKA  M
Sbjct: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALM 500

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
           P LAYYAIFFM +IIIIQGFT+F P+F+G DF+AAYIS FLF  +W+ FQL+FRC+L W 
Sbjct: 501 PWLAYYAIFFMIIIIIIQGFTAFAPTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKLYWS 560

Query: 531 IEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           +++VDIDTDRRDI+ ++WED  P TFWD+FW+VVA
Sbjct: 561 LDEVDIDTDRRDIDAIIWEDSAPKTFWDRFWDVVA 595

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/544 (65%), Positives = 427/544 (78%)

Query: 22  DDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIREAEVKRELKQRHXXXXXXXXXXXXXX 81
            DY   R  +  H               + G ++E +VKR LK RH              
Sbjct: 5   KDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGL 64

Query: 82  XXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFG 141
                 PL+NAGPVGALIAY+F+GTL YSVTQSLGEMATFIPVTSSFTVF+QRFLSP+ G
Sbjct: 65  FISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALG 124

Query: 142 AANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEF 201
           +ANGY+YW SWAITFALELSVVGQIIQFWT AVP+ AWI+IFWV+L   N+FPV++YGE 
Sbjct: 125 SANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEV 184

Query: 202 EFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGW 261
           EFW+A IKVLAI+GF+IY   MVCGAG TGPVGFRYWRNPGP GPGII+K++NE +FLGW
Sbjct: 185 EFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGW 244

Query: 262 VSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYN 321
           VSSLI+AAFTYQGTELVGITAGEAANPRK+VPRAI KV FRILFFYI SL FIGLLVP+N
Sbjct: 245 VSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFN 304

Query: 322 DPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSK 381
           DPKL S+DSY+++SPF+I+I+NSGT +LPHIFNAVILSTIISA NSNVYVGSRI + ++ 
Sbjct: 305 DPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAM 364

Query: 382 SKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLF 441
           + LAP+ L+ T K+G+P+ +V+ T + G LAY+E+S+G  A FNWLLNIT VAGFF+W+ 
Sbjct: 365 NGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWIL 424

Query: 442 ISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGID 501
           ISISH+RFMQAL+++GISRDDLPFKAKFMP  AYYA FF+ +IIIIQGFT+F P F   D
Sbjct: 425 ISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFKVSD 484

Query: 502 FLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFW 561
           F  AYIS  LF   WI FQ+WFR  L  K ED+D+DTDRR+I++VVWE+  P   W+KFW
Sbjct: 485 FFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFW 544

Query: 562 NVVA 565
             +A
Sbjct: 545 AAIA 548

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/568 (63%), Positives = 434/568 (76%), Gaps = 8/568 (1%)

Query: 1   MDKKQEEPLKNGKIK---SSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIREA 57
           +D   EE L+ GK K    S+  L+ + L    +                   N +    
Sbjct: 4   LDINTEETLE-GKSKIVIKSTESLEQHDLQGNEDK----NTPTTTPSKENVSENEKDEYH 58

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
           EVKR+L +RH                    PL  +GPVG+LIAYLF+GT+VYSVTQSLGE
Sbjct: 59  EVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118

Query: 118 MATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV 177
           MATFIPVT+SFT+FS RFLSP+ GAANGYMYWFSWA+TFALELSVVGQIIQFWT AVP+ 
Sbjct: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRY 237
           AWISIFWV+L   N+FPVR YGE EFW+A +KV AI+GF+IYC C+VCGAG TGPVGFRY
Sbjct: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRY 238

Query: 238 WRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 297
           WRNPGP G GII+ N+ EA+FLGW SSLINAAFT+QGTELVGITAGEAANPR++VP+AI+
Sbjct: 239 WRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIR 298

Query: 298 KVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVI 357
           KVVFRIL FYI SLFFIGLLVPY+D KL S++SYV++SPFII+I+NSGT ILPHIFN VI
Sbjct: 299 KVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVI 358

Query: 358 LSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETS 417
           L TIISA NSNVY+GSR++FGL+K+   P++ ++T K+GVP  +V+FT LFGALA+METS
Sbjct: 359 LVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETS 418

Query: 418 TGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYA 477
           TGG+ AF WLLN+ GVAGFFSWL IS +H+RFMQ L+ RGISR+DLPFKAKFMP LAYYA
Sbjct: 419 TGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYA 478

Query: 478 IFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDID 537
              M +II  QGFT+F P FD ++F A+YIS FLF   W  FQLWF+CR +WK+ D+DID
Sbjct: 479 TIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDIDID 538

Query: 538 TDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
            DRR+IE+ VW+D  P   W KFW+ VA
Sbjct: 539 KDRREIEDRVWQDTTPANLWGKFWDFVA 566

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/512 (68%), Positives = 423/512 (82%), Gaps = 1/512 (0%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +  EVKR+LKQRH                    PL +AGPVGALI+YLFMGT++YSVTQS
Sbjct: 62  KGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQS 121

Query: 115 LGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           LGEMATFIPVTSSF+VF+QRFLSP+ GA NGYMYW SW  TFALELSV+GQIIQ+WT AV
Sbjct: 122 LGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAV 181

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTG-PV 233
           P+VAWI IFW LL  MNMFPV++YGEFEF +ASIKV+A++GF+ +  C+VCGAG +G P+
Sbjct: 182 PLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPI 241

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           GFRYWRNPG  GPGII+KN NE +FLGWVSSLINAAFTYQGTELVGITAGEAANPR++VP
Sbjct: 242 GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVP 301

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIF 353
           RAIKKVV RIL FYI SLFFIGLLVPYNDPKL S+ ++V++SPF+ISI+NSGT +LP IF
Sbjct: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVSSSPFMISIENSGTKVLPDIF 361

Query: 354 NAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAY 413
           NAV+L TI+SA NSNVY+GSR+++ LSK+ LAPR LS   K GVP+ +V+ T  FG LA+
Sbjct: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAF 421

Query: 414 METSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGL 473
           +ETS G    FNWLLNITGVAGFF+WL IS+SH+RFMQA++ RGISRDDLP++A+ MP L
Sbjct: 422 LETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFL 481

Query: 474 AYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIED 533
           AYYA FF+ LI++IQGFT+F P+F  IDF+AAYIS FLFIAIW++FQ+WF+CR +WK++D
Sbjct: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQD 541

Query: 534 VDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           VDID+DRRDIEE VW +P   T W   W++++
Sbjct: 542 VDIDSDRRDIEEQVWIEPECKTRWQHVWDILS 573

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/509 (67%), Positives = 420/509 (82%), Gaps = 1/509 (0%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
           EVKR+LKQRH                    PL +AGPVGALI+YLFMGT++YSVTQSLGE
Sbjct: 65  EVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124

Query: 118 MATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV 177
           M TFIPVTSSF+VF+QRFLSP+ GA NGYMYW SW  TFALELSV+G++IQ+WT AVP+ 
Sbjct: 125 MVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLA 184

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT-GPVGFR 236
           AWI IFW LL +MNMFPV++YGEFEF +ASIKV+A++GF+I+  C+VCGAG + GP+GFR
Sbjct: 185 AWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFR 244

Query: 237 YWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 296
           YWRNPG  GPGII+ + NE +FLGWVSSLINAAFTYQGTELVGITAGEAANPRK++PRAI
Sbjct: 245 YWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAI 304

Query: 297 KKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAV 356
           KKVV RIL FYI SLFFIGLLVPYNDPKL SD  +V++SPF+ISI+NSGT +LP IFNAV
Sbjct: 305 KKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAV 364

Query: 357 ILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMET 416
           +L TI+SA NSNVY+GSR+++ LSK+ LAPR LS   + GVP+ SV+ T +FG LA++E 
Sbjct: 365 VLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEV 424

Query: 417 STGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYY 476
           S G   AFNWLLNITGVAGFF+WL IS SH+RFMQA+  RGISRDDLP+KA+ MP LAYY
Sbjct: 425 SAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYY 484

Query: 477 AIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDI 536
           A FF+ LI++IQGFT+F P+F  IDF+AAYIS FLF+AIW+ FQ+WF+CRL+WK++D+DI
Sbjct: 485 ASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDI 544

Query: 537 DTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           D+DRR IEE+VW +P   T W + W+V++
Sbjct: 545 DSDRRQIEELVWIEPECKTRWQRVWDVLS 573

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/511 (67%), Positives = 418/511 (81%), Gaps = 1/511 (0%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
             EV+R+LK+RH                    PL +AGPVGALI+YLFMGT++YSVTQSL
Sbjct: 63  RGEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSL 122

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           GEMATFIPVTSSF+VF+QRFLSP+ GA NGYMYW SW  TFALELSV+GQIIQ+WT AVP
Sbjct: 123 GEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVP 182

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGV-TGPVG 234
           + AWI IFW LL  MNMFPV++YGEFEF +ASIKV+ ++GF+I+  C+VCGAG   GP+G
Sbjct: 183 LAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIG 242

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
           FRYWRNPG  GPGII+ N NE +FLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 243 FRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPR 302

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFN 354
           AIKKVV RIL FYI SLFFIGLLVPYNDPKL SD ++V+ASPF+ISI+NSGT +LP IFN
Sbjct: 303 AIKKVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPDIFN 362

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           AV+L TI SA NSNVY+GSR+++ LSK+ LAP+ LS   + GVP+++V+ T LFG LA++
Sbjct: 363 AVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFL 422

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
           ETS G   AFNWLLNITGVAGFF+WL IS SH+RFMQA++ RGISRDDLP+KA+ MP LA
Sbjct: 423 ETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLA 482

Query: 475 YYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDV 534
           YYA FF+ LI++IQGFT+F P+F  +DF+AAYIS FLF  IW+ FQLWF+CRLI K++D+
Sbjct: 483 YYASFFIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDI 542

Query: 535 DIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           DID+DRR+IEE VW +P   T W + W++++
Sbjct: 543 DIDSDRREIEEQVWIEPECKTRWQRVWDILS 573

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/513 (66%), Positives = 419/513 (81%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            ++   VKR LK RH                    PL NAGPVGALIAY+F+GT+++SVT
Sbjct: 87  HVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVT 146

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
           QSLGEM TFIPVTSSFTVFS RFLSP+FGAANGYMYWFSWA+TFA+ELSV+G++IQFWT+
Sbjct: 147 QSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTT 206

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
           AVP+ AWI IFW LL   NMFPV++YGE EFW+A +KVL+++GFLI+CLC+  GAG  GP
Sbjct: 207 AVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGPHGP 266

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
            GFRYWR+PG  GPGIIA++ +EA+FLGWVSSLINAAFTYQGTELVGITAGEAANPRK+V
Sbjct: 267 FGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 326

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHI 352
           P+AIKKV+ RILFFY+GSLFFIG+LVP+NDPKLTS  S+V++SPFII+IQNSG  +LP I
Sbjct: 327 PKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSFVSSSPFIIAIQNSGVSLLPSI 386

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
           FN VIL TIISA NSNVYVGSRI+FGL+ S LAP+  +RT K GVP+V+V+FT LFG+LA
Sbjct: 387 FNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLA 446

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++E +T G+  FNWLL+I  +AGFF+WL IS+SH+RFM+ALEYRGISR+ LPFKA FMP 
Sbjct: 447 FLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFMPW 506

Query: 473 LAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIE 532
           LAYYA  F+ LII+IQGFT+F P F+  DF+A+YIS  LF+ IW VFQ   +CR+ WK+E
Sbjct: 507 LAYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFVIIWGVFQAMKKCRIFWKVE 566

Query: 533 DVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           D+D+D+DR+DIE++ WED  P TFW K W  +A
Sbjct: 567 DIDLDSDRKDIEDIRWEDDSPKTFWTKVWQTLA 599

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/565 (62%), Positives = 433/565 (76%), Gaps = 15/565 (2%)

Query: 1   MDKKQEEPLKNGKIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIREAEVK 60
           M +K E  L++ ++ S + E  D       +S                 ++G  R A V+
Sbjct: 10  MSQKTETRLEDYEMGSFAEEALDQEAQSSQDS--------------QLGSSGHGRNA-VQ 54

Query: 61  RELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMAT 120
           R+LK RH                    PL NAGPVGALI+YLFMG++ Y VTQSLGEMAT
Sbjct: 55  RQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMAT 114

Query: 121 FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWI 180
           FIPVTSSFTVF++RFLS   GAANGYMY FSW++T+ALELS+VGQII++WTSAVP  AWI
Sbjct: 115 FIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWI 174

Query: 181 SIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRN 240
           +IFWV +   N+ PV+FYGEF+FW+A IKV+AI+GFL+YCLCMVCGAG TGPVGFRYWRN
Sbjct: 175 AIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYWRN 234

Query: 241 PGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVV 300
           PGP G GII+ +++E +FLGWVSSL+NAAFTYQGTELVGI+AGE+ANPRK+VP+AI KV 
Sbjct: 235 PGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVF 294

Query: 301 FRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILST 360
           FRIL FY+GSLFFIGLLVP+ND KLTS DSY A SPFII+IQNSGT ILP IFNAVIL+T
Sbjct: 295 FRILLFYVGSLFFIGLLVPFNDEKLTSSDSYSAGSPFIIAIQNSGTKILPDIFNAVILAT 354

Query: 361 IISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGG 420
           IISAANSNVYVGSR+++GL+K +LAPR  +RTN++GVP V+V+F   FG L Y+  S G 
Sbjct: 355 IISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGA 414

Query: 421 EAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFF 480
             AF+WLLNIT +AGFFSWLFIS+ HVRFMQAL+ +GISRDDLPFKAK MP  AYY+ FF
Sbjct: 415 SKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFF 474

Query: 481 MTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDR 540
           +TLIIIIQGFTS  P+F+  +F AAYIS F+F+ IW VFQ W+R R+I +IE VDID+DR
Sbjct: 475 ITLIIIIQGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDR 534

Query: 541 RDIEEVVWEDPPPVTFWDKFWNVVA 565
           R+++   W++  P T W KFW  +A
Sbjct: 535 REVDAQQWDNTEPTTLWGKFWAAMA 559

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/514 (66%), Positives = 417/514 (81%)

Query: 52  GQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSV 111
           G ++E +VKR LK RH                    PL+NAGPVGALIAY+F+GTL Y V
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94

Query: 112 TQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWT 171
           +QSLGEMATFIPVTSSF VF+QRFLSP+ GAANGYMY+ SW+ITFALELSVVGQ+IQFWT
Sbjct: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154

Query: 172 SAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTG 231
            AVP+ AWI I WV+LV+ N+ PV+FYGE EFW+A IKVLAI+GF+IY   MVCGAG TG
Sbjct: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214

Query: 232 PVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
           PVGFRYWRNPGP GPGII+K++NE +FLGWVSSLI+AAFTYQGTELVGITAGEAANPRK+
Sbjct: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPH 351
           VPRAI KV FRILFFYI SL FIGLLVP+NDPKL S+DSY+++SPF+I+I+NSGT +LPH
Sbjct: 275 VPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
           IFNAVILSTIISA NS+VY+ SR+++ +  + LAP+ L+ T K+G+P+ +V+ T L G L
Sbjct: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           AY+E+S G    F+WLLNIT VAGFF+W+ IS++H+RFMQAL+++GISRDDLPFKAKFMP
Sbjct: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKI 531
             AYYA FF+ +IIIIQGFT+F P F+  DF  AY+S  LF A+WI FQ+WFR  L  K 
Sbjct: 455 WGAYYAAFFIGVIIIIQGFTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKT 514

Query: 532 EDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           ED+D+DTDRR+I+  VWE+  P   W+KFW+ VA
Sbjct: 515 EDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/479 (71%), Positives = 407/479 (84%), Gaps = 1/479 (0%)

Query: 88  PLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYM 147
           PL +AGPVGALI+Y+FMGT++YSVTQSLGEMATFIPVTSSF+VF+QRFLSP+ GA NGYM
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 148 YWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVAS 207
           YW SW  TFALELSV+GQIIQ+WT AVP+ AWI IFW LL  MNMFPV++YGEFEF +AS
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 208 IKVLAIMGFLIYCLCMVCGAGV-TGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLI 266
           IKV+A++GF+IY  CMVCGAG   GP+GFRYWRNPG  GPGII+ + NE +FLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 267 NAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT 326
           NAAFTYQGTELVGITAGEAANPRK+VPRAIKKVV RIL FYI SLFFIGLLVPYNDPKL 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 327 SDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAP 386
           SD S+V+ASPF+ISI+NSGT +LP IFNAV+L TI+SA NSNVY+GSR+++ LSK+ LAP
Sbjct: 259 SDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAP 318

Query: 387 RILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISH 446
           R LS   K GVP+ +V+ T +FG LA++ETS G   AFNWLLNITGVAGFF+WL IS SH
Sbjct: 319 RFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSH 378

Query: 447 VRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAY 506
           +RFMQA+  RGISR+DLP+KA+ MP LAYYA FF+ LI++IQGFT+F PSF  +DF+AAY
Sbjct: 379 IRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAY 438

Query: 507 ISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           IS FLF+AIW  FQLWF+C +I K++DVDID+DRR+IEE VW +P   T W   W+V+A
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVLA 497

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/515 (66%), Positives = 414/515 (80%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G++R  EVKR LK RH                    PL NAGPVG LIAYLFM T+ +S
Sbjct: 66  KGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFS 125

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           V QSLGEMAT+IPVTS+F+VFSQRFLSP+FGAANGYMYWFSW+ITFALELSV+GQI+Q+W
Sbjct: 126 VMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYW 185

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T  VP+ AWISIFWVL+  +N  PV+FYGEFEFW+A IKV+AI+GF+IYC  MVCGAG T
Sbjct: 186 TFKVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGKT 245

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GPVGFRYWR+    G GII+KN NEA+FLGWVSSLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 246 GPVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 305

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILP 350
           +VP++IK+ ++RIL FYI SL F+GLLVP+ND  L    SY A+SPFI++I+NSGT  LP
Sbjct: 306 TVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAASSPFILAIKNSGTKALP 365

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
            IFNAVIL+T+ISAANS+VYVGSR+M+ +++++LAP IL++ +K GVP+ +V+FT   GA
Sbjct: 366 DIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGA 425

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           LAY+ETS+ G   FNWL+NITGVAGFFSW  IS SH+RFM+AL+ RGISR+DLPFKA FM
Sbjct: 426 LAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFM 485

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
           P +A Y+ FFMTLII++QGFT F P F   DF+A+YIS  LF  IW VFQ+WFRC L+  
Sbjct: 486 PWIAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRCPLLVP 545

Query: 531 IEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           I ++DIDTDRRD++  VWED PP T WDKFWN+VA
Sbjct: 546 IAEIDIDTDRRDVDAEVWEDEPPKTLWDKFWNIVA 580

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/517 (69%), Positives = 420/517 (81%), Gaps = 2/517 (0%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G I +AEVKR LK RH                    PL NAGPVG+LIA++ +GTL YS
Sbjct: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           VTQSLGEMATFIPVTSSFTVFSQRF+SP+ GAANGYMYWFSWAITFALELS+VGQIIQ+W
Sbjct: 125 VTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T AVP+ AWI+IFWVLLV+ NMFPV++YGEFEFWVASIKV+AI+GFLIY LCMVCGAG  
Sbjct: 185 TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE 244

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GP+GFRYWR PGP G GIIAKN+N+A+FLGWVSSLI+AAFTYQGTELVGITAGE  NPRK
Sbjct: 245 GPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRK 304

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDD--SYVAASPFIISIQNSGTPI 348
           +VPRAI KV FRIL FYIGSLFFIGLLVPYNDPKL   D  SY+A SPF+I+I N  TP+
Sbjct: 305 AVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPV 364

Query: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLF 408
           LPHIFNAVIL+TIISA NSNVYVGSRI+FGLSK+ LAP+  S+T K+GVP+++V+ T +F
Sbjct: 365 LPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVF 424

Query: 409 GALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAK 468
           G LAY+  S   +  F+WLLNIT +AGF +WL ISISH+RFMQ L++RGISRDDLP+KAK
Sbjct: 425 GFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484

Query: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLI 528
           FMP  AYYA FF+T+IIIIQGFT+F P F+  DF AAYIS FLF  +W +FQ  +R +L 
Sbjct: 485 FMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLF 544

Query: 529 WKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
             +++VDID+DRRDI+ ++WE+  P   W+KFW V A
Sbjct: 545 RTLDEVDIDSDRRDIDVIIWEEEEPKNLWEKFWAVAA 581

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/515 (68%), Positives = 423/515 (82%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G +++AEVKR LK RH                    PL +AGPVGALIAY+FMGT+ Y 
Sbjct: 74  EGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYF 133

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           VTQSLGEMATFIPVTSSFTVF+QRFLSP+FG ANGY+YWFSW ITFALELSVVGQIIQFW
Sbjct: 134 VTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFW 193

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T AVP+ AWI+IFWV+L   N+FPV++YGE EFW+A IKVLAI+GF+IY   MVCGAG T
Sbjct: 194 TFAVPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT 253

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GPVGFRYWRNPGP GPGII+K++NE +FLGWVSSLINAAFTYQGTELVGITAGE+ NPR+
Sbjct: 254 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRR 313

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILP 350
           +VPRAI KV FRILFFYI SL FIGLLVP+NDPKL S+DSY+++SPF+I+I+NSGT +LP
Sbjct: 314 TVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLP 373

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           HIFNAVILSTIISA NSN+YVGSR+++GL+K+KLAP++ +R  K+GVP++SV+ T  FG 
Sbjct: 374 HIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGF 433

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           LAY+  S   +  F+WLLNIT +AGFF+WLFIS++H+RFMQ L+ R +SR+DLPFKAKFM
Sbjct: 434 LAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFM 493

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
           P  AYY+ FF++LIIIIQGFT+F P F+  +F AAYIS FLF+AIW+VFQ+ FR R I  
Sbjct: 494 PWGAYYSAFFISLIIIIQGFTAFAPKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRFILT 553

Query: 531 IEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
             DVDIDTDRRDI+ +VWE+  P   WDKFW  +A
Sbjct: 554 KNDVDIDTDRRDIDCIVWEEETPKNAWDKFWAAMA 588

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/511 (66%), Positives = 411/511 (80%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +E  ++R LK RH                    PL +AGPVG+LI+YLFMG+L + VTQS
Sbjct: 45  QERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQS 104

Query: 115 LGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           LGEMATFIPV SSFTVF++RFLSP+ GAANGYMY FSW ITFALELS+VG+IIQ+WT  V
Sbjct: 105 LGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGV 164

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
           P  AWI IFWV +   N+  V+FYGEF+FW+A IKV+AI+GFLIYCLCMVCGAG TGPVG
Sbjct: 165 PNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGPVG 224

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
           FRYWRNPGP G GII+K+ +E +FLGWVSSL+NAAFTYQGTELVG++AGE+ANPRK+VP+
Sbjct: 225 FRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPK 284

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFN 354
           AI+KV  RIL FY+GSLFFIGLLVP+NDPKL S  +Y A+SPFII+IQNSGT  LP IFN
Sbjct: 285 AIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYSASSPFIIAIQNSGTRALPDIFN 344

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           AVIL+TIISAANSNVYVGSR+++GL+K  LAP+I+ R N++GVP++ V    LFG L Y+
Sbjct: 345 AVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYL 404

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             S+G   AF+WLLNIT +AGFF+WLFIS+ H+RFMQAL+Y+GISRDDLPFKAK MP  A
Sbjct: 405 SVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGA 464

Query: 475 YYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDV 534
           YYA FF+ LIIIIQGFT+F P F+  +F AAY+S FLFIA+W++FQ+ F+ RLI K+EDV
Sbjct: 465 YYAAFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDV 524

Query: 535 DIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           DID+DRR+IE  VWED  P   W KFW  +A
Sbjct: 525 DIDSDRREIEAEVWEDDEPTNLWGKFWAAMA 555

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/564 (60%), Positives = 414/564 (73%), Gaps = 5/564 (0%)

Query: 2   DKKQEEPLKNGKIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIREAEVKR 61
           D   + P+   K K S        LH  +N +H                  Q ++  VKR
Sbjct: 52  DSSDKPPITLRKSKLSEIG----SLHSGSN-LHQHGTTSLHDDEESDTEEAQYQDTRVKR 106

Query: 62  ELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATF 121
            LKQRH                    PL+NAGPVG+LIAY+FMG++VY VTQSLGEMATF
Sbjct: 107 ALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYFVTQSLGEMATF 166

Query: 122 IPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWIS 181
           IPVTSS TVFS+RFLSP+FG ANGYMYWF+WAIT+A+E+SV+GQ+IQ+WT AVP+ AWI 
Sbjct: 167 IPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIG 226

Query: 182 IFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRNP 241
           IFWV++  MN FPV+ YGEFEFW+ASIKVLAIMG+LIY L +VCG    GP+GFRYWRNP
Sbjct: 227 IFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNP 286

Query: 242 GPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVF 301
           GP GPGII+    EA+FLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI KVVF
Sbjct: 287 GPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVF 346

Query: 302 RILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTI 361
           RI  FYI SLFFIGLLVP+ND +L +D + +A+SPF+ISIQN+GT  LP IFNAV+L TI
Sbjct: 347 RIALFYIMSLFFIGLLVPFNDDRLANDSAVIASSPFVISIQNAGTRALPDIFNAVVLLTI 406

Query: 362 ISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGE 421
           ISAANSNVYVGSR+++ L+ +  AP+I S   K GVP++ VI T   G LA++  +    
Sbjct: 407 ISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAALGLLAFLVVNNNAN 466

Query: 422 AAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFM 481
            AFNWL+NI+ +AG  +WLFIS+SH+RFMQAL+YRGISRDDLPFKAK MP  AYYA FF+
Sbjct: 467 TAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFV 526

Query: 482 TLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRR 541
           T+II IQGF +F P FD   F  +YIS  L   ++   QL++RCR IWK+ED+DID+DRR
Sbjct: 527 TVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIWKVEDIDIDSDRR 586

Query: 542 DIEEVVWEDPPPVTFWDKFWNVVA 565
           +IE ++WE+  P   W+KFW  VA
Sbjct: 587 EIEAIIWEEDEPKNLWEKFWAWVA 610

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/515 (64%), Positives = 405/515 (78%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
             + ++ +VKR LK RH                    PL  +GPVG+LIAY+FMGT+VY 
Sbjct: 94  EAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYF 153

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           VTQ+LGEMATFIPVTSS TVFS RFLSP+FG +NGY+YWF+WAIT+A+E+SVVGQ+I+FW
Sbjct: 154 VTQALGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFW 213

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T+ VP+ AWISIFWVL+ A+N FPV  YGE EFWVAS+KVLAI+G+LIY L +VCG    
Sbjct: 214 TTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGSKQ 273

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GP+GFRYWR+   MG G+I+K+ NEA+FLGWV+SLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 274 GPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRK 333

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILP 350
           SVPRAI KVVFRI+ FYI SLFFIGLLVPYNDPKL S  SY+A+SPF+ISI+N+GT  LP
Sbjct: 334 SVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSATSYIASSPFVISIENAGTRALP 393

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           HIFNA+I+ TIISAANSNVYV SR+++ L+ S  AP+I +R    GVP++ VI T L G 
Sbjct: 394 HIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGL 453

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           LA++  +     AFNWL+NI+ +AG  +WLFIS+SH+RFM+AL+YRGISRDDLPFKA+FM
Sbjct: 454 LAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFM 513

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
           P  +YYA FF+T+II IQGFT+F P FD   F  AYIS  L   ++I  QL++RCR  WK
Sbjct: 514 PYGSYYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWK 573

Query: 531 IEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           +ED+DIDTDRR+I+E+VWED  P T WDKFW  VA
Sbjct: 574 VEDIDIDTDRREIDEIVWEDDEPKTAWDKFWAAVA 608

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/512 (64%), Positives = 408/512 (79%)

Query: 54  IREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQ 113
           + +  VKR LKQRH                    PL+N+GPVGALIAY+FMGT++Y VTQ
Sbjct: 86  VHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQ 145

Query: 114 SLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
           SLGEMATFIPVTSS TVFS+RFLSP+FG ANGYMYWF+WAIT+A+E+SV+GQ+IQ+WT  
Sbjct: 146 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPV 233
           VP+ AWI IFWVL+  MN FPV+ YGEFEFWVASIKV+AI+G+LIY L +VCG    GP+
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPI 265

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           GFRYWRNPG MG GII+ +L EA+FLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIF 353
           RAI KVVFRI+ FYI SLFF+GLLVPYNDP+L++  + +A+SPF+ISIQN+GT +LP IF
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIF 385

Query: 354 NAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAY 413
           NAV+L T+ISAANSNVYVGSR+++ L++S  AP+  +   ++GVP++ VI T L G LA+
Sbjct: 386 NAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAF 445

Query: 414 METSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGL 473
           +  +     AFNWL+NI+ +AG  +WLFIS++H+RFMQAL++RGISRDDLPFKAKFMP  
Sbjct: 446 LVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWG 505

Query: 474 AYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIED 533
           AYYA FF+T+II IQGF +F P FD  +F  AYIS  L + ++   QL++RCR +WK+ED
Sbjct: 506 AYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLED 565

Query: 534 VDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           +DID+DRR+I+ +VWED  P   W+KFW  VA
Sbjct: 566 IDIDSDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/514 (63%), Positives = 403/514 (78%), Gaps = 1/514 (0%)

Query: 52  GQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSV 111
           G +++  VKR LKQRH                    PL NAGPVGALIAY+FMG+++Y +
Sbjct: 87  GHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFI 146

Query: 112 TQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWT 171
           TQSLGEMATFIPVTSS TVFS+RFLSP+FG  NGYMYWF+WAIT+A+E+SVVGQ+IQ+WT
Sbjct: 147 TQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWT 206

Query: 172 SAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTG 231
            AVP+ AWI+IFWV +  +N FPV+ YGE EFWVASIKVLAI+G+LIY L +VCG    G
Sbjct: 207 DAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGSSQG 266

Query: 232 PVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
           P+GFRYWRNPGP GPGII+K++NE +FLGWVSSLINAAFTYQGTELVGITAGEAANPRKS
Sbjct: 267 PIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 326

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPH 351
           VPRAI KVVFRI  FYI SLFFIGLLVPYND  L+S DSY+A+SPF+ISIQN+GT  LP 
Sbjct: 327 VPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPFVISIQNAGTYALPD 386

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
           IFNAV++ TIISAANSNVYVGSR+++ L+++  AP+  +   K+GVPW+ VI T   G L
Sbjct: 387 IFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLL 446

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           A++  +     AFNWL+NI+ +AG  +W FI++SH+RFMQAL+YRGISRDDLPFKAK MP
Sbjct: 447 AFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMP 506

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKI 531
             AYY+ FF+ +II IQGF +F P +D   F  +YIS  L + ++I  QL++RCR + K+
Sbjct: 507 WGAYYSAFFVFVIIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKV 565

Query: 532 EDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           ED+DIDTDRR+IE ++WED  P   W+KFW  VA
Sbjct: 566 EDIDIDTDRREIEAIIWEDDEPKNLWEKFWAWVA 599

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/513 (64%), Positives = 407/513 (79%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
           Q  + EVKR LKQRH                    PLTN+GPVG+LIAYLFMG+++YS+T
Sbjct: 95  QYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSIT 154

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
           QSLGEMATFIPVTSS TVFS+RFLSP+FG ANGYMYWF+WAIT+A+E+SVVGQ+I++WT 
Sbjct: 155 QSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTK 214

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
            VP+ AWI+IFWV +  MN FPV+ YGE EFW+A +KVLAI G+L+Y L +VCG    GP
Sbjct: 215 KVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGP 274

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +GFRYWRNPGP G GII+K+ N ++FLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV
Sbjct: 275 IGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 334

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHI 352
           PRAI KVVFRI  FYI SLFFIGLLVPY+DP+L+SD + VA+SPF+ISIQN+GT ILP I
Sbjct: 335 PRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSPFVISIQNAGTKILPDI 394

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
           FNA+++ T+ISAANSNVYVGSR+++ L+++  AP+  +   ++GVP++ V+ T   G LA
Sbjct: 395 FNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLA 454

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  +     AFNWL+NI+ +AG  +WLFISISH+RFMQAL++RGISRDDLPFKAKFMP 
Sbjct: 455 FLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPW 514

Query: 473 LAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIE 532
            AYYA FF+T+II IQGF +F P FD   F  AYIS  +   ++I  Q+++RCR  WK+E
Sbjct: 515 AAYYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLE 574

Query: 533 DVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           D+DIDTDRR+IEEV+WED  P T+WDKFW  VA
Sbjct: 575 DIDIDTDRREIEEVIWEDDEPKTYWDKFWAAVA 607

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/511 (63%), Positives = 400/511 (78%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
            + +VKR LKQRH                    PLTN+GPVG+LIAYLFMG+++Y +TQS
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 115 LGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           LGEMATFIPVTSS TVFS+RFLSP+FG ANGYMYWF+WAITFA+E+SVVGQ+I++WT  V
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKV 208

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
           P+ AWI+IFWVL+  +N FPV+ YGE EFW+A IKVLAIMG+L+Y L +VCG    GP+G
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQGPIG 268

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
           FRYWRNPGP GPGII+K++N  +FLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 269 FRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 328

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFN 354
           AI KVVFRI  FYI SLFFIG+LVPYND +L S  + +A+SPF+ISIQN+GT +LP IFN
Sbjct: 329 AINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVISIQNAGTKVLPDIFN 388

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           A+++ TIISAANSNVYVGSR+++ L+ S  AP+  +   + GVP++ VI T   G LA++
Sbjct: 389 AIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLAFL 448

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             +     AFNWL+NI+ +AG  +WLFISISH+RFMQAL++RGISRDDLPFKAK MP  A
Sbjct: 449 VVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPFGA 508

Query: 475 YYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDV 534
           YYA FF+T+II IQGF +F P +D   F  +YIS  +   ++I  Q+++RCR  W++ED+
Sbjct: 509 YYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRVEDI 568

Query: 535 DIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           DID+DRR+IE V+WED  P T WDKFW  VA
Sbjct: 569 DIDSDRREIEAVIWEDDEPKTLWDKFWAAVA 599

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/567 (59%), Positives = 424/567 (74%), Gaps = 3/567 (0%)

Query: 2   DKKQEEPLKN--GKIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXAN-GQIREAE 58
            +K + P  +  GK +   Y  + +PL   T  V                A      +  
Sbjct: 7   HEKDDSPTISPVGKTEQDKYGYELHPLDPVTQQVTLRTVTNVCDGLEEEDAEEAGYHDTR 66

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           VKR LKQRH                    PL+NAGPVG+LIAYLFMG++VY +TQSLGEM
Sbjct: 67  VKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQSLGEM 126

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVA 178
           ATFIPVTSS TVFS+RFLSP+FG ANGYMYWF+WAIT+A+E+SV+GQ+IQFWTSAVP+ A
Sbjct: 127 ATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWTSAVPLAA 186

Query: 179 WISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYW 238
           WI+IFWV +  +N FPV+ YGE EFWVASIKV+AI+G+LIY L +VCG    GP+GFRYW
Sbjct: 187 WIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGSSQGPIGFRYW 246

Query: 239 RNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKK 298
           RNPGP GPGII+ + NE +FLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI K
Sbjct: 247 RNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINK 306

Query: 299 VVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVIL 358
           VVFRI+ FYI SLFF+G+LVP+NDP+L S+ + +A+SPF+ISIQN+GT +LPHIFNAV++
Sbjct: 307 VVFRIVIFYIMSLFFVGMLVPFNDPRLASNVAVIASSPFVISIQNAGTRVLPHIFNAVVM 366

Query: 359 STIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETST 418
            TIISAANSNVYVGSR+++ LS++  AP+      ++GVP++ VI T L G LA++  + 
Sbjct: 367 LTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLLGLLAFLVVNN 426

Query: 419 GGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAI 478
               AFNWL+NI+ +AG  +WLFIS+SH+RFMQAL++RGISRDDLPFKAK MP  AYYA 
Sbjct: 427 NANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAA 486

Query: 479 FFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDT 538
           FF+T+II IQGF +F P FD   F  AYIS  + + + I  QL++RCR +WK+ED+DIDT
Sbjct: 487 FFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRFLWKLEDIDIDT 546

Query: 539 DRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           DRR+IE ++WE+  P   W+KFW+++A
Sbjct: 547 DRREIECIIWEEEEPQNLWEKFWSIMA 573

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/508 (63%), Positives = 400/508 (78%), Gaps = 1/508 (0%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
            VKR LKQRH                    PL+NAGPVG+LIAY+FMGT++Y +TQSLGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 118 MATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV 177
           MATFIPVTSS TVFS+RFLSP+FG +NGYMYWF+WAIT+A+E+SV+GQ+IQ+WT  VP+ 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 224

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRY 237
           AWI+IFWVL+  MN FPV+ YGEFEFWVAS+KVLAI+G+LIY L +VCG    GP+GFRY
Sbjct: 225 AWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRY 284

Query: 238 WRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 297
           WRNPG  GPGII+KN +E +FLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPRAI 
Sbjct: 285 WRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 344

Query: 298 KVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVI 357
           KVVFRI+ FYI SLFFIGLLVPYN+P+L+   + +A+SPF+ISIQN+GT  LP IFNAV+
Sbjct: 345 KVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNAVV 404

Query: 358 LSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETS 417
           L T+ISAANSNVYVGSR+++ L++S  AP+      K GVP++ V+ T   G LA++  +
Sbjct: 405 LITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVVN 464

Query: 418 TGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYA 477
                AFNWL++I+ +AG  +WLFIS++H+RFMQAL+ RGISRDDLPFKAK MP  AYYA
Sbjct: 465 NNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYYA 524

Query: 478 IFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDID 537
            FF+T+II IQGF +FCP F   +F  +YIS  L   ++I  QL+++CR IWK+ED+DID
Sbjct: 525 SFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDID 583

Query: 538 TDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           +DRR+IE ++WED  P   W+KFW  VA
Sbjct: 584 SDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/511 (63%), Positives = 398/511 (77%), Gaps = 1/511 (0%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
            +  VKR LKQRH                    PL+ AGPVG+LI+Y+FMGT+VY +TQS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 115 LGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           LGEMATFIPVTSS TVFS+RFLSP+FG ANGYMYWF+WAIT+A+E+SV+GQ+IQ+WT  V
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
           P+  WI+IFWVL+  MN FPV+ YGEFEFWVAS+KVLAIMG+LIY L +VCG    GP+G
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIG 282

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
           FRYWRNPG  GPGII+ + NE +FLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 283 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 342

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFN 354
           AI KVVFRI+ FYI SLFFIGLLVPYN+P+L++  + +A+SPF+ISIQN+GT  LP IFN
Sbjct: 343 AINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASSPFVISIQNAGTYALPDIFN 402

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           AV+L T+ISAANSNVYVGSR+++ L+++  AP+      K GVP++ V+ T   G LA++
Sbjct: 403 AVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 462

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             +     AFNWL+NI+ +AG  +WLFIS++H+RFMQALE RGISRDDLPFKAK MP  A
Sbjct: 463 VVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGA 522

Query: 475 YYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDV 534
           YYA FF+T+II IQGF +FCP F   DF  +YIS  L   ++   QL+++CR IWK+ED+
Sbjct: 523 YYAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 581

Query: 535 DIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           DIDTDRR+IE ++WED  P   W+KFW  VA
Sbjct: 582 DIDTDRREIEAIIWEDDEPKNLWEKFWAAVA 612

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/567 (59%), Positives = 417/567 (73%), Gaps = 8/567 (1%)

Query: 1   MDKKQEEPLKNGKIKSSSYELDDY--PLHRRTNSVHXXXXXXXXXXXXXXXANGQIREAE 58
           +D+KQ+  LK    K S   LD     ++  TNS+                      +  
Sbjct: 51  IDEKQDN-LK----KKSGLMLDGTIGDINSITNSLTRSQIASHEQGGDDEEEEAHYEDKH 105

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           V+R LKQRH                    PL+NAGPVG+LIAY+FMGT+VY VTQSLGEM
Sbjct: 106 VRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQSLGEM 165

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVA 178
           ATFIPVTSS TVFS+RFLSP+FG +NGYMYWF+WAIT+A+E+SV+GQ+I++WT+ VP+  
Sbjct: 166 ATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKVPLGV 225

Query: 179 WISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYW 238
           WI+IFWVL+  MN FPV+ YGEFEFWVAS+KVLAIMG+LIY L +VCG    GP+GFRYW
Sbjct: 226 WIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSKQGPIGFRYW 285

Query: 239 RNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKK 298
           RNPG  GPGII+ + NE +FLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPRAI K
Sbjct: 286 RNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINK 345

Query: 299 VVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVIL 358
           VVFRI+ FYI SLFFIGLLVPY DP+L++  + +A+SPF+ISIQN+GT  LP IFNA++L
Sbjct: 346 VVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASSPFVISIQNAGTYALPDIFNAIVL 405

Query: 359 STIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETST 418
            T+ISAANSNVYVGSR+++ L+++  AP+      K GVP++ V+ T   G LA++  + 
Sbjct: 406 ITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFLVVNN 465

Query: 419 GGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAI 478
               AFNWL+NI+ +AG  +WLFIS+SH+RFMQAL  RGISRDDLPFKAKFMP  AYYA 
Sbjct: 466 NANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGAYYAS 525

Query: 479 FFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDT 538
           FF+T+II IQGF SFCP F   DF  +YIS  L   ++   QL+++CR IWK+ED+DID+
Sbjct: 526 FFVTVIIFIQGFQSFCP-FRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDIDIDS 584

Query: 539 DRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           DRR+IE ++WED  P   W+KFW  VA
Sbjct: 585 DRREIEAIIWEDDEPKNLWEKFWAAVA 611

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/563 (57%), Positives = 414/563 (73%), Gaps = 10/563 (1%)

Query: 3   KKQEEPLKNGKIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIREAEVKRE 62
           KK+   L+ G I           ++  TNS+                      +  VKR 
Sbjct: 59  KKKHGSLQGGAIAD---------VNSITNSLTRLQVVSHETDINEDEEEAHYEDKHVKRA 109

Query: 63  LKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFI 122
           LKQRH                    PL+NAGPVG+LIAY+FMGT+VY VTQSLGEMATFI
Sbjct: 110 LKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFI 169

Query: 123 PVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISI 182
           PVTSS TVFS+RFLSP+FG +NGYMYWF+WAIT+A+E+SV+GQ+I++WT  VP+ AWI+I
Sbjct: 170 PVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAI 229

Query: 183 FWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPG 242
           FWV++  MN FPV+ YGEFEFWVAS+KVLAIMG+LIY L +VCG    GP+GFRYWRNPG
Sbjct: 230 FWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPG 289

Query: 243 PMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFR 302
             GPGII+ + +E +FLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPRAI KVVFR
Sbjct: 290 AWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFR 349

Query: 303 ILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTII 362
           I+ FYI SLFFIGLLVPYND +L++  + +A+SPF+ISIQN+GT  LP IFNAV+L T++
Sbjct: 350 IVLFYIMSLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLITVV 409

Query: 363 SAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEA 422
           SAANSNVYVGSR+++ L+++  AP+      + GVP++ V+ T   G LA++  +     
Sbjct: 410 SAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANT 469

Query: 423 AFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMT 482
           AFNWL+NI+ +AG  +WLFIS++H+RFMQAL++RGISRDDLPFKAK MP  AYYA FF+T
Sbjct: 470 AFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVT 529

Query: 483 LIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRD 542
           +II IQGF +FCP F   +F  +YIS  L   ++I  Q++++CR IWK+ED+DID+DRR+
Sbjct: 530 VIIFIQGFQAFCP-FKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKLEDIDIDSDRRE 588

Query: 543 IEEVVWEDPPPVTFWDKFWNVVA 565
           IE ++WED  P   W+KFW  VA
Sbjct: 589 IEAIIWEDDEPKNLWEKFWAAVA 611

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/516 (61%), Positives = 399/516 (77%), Gaps = 1/516 (0%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G   E EVKR LK RH                    PL  AGPVG+LIAY+FMGT+VYS
Sbjct: 52  EGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYS 111

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           +TQSLGEMATFIPVTSS TVFS+RFLSP+FG ANGYMYWF+WAITFA+ELSVVGQII +W
Sbjct: 112 ITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYW 171

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           TS VP+ AWI+IFW+++  +N FPVRFYGE EFW+AS+KV+ I+G+LIY   +VCG    
Sbjct: 172 TSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGSSQ 231

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GP+GFR WRNPGP G G+I+ N  EA+FLGWVSSLI AAFTYQGTELVGITAGE+ NPRK
Sbjct: 232 GPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRK 291

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL-TSDDSYVAASPFIISIQNSGTPIL 349
           +VP+AI KV FRILFFYI SLFF+GLLVPYNDP++  + D+ V ASPF+ISI+N+GT IL
Sbjct: 292 TVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNAGTKIL 351

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P IFNAV+L T++SAANSNVY+GSR+++ L++S  AP+     N++GVP + V+ T L G
Sbjct: 352 PDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALMG 411

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            +A++  +   +AAFNWL+NI+ +AG  +WLFIS++H+RFMQ L+ RGISRD LPFKAKF
Sbjct: 412 LMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKF 471

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIW 529
           MP  AYYA  F+ +II IQG+T+F P FD   F  AYIS  L + ++I  Q++++CR +W
Sbjct: 472 MPWAAYYAASFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFLW 531

Query: 530 KIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           K+ED+DIDT+RR+I+ +VWED  P   WDKFW+ +A
Sbjct: 532 KLEDIDIDTNRREIDAIVWEDDEPKNLWDKFWSTIA 567

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/511 (61%), Positives = 399/511 (78%), Gaps = 1/511 (0%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
             ++ E +VKR LKQRH                    PL+ AGPVG+LIAY+FMGT++Y 
Sbjct: 84  EAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYF 143

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           VTQSLGEMATFIPVTSS TVFS+RFLSP+FG ANGYMYWF+WAIT+A+E+SV+GQ+IQ+W
Sbjct: 144 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYW 203

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T AVP+ AWI+IFWVL+  MN FPV+ YGE EFW+A +KVLAI+G+LIY L +VCG    
Sbjct: 204 TKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGSHQ 263

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           GP+GFRYWR+PG  GPGII+KN N  KFLGWV+SLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 264 GPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRK 323

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILP 350
           +VPRAI KVVFRI+ FYI SLFFIG+L+PYND +L++ D+ +A+SPF+ISI+N+ T +LP
Sbjct: 324 TVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRLSAQDAVIASSPFVISIKNAHTKVLP 383

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
            IFNAV++ T++SAANSNVYVGSR+++ L+ +  AP+  S   + GVP++ V+ T   G 
Sbjct: 384 DIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASLGL 443

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           LA++  +     AFNWL+NI+ +AG  +WLFIS++H+RFMQAL++RGISRDDLPFKAK M
Sbjct: 444 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLM 503

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
           P  AYYA FF+T+II IQG+ +FCP +D   F  +YIS  L   + +  QL++R R + K
Sbjct: 504 PWGAYYAAFFVTVIIFIQGYQAFCP-WDVSTFFTSYISLILLAVLVVGCQLYYRGRFLLK 562

Query: 531 IEDVDIDTDRRDIEEVVWEDPPPVTFWDKFW 561
           +ED+DIDTDRR+IE +VWED  P T WDKFW
Sbjct: 563 LEDIDIDTDRREIESIVWEDDEPKTLWDKFW 593

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/567 (57%), Positives = 408/567 (71%), Gaps = 12/567 (2%)

Query: 2   DKKQE--EPLKNGKIKSSSYELDDYPLHRRTN-SVHXXXXXXXXXXXXXXXANGQIREAE 58
           DK  E   PL  GK +S  +++  Y    +   S H                 G ++E +
Sbjct: 3   DKSSELSSPLTQGKTRSDEFQMYVYSNETQNGGSGHNSSFEDD---------EGDLQEGQ 53

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           VKR LK RH                    PL++AGPVGALIAY+FMG++VY VTQS+GEM
Sbjct: 54  VKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEM 113

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVA 178
           ATFIPVTSS TVFS RFLSP+FG ANGYMYWF+WAIT+A+E+SV+GQ+IQ+WT AVP+ A
Sbjct: 114 ATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAA 173

Query: 179 WISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYW 238
           WI IFWV +   N FPVRFYGE EFWVASIKV+AI+G+L+Y L +VCG    GP+GFRYW
Sbjct: 174 WIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGSKQGPIGFRYW 233

Query: 239 RNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKK 298
           RNPGP G GII+ + ++ +FLGWV+SLINA+FTYQGTELVGITAGEAANPRK+VP+AI K
Sbjct: 234 RNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKTVPKAINK 293

Query: 299 VVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVIL 358
           V FRILFFYI SLFF+GLLVPYN P L    S +A+SPF+ISIQ++GT ILP IFNAV+L
Sbjct: 294 VFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIASSPFVISIQSAGTRILPDIFNAVVL 353

Query: 359 STIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETST 418
            TIISAANSNVYVGSRI+F L+ + +AP+  S     GVP++ VI T L G LA++    
Sbjct: 354 VTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLLAFLVVDD 413

Query: 419 GGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAI 478
                FNWL+NI+ +AG  +WLFISISH+RFMQ L+ RGISRDDLPFK+K MP  AYYA 
Sbjct: 414 NANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAA 473

Query: 479 FFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDT 538
           F++ +II +QGF +FCP F   +F   YIS  L   ++ + QL++RCR   ++ED+DID+
Sbjct: 474 FWVAVIIFVQGFQAFCPKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFFNRLEDIDIDS 533

Query: 539 DRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           DRR+I+ ++WE+  P T W KFW  VA
Sbjct: 534 DRREIDALIWEEEEPTTLWGKFWVAVA 560

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/509 (62%), Positives = 395/509 (77%), Gaps = 2/509 (0%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           + +VKR+LK RH                    P+  AGPVG+L+AYLFMGT+ + VTQSL
Sbjct: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           GEMATFIPVTSSFT+++QRFLSP+ GAANGY+YWFSW +TFALELS++GQ+IQ+WT AVP
Sbjct: 119 GEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVP 178

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGF 235
           +  WI +FW+LL A NM PVRFYGE EFW+A++KVL+I GFLIY L MVCG    G +GF
Sbjct: 179 LSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGF 238

Query: 236 RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 295
           RYW+NPGP G G+I+ N  EA+FLGWVSSLI AAFTYQGTELVGITAGE+ NPRK+VP+A
Sbjct: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298

Query: 296 IKKVVFRILFFYIGSLFFIGLLVPYNDPKL-TSDDSYVAASPFIISIQNSGTPILPHIFN 354
           I KV FRILFFYI SLFF+GLLVPY DP+L T+ DS +  SPF+++IQNSGT +LP +FN
Sbjct: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFN 358

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
            VIL TI+SA NSN+Y+GSR+++GLSKS LAP +  +TNK GVP+ +V+ + +FG LAY+
Sbjct: 359 GVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYL 418

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             S   +  F+WLL IT VAGFF+WL IS+SH+RFMQ L+ RGISR+DLPFKAKFMP  A
Sbjct: 419 NISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGA 478

Query: 475 YYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDV 534
           YYA FF+T+II+IQGF SF P F   +F+A YIS FLFI  W+ FQ+ F+ RLI + EDV
Sbjct: 479 YYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDV 538

Query: 535 DIDTDRRDIEEVVW-EDPPPVTFWDKFWN 562
           DIDTDRR+I+ +VW +D  P T   K W 
Sbjct: 539 DIDTDRREIDALVWSDDDEPKTLLQKLWQ 567

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/516 (61%), Positives = 393/516 (76%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
             G ++E +VKR LK RH                    PL+ +GPVGALIAY+FMGT+VY
Sbjct: 106 GEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVY 165

Query: 110 SVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
            VTQS+GEMATFIPVTSS TVFS RFLSP+FG ANGYMYWF+WAITFA+ELSV GQ+I++
Sbjct: 166 FVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEY 225

Query: 170 WTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGV 229
           WT AVP  AWI+IFWVL+   N FPV+FYGE EFWVASIKVLAI+G+LIY L +VCG   
Sbjct: 226 WTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGSK 285

Query: 230 TGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
            GP+GFRYWRNPGP G GII+K+ +E +FLGWV+SLINA+FTYQGTELVGITAGEAANPR
Sbjct: 286 QGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAANPR 345

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           ++VPRAI KV FRILFFYI SLFF+GLLVPYN   L    + +A+SPF+ISIQN+GT  L
Sbjct: 346 RTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIASSPFVISIQNAGTRAL 405

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P IFNAV+L TIISAANSNVYVGSR++F L+ + +AP++ S     GVP++ VI T L G
Sbjct: 406 PDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLG 465

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  +     AFNWL+NI+ +AG  +WLFISISH+RFMQ L+ RGISRDDLPFK+K 
Sbjct: 466 LLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKL 525

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIW 529
           MP  AYYA F++T+II +QGF +F P F   +F  +YIS  L + ++   QL++RCR   
Sbjct: 526 MPYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLVVVFCGAQLFYRCRFFN 585

Query: 530 KIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           ++ED+DID+DRR+ + ++WED  P T W KFW  VA
Sbjct: 586 RLEDIDIDSDRREADALIWEDDEPTTLWGKFWTAVA 621

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/518 (61%), Positives = 400/518 (77%), Gaps = 7/518 (1%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
            + +VKRELKQRH                    PL +AGPVGALIAY+FMG++VY VTQ+
Sbjct: 80  EDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQA 139

Query: 115 LGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           LGEMATFIPVTSS TVFSQRFLSP+FG ANGYMYWF+WAITFA+E+SVVGQ+IQ+WT AV
Sbjct: 140 LGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDAV 199

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPV 233
           P+ AWI+IFWVL+  MN FPV+ YGE EFWVA +KV+AI+G+L+Y L +VCG +   GP+
Sbjct: 200 PLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPI 259

Query: 234 GFRYWRNPGPMGPGI------IAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
           GFRYWRNPG  G G+      I  +  E +FLGWV+SLINAAFTYQGTELVGITAGEAAN
Sbjct: 260 GFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAAN 319

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTP 347
           PRK+VPRAI KVVFRI+ FYI SLFFIGLLVP+ D +L+ D + +A+SPF+ISI+N+GT 
Sbjct: 320 PRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRLSDDTTVIASSPFVISIENAGTK 379

Query: 348 ILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGL 407
           ILP IFNA+++ T++SAANSNVYVGSR+++ L+ +K+AP+I +R  + GVP++ VI T L
Sbjct: 380 ILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSL 439

Query: 408 FGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKA 467
            G LA++        AFNWL++I+ +AG  +WLFIS++HVRFMQ L+ RGISRDDLPFKA
Sbjct: 440 LGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKA 499

Query: 468 KFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRL 527
           KFMP  +YYA F++ +II +QGF +F P FD   F   YIS  L   ++I  QL++RCR 
Sbjct: 500 KFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTDYISLILLAVVFIGAQLYYRCRF 559

Query: 528 IWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           +WK+EDVDID+DRR+IE+ +WED  P T WDKFW  +A
Sbjct: 560 LWKLEDVDIDSDRREIEDAIWEDDEPKTIWDKFWAAIA 597

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/516 (63%), Positives = 404/516 (78%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
             G  RE EVKR LK RH                    PL+ +GPVGALIAY+F+G++VY
Sbjct: 47  GEGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVY 106

Query: 110 SVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
            VTQSLGEMATFIPVTSS TVFS+RFLSP+FG ANGYMYWF+WAIT+A+E++VVGQ+IQ+
Sbjct: 107 FVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQY 166

Query: 170 WTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGV 229
           WT AVP+ AWI+IFWVL+   N FPV+FYGE EFWVAS+KV+AI+G+LIY L +VCG   
Sbjct: 167 WTDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGSH 226

Query: 230 TGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
            GP+GFRYWRNPGP GPGII+K++NE +FLGWVSSLINAAFTYQGTELVGITAGEAANPR
Sbjct: 227 QGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 286

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K+VPRAI KV FRILFFYI SLFFIGLLVPY+D +L++  + +A+SPF+ISIQN+GT +L
Sbjct: 287 KTVPRAINKVFFRILFFYILSLFFIGLLVPYDDLRLSNTTAVIASSPFVISIQNAGTKVL 346

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           PHIFNA+++ TIISAANSNVYVGSR+++ L+ S  AP+      K GVP++ VI T L G
Sbjct: 347 PHIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLG 406

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  +     AFNWL+NI+ +AG  +WLFIS+SHVRFMQ L++RGISR+DLPFKAK 
Sbjct: 407 LLAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKL 466

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIW 529
           MP  AYYA FF+ +IIIIQGF +F P F   DF  +YIS  L   +++  QL++RCR IW
Sbjct: 467 MPWGAYYAAFFIGVIIIIQGFKAFTPKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFIW 526

Query: 530 KIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
            ++D+DID+DRR+I+ +VWED  P   W+KFW  VA
Sbjct: 527 SLDDIDIDSDRREIDAIVWEDDEPKNLWEKFWVAVA 562

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/516 (62%), Positives = 401/516 (77%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
             G   E EVKR LK RH                    PL+ +GPVG+LIAY+FMG++VY
Sbjct: 64  GEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVY 123

Query: 110 SVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
            VTQSLGEMATFIPVTSS TVFS+RFLSP+FG ANGYMYWF+WAIT+A+ELSV+GQII +
Sbjct: 124 FVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINY 183

Query: 170 WTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGV 229
           WT AVP+ AWI+IFWVLL A N FPV++YGEFEF VASIKV+AI+G+L+Y L +VCG   
Sbjct: 184 WTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGSS 243

Query: 230 TGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
            GP+GFRYWRNPGP G G IAKN+N+A+FLGWV SL+NA+FTYQGTELVGITAGEA+NPR
Sbjct: 244 QGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASNPR 303

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K+VP+AI KV FRIL FYIGSLFF+GLLVPYN P+L S+ + +A+SPF+ISIQN+GT +L
Sbjct: 304 KTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLESNSAVIASSPFVISIQNAGTKVL 363

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P IFNAV+L TI+SA NSNVYVGSR+++ L+ S  AP+  S   K GVP++ VI T L G
Sbjct: 364 PDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTALLG 423

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++ T+     AFNWL+NI+ +AG  +W FIS++H+RFMQ L+ RGISRD LPFKAK 
Sbjct: 424 LLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKL 483

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIW 529
           MP  AYYA FF+ LI+ IQGFT+F P FD  +F  AYIS  L + ++I+ QL++RCR + 
Sbjct: 484 MPWGAYYAAFFVGLIVFIQGFTAFAPRFDVSEFFTAYISLILLVVLFILCQLYYRCRFLT 543

Query: 530 KIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           KIED+DID+DRR+I+ ++WED  P   W+KFW  +A
Sbjct: 544 KIEDIDIDSDRREIDAIIWEDDEPKNLWEKFWVALA 579

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/524 (58%), Positives = 388/524 (74%), Gaps = 16/524 (3%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G  +E EVKR LK RH                    PL  AGPVG+L+AY+F+GT+VYS
Sbjct: 47  EGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYS 106

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           +TQSLGEMATFIPVTSS TVFS+RFLSP+FG ANGYMYWF+WAITFA+ELSVVGQIIQ+W
Sbjct: 107 ITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYW 166

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T  VPI AWI IFWVL+  +N FPVRFYGE EFW+AS+KVL I+G+LIY   +VCG    
Sbjct: 167 TDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSKQ 226

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAK--------FLGWVSSLINAAFTYQGTELVGITA 282
           GP+G        P   GI A+    +         FLGWVSSLI AAFTYQGTELVGITA
Sbjct: 227 GPIGL-------PATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITA 279

Query: 283 GEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISI 341
           GE+ NPRK+VP+AI KV FRILFFYIGSL F+GLLVPY+DP+L S+ S  V ASPF+ISI
Sbjct: 280 GESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISI 339

Query: 342 QNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVS 401
           +N+GT ILP IFNAV+L T+ISAANSNVY+GSR+ + L+ +  AP+ L+   K GVP+  
Sbjct: 340 KNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFG 399

Query: 402 VIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRD 461
           V+ T L G ++++  +     AF+WL+NI+ +AG  +WLFIS++H+RFMQ L++RGISRD
Sbjct: 400 VLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRD 459

Query: 462 DLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQL 521
           DLPFKAKFMP  AYYA FF+T+II IQG+T+F P FD   F  +YIS FL + ++I  Q+
Sbjct: 460 DLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQI 519

Query: 522 WFRCRLIWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           +++CR +W +ED+DID+DRR+I+ +VWE+  P   WDKFW+ VA
Sbjct: 520 YYKCRFLWAVEDIDIDSDRREIDAIVWEEDEPKNIWDKFWSAVA 563

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/516 (58%), Positives = 387/516 (75%), Gaps = 1/516 (0%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
           A G+  + +VKR LK RH                    PL+ +GPVG+LIAY+FMG++VY
Sbjct: 93  AKGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVY 152

Query: 110 SVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
            VTQSLGEMATFIPVTSS TVF++RFLSP+ G +NGYMYWF+WAITFA ELSV GQIIQ+
Sbjct: 153 FVTQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQY 212

Query: 170 WTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGV 229
           WT  VP+ AWI IFWV++  +N FPV+ YGE EFWV+S+KVLAI+G+LIY L +VCG   
Sbjct: 213 WTYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSR 272

Query: 230 TGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
            GP+GFRYWR+    G G I+KN +EA+FLGWVSSLINAAFTYQGTELVGI+AGEAANPR
Sbjct: 273 QGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPR 332

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K+VPRAI KV+FRI  FYI SLFFIGLLVPYND +L+   + +A+SPF+IS+ N+GT  L
Sbjct: 333 KTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASSPFVISMLNAGTSAL 392

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P IFNAVIL T++SAANS+VY+ SR+++ L+    AP+  +  N+ GVP++ V  T L G
Sbjct: 393 PDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVG 452

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  S     AFNWL+NI+ +AG  +W FI  +H+RFMQAL+++GISRDDLPFKA+F
Sbjct: 453 WLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARF 512

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIW 529
           MP  AYYA FF+ LII IQG+ +F P +D   F  +YIS  LF  +++   +++R RL+ 
Sbjct: 513 MPWGAYYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYLGCLIYYRGRLLI 571

Query: 530 KIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565
           KIED+DIDTDR+++E  VWE+  P  +W+KFW  VA
Sbjct: 572 KIEDIDIDTDRKEVEAYVWEEDAPRNWWEKFWAAVA 607

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/509 (58%), Positives = 390/509 (76%), Gaps = 3/509 (0%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
            +++VKRELK RH                    P+ NAGPVG+L+AY+F+ T+ Y VTQS
Sbjct: 45  NQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQS 104

Query: 115 LGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           LGEMATFIPVTSSFTVF+ RF+SP+ GAANGY+YW SW ITFALE+SV+G++I +W+ AV
Sbjct: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
           PI AW++IFWVLL A+N+ PV+FYGEFEFW+AS+KV+AI+ FL Y L +VCG    G +G
Sbjct: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
           FRYW++PGP G GI+++ ++ A+FLGWVSSLI AAFT+QGTELVG+TAGE  NPR++VP+
Sbjct: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPILPHI 352
           AI  V FRIL FYIGSL  IGLLV Y+DP+L  D S     ASPF+++I  +GT +LP I
Sbjct: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            N VI+ TIISA NSN+YVGSR+++GL +S LAP  +SRT   GVP+V+V+ T +FGAL 
Sbjct: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           Y+  S+   + F+WLL+IT V+GFF+WL IS+SH+RFMQ L+ RGISRDDLPFKAKFMP 
Sbjct: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464

Query: 473 LAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIE 532
            AYYA FF+ +II++QGFT+F P F  +DF+A YIS F+F+ IW++FQ  F+ R    ++
Sbjct: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVD 523

Query: 533 DVDIDTDRRDIEEVVWEDPPPVTFWDKFW 561
           ++DIDTDRRDI+ ++W+D  P T W K W
Sbjct: 524 EIDIDTDRRDIDAIIWDDDKPTTLWGKIW 552

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  342 bits (877), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/501 (39%), Positives = 297/501 (59%), Gaps = 9/501 (1%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+     +K+EL+ RH                     L +AGPV  LI+Y F+G LVY+
Sbjct: 42  DGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYT 101

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           V   LGEMA FIP+   FT ++ R++ P+ G A GY Y F + I    +L+    ++QFW
Sbjct: 102 VMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFW 160

Query: 171 TSA--VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
            S   V    WI+IF  L+V +N   VRF+GEFEFW++S+KVL ++G ++    ++ G G
Sbjct: 161 VSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGG 220

Query: 229 VTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
                 GFR+WR+PG   P   A + ++ KF+ + S    A F Y GTEL GI A EA N
Sbjct: 221 PNHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKN 280

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDD---SYVAASPFIISIQNS 344
           PR+SVPRAIK  ++RI+ FY+ ++  +G+ V YNDP+L       +  AASPF+++I+N+
Sbjct: 281 PRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENA 340

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
             P+LPHIFN  +L  + SA NS++YV SR ++GL+    APRI + TNK GVP+ S+  
Sbjct: 341 SIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGL 400

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           + LF  LAYM  S+G    FN+ +N+  + G  SW+ I I+++RF +A+  +   +  L 
Sbjct: 401 SVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLS 460

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWF 523
           + A F P   Y A+FF  LI +I+ +T F    FD   F++ YI   +++  ++ +++ +
Sbjct: 461 YTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVY 520

Query: 524 RCRLIWKIEDVDIDTDRRDIE 544
           R +LI K EDVD+ T +  I+
Sbjct: 521 RTKLI-KPEDVDLYTFKDAID 540

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  341 bits (875), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/504 (38%), Positives = 299/504 (59%), Gaps = 11/504 (2%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+     +K+EL+ RH                     L+ AGPV  LIAY F+G LVY 
Sbjct: 47  DGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYI 106

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           V   LGEMAT+IP+   FT ++ R+  P+ G A GY Y F + I    +L+    ++Q+W
Sbjct: 107 VMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYW 165

Query: 171 TSAVPIV--AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
            S   +    WI+IF V++V +N+  V+F+GEFEFW++S KVL ++  ++    ++ G G
Sbjct: 166 VSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGG 225

Query: 229 VTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
            +   +GFR++++PG   P   A + ++ KF+ +V+  + A F Y GTEL GI A E  N
Sbjct: 226 PSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKN 285

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL---TSDDSYVAASPFIISIQNS 344
           PR++VPRAIK  ++RI+ FY+ ++F +G+ V YNDP L       +  AASPF+++I+N+
Sbjct: 286 PRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNA 345

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G P+LPHIFNA +L  + SA NS++YV SR ++GL+    AP+I ++TNK GVP+ S+I 
Sbjct: 346 GIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLIL 405

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
             LF  LAYM  S+G    FN+ +N+  + G  SW+ I I+++ F +AL  +G+ +  L 
Sbjct: 406 CILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLA 465

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWF 523
           + A      AY+A+FF  LI +I+ FT F    FD  +F+  YI   +FI  +  ++ + 
Sbjct: 466 YAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YI 524

Query: 524 RCRLIWKIEDVDIDTDRR--DIEE 545
           R     K E+ D+ T +   D+EE
Sbjct: 525 RGTKFVKPEEADLYTFKELIDLEE 548

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  339 bits (870), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 182/502 (36%), Positives = 295/502 (58%), Gaps = 9/502 (1%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+     ++++LK RH                     L  AGP+   IAY F+G LV+ 
Sbjct: 78  DGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFF 137

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
              +LGEMA++IP+   FT ++ R+  P+ G A GY Y   + I    +L+    +IQ+W
Sbjct: 138 TMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYW 196

Query: 171 TSAVPIV--AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
                +    WI+IF V++VAMN   V+F+GEFEFW+++ KV+ ++G +I    ++ G G
Sbjct: 197 LDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGG 256

Query: 229 VTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
            T   +GFR++ +PG   P   + + ++ KF+ +V+ L+ A F Y G EL GI A EAAN
Sbjct: 257 PTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAAN 316

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDP---KLTSDDSYVAASPFIISIQNS 344
           PRKS+P+AIK  ++RI+ FY+ ++F +G+ V Y+DP   K  +  +  AASP++++I NS
Sbjct: 317 PRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINS 376

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G   LPHIFNA +L  + SA NS++YV SR ++GL+    AP+I + TN+ GVP+ S++ 
Sbjct: 377 GIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLM 436

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           +  F  LAYM  S+G    FN+ +N+  + G  SW+ I I+++ F +A++ + + R    
Sbjct: 437 SSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFA 496

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWF 523
           ++A F P  +Y+ + F  LI  I+ FT F    FD  +F+  YI   +F+  +  ++   
Sbjct: 497 YRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVK 556

Query: 524 RCRLIWKIEDVDIDTDRRDIEE 545
           + + IWK E+VD+ T +  I+E
Sbjct: 557 KTK-IWKPEEVDLYTFKAAIDE 577

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  337 bits (864), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/511 (36%), Positives = 293/511 (57%), Gaps = 13/511 (2%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
           ++G+     +K+ELK RH                     L   GP   LIAY F+G LV+
Sbjct: 41  SDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVF 100

Query: 110 SVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
            V   LGEMAT+IP+   FT ++ R+  P+ G A GY Y F + I    +L+    +IQ+
Sbjct: 101 FVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQY 159

Query: 170 WTSAVPIV--AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA 227
           W     +    WI+IF V++V +N   VR++GEFEFW++S K++ + G +++   ++ G 
Sbjct: 160 WIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGG 219

Query: 228 GVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAA 286
           G     +GFRYW+NPG   P   +   ++ KF+ +V+  + A F Y G EL GI A EA 
Sbjct: 220 GPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAE 279

Query: 287 NPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL---TSDDSYVAASPFIISIQN 343
           NPR+++PRAIK  ++RI+ FYI ++F +G+ V YNDP+L       +  AASPF+++IQN
Sbjct: 280 NPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQN 339

Query: 344 SGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVI 403
           SG   LPHIFN  +L  + SA NS++YVG+R ++ L+    AP++ ++TN+ GVP+ ++ 
Sbjct: 340 SGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALF 399

Query: 404 FTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDL 463
              LF  LAYM  S+G    FN+ +N+  + G  SW+ I I+++ F +A   + + R+  
Sbjct: 400 GCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSF 459

Query: 464 PFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWF 523
            ++A F P  AY  +FF  LI  I+ FT F   FD   F+  YI   L++  +  +++ +
Sbjct: 460 AYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIY 519

Query: 524 RCRLIWKIEDVDIDT-----DRRDIEEVVWE 549
           + +L+ K E+ D+ +     DR + E  + E
Sbjct: 520 KTKLV-KAEEADLYSFKEAIDREEAEGKIKE 549

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  336 bits (862), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/501 (38%), Positives = 296/501 (59%), Gaps = 9/501 (1%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+     +K+ L+ RH                     L +AGP   LI+Y F+G LVY+
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           V   LGEMA FIP+   FT ++ R++ P+ G A GY Y F + I    +L+    ++Q+W
Sbjct: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161

Query: 171 TSAVPIV--AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
            S   +    WI+IF VL+V +N   VRF+GEFEFW++S+KVL ++G ++    ++ G G
Sbjct: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGG 221

Query: 229 VTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
                 GFRYWR+PG   P   A + ++ KF+ + S    A F Y GTEL GI A EA N
Sbjct: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKN 281

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDP---KLTSDDSYVAASPFIISIQNS 344
           PR+SVPRAIK  ++RI+ FY+ S+  +G+ V YNDP   K     +  AASPF+++I+N+
Sbjct: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNA 341

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G P+LPHIFNA +L  + SA NS++YV SR ++GL+  + AP+I ++TN  GVP+ S+  
Sbjct: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           + LF  LAYM  S+G    FN+ +N+  + G  SW+ I I+++RF +A+  +   +    
Sbjct: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWF 523
           + A F P   + ++FF  LI +I+ +T F   +FD   F++ YI   ++   ++ ++L  
Sbjct: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521

Query: 524 RCRLIWKIEDVDIDTDRRDIE 544
           R +LI K EDVD+ T +  I+
Sbjct: 522 RSKLI-KPEDVDLYTFKAAID 541

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  335 bits (858), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/504 (37%), Positives = 292/504 (57%), Gaps = 11/504 (2%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+     +K+ L+ RH                     L  AGP   LIAY F+G LV+ 
Sbjct: 71  DGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFF 130

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           V   LGEMA +IP+   FT +S R+  P+ G A GY Y F + I    +L+    +IQ+W
Sbjct: 131 VMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189

Query: 171 TSAVPIV--AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
                +    WI+I  V ++ +N   VRF+GE E++++++K+  ++G +I  L + CG G
Sbjct: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGG 249

Query: 229 VTGPV-GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
               V GF+YW+NPG       A    + +F+ + S  + A F Y GTEL GI   E  N
Sbjct: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDS---YVAASPFIISIQNS 344
           PRK+VP+AIK  ++RI+ FY+ S+F +G+ VP+NDP L S  S     +ASPF+++I N+
Sbjct: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNA 369

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G P+LPHI NA IL  + SAANS++YV SR ++GL+    APRI ++TNK GVP+ S++ 
Sbjct: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
             LF  LAYM  S+G    F + +N   + G  SW+ I I+++RF +A   +GI +  L 
Sbjct: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWF 523
           +++   P  A++++FF  LI +I+ F +F   +FD   F+  YI    +I  +I ++LW+
Sbjct: 490 YQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWY 549

Query: 524 RCRLIWKIEDVDIDTDRR--DIEE 545
           + ++I   E+VD+ + +   D+EE
Sbjct: 550 KTKIIPS-EEVDLVSFKEAVDLEE 572

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/506 (36%), Positives = 302/506 (59%), Gaps = 13/506 (2%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+ +   +K++L+ RH                     L+ AGP+  LIAY  MG +V++
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           V   LGEMA +IP+   FT ++ R+  P+ G A GY Y F + +    +L+    ++Q+W
Sbjct: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168

Query: 171 TS--AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
                V    WI++F  +++ +N+  V+F+GEFEFW++S KVL ++  +   L +V G G
Sbjct: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGG 228

Query: 229 VT-GPVGFRYWRNPGPMGP--GIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEA 285
            +   +GFRYW++PG   P  G ++    + KF+ + S  + A F Y GTEL GI A E 
Sbjct: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288

Query: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDD---SYVAASPFIISIQ 342
            NPR++VPRAIK  ++RI+ FY+ ++F +GL V YNDP L       +  AASP++++I+
Sbjct: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIK 348

Query: 343 NSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSV 402
           N+G P+LPHIFNA +L+ + SA NS++YVGSR ++GL+  K AP+I ++TN  GVP+ S+
Sbjct: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408

Query: 403 IFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDD 462
               LF  LAYM  S+  E  F++ +N+T + G  SW+ I I+++ F +A   +GI ++ 
Sbjct: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468

Query: 463 LPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQL 521
           L ++A F P  A+ A+ F  ++ +++ FT F   +FD   F+  YI   ++I  ++ +++
Sbjct: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528

Query: 522 WFRCRLIWKIEDVDIDTDRR--DIEE 545
             + + I K  +VD+ T +   D+EE
Sbjct: 529 VHKTKWI-KSANVDLFTYKTAIDLEE 553

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/507 (38%), Positives = 293/507 (57%), Gaps = 14/507 (2%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
           A+G+     +K+ELK RH                     L   GPV  LIAY F+G LV+
Sbjct: 71  ADGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVF 130

Query: 110 SVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
                LGEMA++IP+   FT ++ R++ P+ G A GY Y F + I    +L+    +IQ+
Sbjct: 131 FTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189

Query: 170 WTSA--VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA 227
           W S   V    WI+IF V++VA+N+  V+F+GEFEFW++S KV+ ++G ++    ++ G 
Sbjct: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGG 249

Query: 228 GVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAA 286
           G     +GFRYWR+PG       A   +  KF  +V+  + + F+Y G EL GI   EA 
Sbjct: 250 GPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309

Query: 287 NPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY---VAASPFIISIQN 343
           NPRKSVP+AIK  V+RI+ FY+ ++F +G+ V YNDP+L S        AASPF+++IQN
Sbjct: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369

Query: 344 SGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVI 403
           SG  +LPHIFNA +L  + SA NS++YV SR ++ L+    AP+I ++T+K GVP+ ++I
Sbjct: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429

Query: 404 FTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDL 463
            + LF  LAYM  S+G    FN+ +N+  + G  SW+ I I ++ F +A   +GI +   
Sbjct: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489

Query: 464 PFKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLW 522
            + A      AY+A+ F  LI +I+ FT F    FD   F+  YI   ++I  W  ++L 
Sbjct: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549

Query: 523 FRCRLIWKIEDVDIDT-----DRRDIE 544
           ++ ++I K  DVD+ T     DR + E
Sbjct: 550 YKTKVI-KSTDVDLYTFKEIYDREEEE 575

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  333 bits (854), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/506 (37%), Positives = 294/506 (58%), Gaps = 14/506 (2%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+     ++++LK RH                     L   GPV  LIAY F+G LV+ 
Sbjct: 74  DGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFY 133

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGEMA++IP+   FT ++ R++ P+ G A GY Y F + I    +L+    +IQ+W
Sbjct: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192

Query: 171 TSA--VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
            S   V    WI+IF V++VA+N+  V+F+GEFEFW++S KV+ ++G ++    ++ G G
Sbjct: 193 ISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGG 252

Query: 229 VTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
                +GFRYWR+PG       A    + KF+ +V+  + + F+Y G EL GI   EA N
Sbjct: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY---VAASPFIISIQNS 344
           PRKSVP+AIK  V+RI+ FY+ ++F +G+ V YNDP+L S        AASPF+++IQNS
Sbjct: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G  +LPHIFNA +L  + SA NS++YV SR ++ L+    AP+I ++T++ GVP+ ++I 
Sbjct: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           + LF  LAYM  S+G    FN+ +N+  + G  SW+ I I ++ F +A   +GI +    
Sbjct: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWF 523
           + A      AY+A+FF  LI +I+ FT F    FD   F+  YI   ++I  W  ++L +
Sbjct: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552

Query: 524 RCRLIWKIEDVDIDT-----DRRDIE 544
           + ++I K  DVD+ T     DR + E
Sbjct: 553 KTKVI-KSTDVDLYTFKEIYDREEEE 577

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  333 bits (853), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/514 (35%), Positives = 298/514 (57%), Gaps = 17/514 (3%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+     +K++LK RH                     L  AGP   LIAY F+GTLV+ 
Sbjct: 74  DGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFF 133

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
              +LGEMA +IP+   FT ++ R+  P+ G A GY Y F + I    +L+    +IQ+W
Sbjct: 134 TMAALGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYW 192

Query: 171 TS--AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
                V    WI+IF V+++A+N   V+++GEFEFW++S K++ ++G +I+   ++ G G
Sbjct: 193 VDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGG 252

Query: 229 VTGP-VGFRYWRNPG---PMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGE 284
                +GFRYW+ PG   P    ++    +  KF+ +V+  + A F Y G EL GI A E
Sbjct: 253 PNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAE 312

Query: 285 AANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL---TSDDSYVAASPFIISI 341
           A NPR+++PRAIK  V+RILFFY+ ++F +G+ V Y+DP L    +  +  AASPF+++I
Sbjct: 313 AENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAI 372

Query: 342 QNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVS 401
           QNSG  +LPHIFN  +L  + SA NS++YVG+R ++ L+    AP+I ++TN+ GVP+ +
Sbjct: 373 QNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNA 432

Query: 402 VIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRD 461
           +    LF  LAYM  S+G    FN+ +N+  + G  SW  I I+ + F +A+  +GI R 
Sbjct: 433 MGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRS 492

Query: 462 DLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPS-FDGIDFLAAYISCFLFIAIWIVFQ 520
              + A F P  +Y+A+FF  L+ +I+ F+ F  + FD   F+  YI   ++   +I ++
Sbjct: 493 TFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYK 552

Query: 521 LWFRCRLIWKIEDVDIDT-----DRRDIEEVVWE 549
           L+++ + + K  + D+++     DR + E  + E
Sbjct: 553 LYYKTKTV-KPHEADLNSYKAAVDREEEEGKIKE 585

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  332 bits (852), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/511 (37%), Positives = 296/511 (57%), Gaps = 13/511 (2%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+     ++++LK RH                     L   GPV  LIAY F+G LV+ 
Sbjct: 73  DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFF 132

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGEMA++IP+   FT ++ R++ P+ G A GY Y F + I    +L+    +IQ+W
Sbjct: 133 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 191

Query: 171 TSA--VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
            S   V    WI+IF V++VA+N+  V+F+GEFEFW++S KVL ++G ++    ++ G G
Sbjct: 192 VSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGG 251

Query: 229 VTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
                +GFRYWR+PG       A    + KF+ +++  + + F+Y G EL GI   EA N
Sbjct: 252 PDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQN 311

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV---AASPFIISIQNS 344
           PRKSVP+AIK  V+RI+ FY+ ++F +G+ V YNDP+L S        AASPF+++IQNS
Sbjct: 312 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNS 371

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G  +LPHIFNA +L  + SA NS++YV SR ++ L+    AP+I S+TNK GVP+ ++IF
Sbjct: 372 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIF 431

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           + LF  LAYM  S G    FN+ +N+  + G  SW+ I I ++ F +A   +GI +    
Sbjct: 432 SVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 491

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWF 523
           + A      AY+A+ F   I +I+ FT F    FD   F+  YI   +++  W+ ++L +
Sbjct: 492 YVAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIY 551

Query: 524 RCRLIWKIEDVDIDTDR----RDIEEVVWED 550
           + ++I K  DVD+ T +    R+ E+   ED
Sbjct: 552 KTKVI-KSTDVDLYTFKEIYDREEEQGKIED 581

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  329 bits (844), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/504 (37%), Positives = 293/504 (58%), Gaps = 11/504 (2%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+     ++++LK RH                     L   GPV  LIAY F+G LV+ 
Sbjct: 72  DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFF 131

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGEMA++IP+   FT ++ R++ P+ G A GY Y F + I    +L+    +IQ+W
Sbjct: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190

Query: 171 TSA--VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
            S   V    WI+IF V++VA+N+  VRF+GEFEFW++S KV+ ++G ++    ++ G G
Sbjct: 191 VSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGG 250

Query: 229 VTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
                +GFRYWR+PG       A   ++ KF+ + S  + + F+Y G EL GI   EA N
Sbjct: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKN 310

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV---AASPFIISIQNS 344
           PRKSVP+AIK  V+RI+ FY+ ++F +G+ V YNDP+L S        AASPF+++IQNS
Sbjct: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNS 370

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G  +LPHIFN  +L  + SA NS++YV SR ++ L+    AP+I ++T+K GVP+ +++ 
Sbjct: 371 GIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMV 430

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           + LF  LAYM  S G    FN+ +N+  + G  SW+ I I ++ F +A   +G+ +    
Sbjct: 431 SVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFA 490

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWF 523
           + A      AY+A+FF  LI +I+ FT F   +FD   F+  YI   +++  W+ ++L +
Sbjct: 491 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIY 550

Query: 524 RCRLIWKIEDVDIDTDRR--DIEE 545
           + +++ K  D D+ T +   D EE
Sbjct: 551 KTKVV-KPADADLYTLKEIYDREE 573

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  328 bits (841), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/532 (33%), Positives = 296/532 (55%), Gaps = 22/532 (4%)

Query: 50  ANGQIREAE-VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLV 108
           +  Q RE   +K+ L+ RH                     L+  GP G L +Y+ +  ++
Sbjct: 39  SESQKREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVI 98

Query: 109 YSVTQSLGEMATFIPVTS-----SFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVV 163
           Y V  +LGEM  ++P +      S +    R+  PS G A G+ Y++ + I  A E +  
Sbjct: 99  YPVMNALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAA 158

Query: 164 GQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM 223
             ++ +WT+ VP  AWI+IF  ++  +N  PV+FYGE EFW A +K+L I+G L     +
Sbjct: 159 SGVVTYWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFIL 218

Query: 224 VCGAGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGIT 281
             G G +   +GFRYW+ PG     I   N    +FL   + +I   F +  G ELV +T
Sbjct: 219 FWGGGPSHDRLGFRYWQKPGAFAYHITTGN--TGRFLDVWTGVIKGGFAFILGPELVAVT 276

Query: 282 AGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDP----KLTSDDSYVAASPF 337
           + EA + R+++ +A ++  +R++FFY+ S   IG++V  NDP     L S  +  A+SPF
Sbjct: 277 SSEAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPF 336

Query: 338 IISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGV 397
           +I+IQN+   ILPHI NA ILS+  S+ NS ++  SR +  +++  +AP++  + N+ GV
Sbjct: 337 VIAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGV 396

Query: 398 PWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRG 457
           P+ +V  +  F  LAY+  S+G   AF W  NI+ ++GF  W+ I ++++RF +A+ +RG
Sbjct: 397 PYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRG 456

Query: 458 ISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSF-DGIDFLAAYISCFLFIAIW 516
           +  D +PFK+ F P   Y+ I  +++I +  G+ +F P F  G DF+AAYI+  +F+ +W
Sbjct: 457 L-YDRVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLW 515

Query: 517 IVFQLWFRCRLIWKI--EDVDIDTDRRDIEEVVWE----DPPPVTFWDKFWN 562
           +  +++ R    W I   +VD+ T   +IEE+  E      PP + W+KF +
Sbjct: 516 VGHKIYTRTLSTWVIPVAEVDVTTGLAEIEELTKELDALRVPPNSAWEKFMD 567

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  329 bits (843), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/508 (36%), Positives = 293/508 (57%), Gaps = 14/508 (2%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           +K+ L+ RH                     L+ AGP    IAY F+G LV+    ++GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW--TSAVPI 176
           A++IP+   FT ++ R++ P+ G A GY Y F + I    +L+    +IQ+W     V  
Sbjct: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217

Query: 177 VAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP-VGF 235
             WI+IF V++V +N+  V+F+GEFEFW++S KVL ++G ++    ++ G G     +GF
Sbjct: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGF 277

Query: 236 RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 295
           RYW++PG   P   A + +  KF+ +VS  + A F Y G EL GI A EA NPRKSVPRA
Sbjct: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337

Query: 296 IKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDD---SYVAASPFIISIQNSGTPILPHI 352
           +K  V+RI+ FY+ ++F +G+ V YNDP+L +     +  AASPF+++IQNSG  +LPHI
Sbjct: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHI 397

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
           FNA +L  + SA NS++YVGSR ++ L+    AP I  RT   G+P  S+    LF  LA
Sbjct: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           YM  S+G    FN+ +N+  + G  SW+ I I+++ FM+A++ +G+ R    + A F P 
Sbjct: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517

Query: 473 LAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKI 531
             Y+++ +   I  I+ FT F   SFD  +F+  YI   +F+  +  ++   + +++ K 
Sbjct: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576

Query: 532 EDVDIDT-----DRRDIEEVVWEDPPPV 554
            +VD+ T     D+++IE  + +    +
Sbjct: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQI 604

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  325 bits (834), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/502 (37%), Positives = 290/502 (57%), Gaps = 9/502 (1%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+     +K+ L+ R                      L  AGPV  LIAY F+G LV+ 
Sbjct: 63  DGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFF 122

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
              SLGEMA++IP+   FT ++ R+  P+ G A GY Y F + I    +L+    +IQ+W
Sbjct: 123 TMASLGEMASYIPL-DGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYW 181

Query: 171 --TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
                V    WI+IF V++VA+N   V+F+GEFEFW++S KVL +   +I    ++ G G
Sbjct: 182 IPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGG 241

Query: 229 VTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
                +GFR+W++PG       A   +  KF+ +VS  + A F Y GTELVGI  GEA N
Sbjct: 242 PNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEARN 301

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL---TSDDSYVAASPFIISIQNS 344
           PRKSVP+AIK  ++RI+ FY+ S+  +G+ V Y+DP L    +  +  AASPF+++I NS
Sbjct: 302 PRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNS 361

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G  +LPHIFNA +L  + SA NS++YV SR ++ L+    AP+I +RTN+ G+P+ S+  
Sbjct: 362 GIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGL 421

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           + LF  LAYM  S+G    FN+ +N+  + G  SW+ I ++++ F +A+  +GI +    
Sbjct: 422 SVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFS 481

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWF 523
           + A      AY+A+FF +LI +I+ FT F    FD   F+  YI   +F   +  ++L +
Sbjct: 482 YVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKLIY 541

Query: 524 RCRLIWKIEDVDIDTDRRDIEE 545
           + ++I  +E VD+ T +  I++
Sbjct: 542 KTKIIDPLE-VDLYTFKAAIDQ 562

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  323 bits (829), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/506 (36%), Positives = 291/506 (57%), Gaps = 8/506 (1%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
            +G+     +K++LK RH                     L  AGPV  LIAY F+G +V+
Sbjct: 56  GDGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVF 115

Query: 110 SVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
                LGEMATFIP+   FT ++ R+  P+ G A GY Y   + I    +L+    ++Q+
Sbjct: 116 FTMACLGEMATFIPL-DGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQY 174

Query: 170 WT--SAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYC-LCMVCG 226
           W     V    W+++ + ++  +N+F VRF+GEFEFW++S+KVL ++G +I   + M+ G
Sbjct: 175 WVPRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGG 234

Query: 227 AGVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAA 286
           AG    +GFRYW++PG         + +  KF+ +V+ L+   F Y G EL GI A EA+
Sbjct: 235 AGSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEAS 294

Query: 287 NPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL-TSDDSYVAASPFIISIQNSG 345
           NPR+SVP+AIK   +RIL FY+ S+F +G+ VPYND KL T++++ + ASPF I+I N+G
Sbjct: 295 NPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAG 354

Query: 346 TPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFT 405
             +LP IFN  +L  + SAANS++YV SR ++ L+    AP+I + TN+ G+P+ S+  +
Sbjct: 355 ITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVS 414

Query: 406 GLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPF 465
            LF  LAYM  S+     F + +N+  +AG  +W+ I I+++ F +A+  + + +    +
Sbjct: 415 CLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAY 474

Query: 466 KAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
            A F P  AY ++FF  LI II+ FT F   FD   F+  YI   +F+  +  +++  + 
Sbjct: 475 VAPFQPYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKITCKS 534

Query: 526 RLIWKIEDVDIDTDRR--DIEEVVWE 549
             I     VD+ + +   D E+V +E
Sbjct: 535 E-IRSARYVDLVSQKSLVDREQVEYE 559

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/505 (34%), Positives = 291/505 (57%), Gaps = 12/505 (2%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+     +K+ LK RH                     L  AGP    I Y F+G LV+ 
Sbjct: 56  DGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFF 115

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGEMA FIP+   FT ++ R++ P+ G A GY Y   + I  A +L+    ++Q+W
Sbjct: 116 TMSCLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYW 174

Query: 171 TSAVPIV--AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
                +    +I+IF +L+V +N+F V+ +GEFEFW++S KVL ++G ++    ++ G G
Sbjct: 175 VDRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGG 234

Query: 229 VTGP-VGFRYWRNPGPMGP---GIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGE 284
                +GFRYWR+PG   P    II+ + +  KF+ + S  + A F Y G EL GI A E
Sbjct: 235 PNHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAE 294

Query: 285 AANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDP---KLTSDDSYVAASPFIISI 341
           A NPRK++P+AIK  ++RI+ FY+ ++  + + V YNDP   K T   +  AASPF+++I
Sbjct: 295 AQNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAI 354

Query: 342 QNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVS 401
           +NSG  ILPHIFN  +L+ ++SAANS++YV SR ++ L+    AP+   +TNK G+P+ S
Sbjct: 355 ENSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWS 414

Query: 402 VIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRD 461
           + F+  F  LAYM  S+     FN+ +N   + G  SW+ I ++++ F +A + +G+ + 
Sbjct: 415 LAFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKS 474

Query: 462 DLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQ 520
           +  + A + P  AY+A+FF  ++ +++ FT F    FD  +F+  YI   +F   ++ ++
Sbjct: 475 NFTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYK 534

Query: 521 LWFRCRLIWKIEDVDIDTDRRDIEE 545
           + ++ +   + E+VD+ T +  I++
Sbjct: 535 IVYKTK-THRPEEVDLVTLKALIDQ 558

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  319 bits (818), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/517 (34%), Positives = 286/517 (55%), Gaps = 12/517 (2%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
           +  E  +++ L  RH                     L N GP+   ++++ +  +VY V 
Sbjct: 40  KCDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVM 99

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
            +L EM  ++P   +    + R++ PS G A G+ Y +S++I  A ELS    ++Q+WT 
Sbjct: 100 NTLAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTD 159

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGAGVTG 231
            V +  WI+IF V++V +N  PV+FYGE EFW AS+K++ I+G LI  + +   GA    
Sbjct: 160 KVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHD 219

Query: 232 PVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGEAANPRK 290
            +GFRYW NPGP    I     N  +FL   +++I + F +    EL+G+   EA + R+
Sbjct: 220 RLGFRYWNNPGPFAYHITGG--NTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRR 277

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPK----LTSDDSYVAASPFIISIQNSGT 346
           ++ +A ++ ++RI+FFYI S   IG ++  +DPK    LTSD    A+SPF+  I N+G 
Sbjct: 278 NIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGI 337

Query: 347 PILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTG 406
           P+L HI NAVILS+  S+ANS +Y  SR +  L+K   AP++ +R N+ GVP+ +V  + 
Sbjct: 338 PVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALST 397

Query: 407 LFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFK 466
               L Y+  S+     F WL NI  ++GF  W  I I+++RF +A+ Y  +  + +PFK
Sbjct: 398 AVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNL-YERVPFK 456

Query: 467 AKFMPGLAYYAIFFMTLIIIIQGFTSFCPSF-DGIDFLAAYISCFLFIAIWIVFQLWFRC 525
           +   P   Y+ + F+ L+ +  G+ +F P + +  DF+AAYI+  +F  +++  ++WF+ 
Sbjct: 457 SALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKT 516

Query: 526 RLIWKIEDVDIDTDRRDIEEVVWEDPP--PVTFWDKF 560
           R      ++D+ T   D EE      P  P   W+KF
Sbjct: 517 RWYIPFREIDVITGLADAEEEAKMTQPRTPKNMWEKF 553

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  317 bits (812), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/565 (34%), Positives = 298/565 (52%), Gaps = 27/565 (4%)

Query: 2   DKK-----QEEPLKNGKIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIRE 56
           DKK     QEEPL+      SSYE    P   + +                   +  + E
Sbjct: 5   DKKNFVYAQEEPLEAQDAGHSSYETGSSPGQTQASKSRWQDFKDGFKRVELEELDPNLTE 64

Query: 57  AE----------VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGT 106
           AE          ++R LK RH                     L   GP G LI +  +G 
Sbjct: 65  AEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGL 124

Query: 107 LVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQI 166
           ++Y V  S+GE+A   PV+  FT ++ RF+  SFG A  Y Y   W +   LE+      
Sbjct: 125 MIYCVVMSMGELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASIT 184

Query: 167 IQFW-TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVC 225
           + FW T       ++++F++++V +N F VR YGE EF  + IKV+ ++GF+I  + +VC
Sbjct: 185 VNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVC 244

Query: 226 GAGVTGPVGF-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGE 284
           G G  G     +YW NPG       + +   ++F G  S  + AAF++ GTELVG+ + E
Sbjct: 245 GGGPVGGYIGGKYWHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAE 299

Query: 285 AANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQN 343
            ANPRK++PRA K+V +RIL FYI SL  IGLLVP+   +L    S   AASPF+++IQ 
Sbjct: 300 TANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQT 359

Query: 344 SGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVI 403
            G   LP + N VIL +++S  NS VY  SR M  L++    P I +  ++ G P V++I
Sbjct: 360 HGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAII 419

Query: 404 FTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDL 463
            T +FG L+++  S      FNWLL ++G++  FSW  I I H+RF +AL  +G S D+L
Sbjct: 420 TTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDEL 479

Query: 464 PFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP---SFDGIDFLAAYISCFLFIAIWIVFQ 520
            F +      +Y+ +  + L++I Q + +  P   S +  DF +AY+S  + +A +I  +
Sbjct: 480 AFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHK 539

Query: 521 LWFRC-RLIWKIEDVDIDTDRRDIE 544
           +W R  +L  + +D+DIDT RR+++
Sbjct: 540 IWKRNWKLFTRAKDIDIDTGRREMD 564

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  315 bits (808), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 175/525 (33%), Positives = 291/525 (55%), Gaps = 26/525 (4%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           +K+ LK RH                     L   GP G  IAY  + +++Y +  ++GEM
Sbjct: 75  LKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEM 134

Query: 119 ATFIP-----VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
             ++P        S T   +R++  S   A G+ Y++ + I  A E +    ++++WT A
Sbjct: 135 VCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLA 194

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP- 232
           VP  AWI+IF  ++  +NM  V+++GE EFW ASIK+L IMG +I    +  G G +   
Sbjct: 195 VPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDR 254

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKS 291
           +GFRYW+NPG     +   +L    FL   S +I  AF +  G ELV +T+ E ++ R++
Sbjct: 255 LGFRYWKNPGAFAHHVTDGSL--GNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRN 312

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY----VAASPFIISIQNSGTP 347
           + +A K+ ++R++FFYI     IG++V +NDP L S  S       +SPF+I IQN+G  
Sbjct: 313 IAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIE 372

Query: 348 ILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGL 407
           +LPHI NA IL++  S+ N+ ++  SR +F ++++  AP+I  R NK GVP+++VI + L
Sbjct: 373 VLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTL 432

Query: 408 FGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKA 467
              LAY+  S+     F WL NI+ ++GF  W+   I+++RF +A+ Y  +  D +PFK 
Sbjct: 433 ISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNL-YDRMPFKT 491

Query: 468 KFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGI-DFLAAYISCFLFIAIWIVFQLWFR-- 524
              P L  +++  +++I I  G+ +F P F  + DF+AAYI+  +F+A+++  +++    
Sbjct: 492 WGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFK 551

Query: 525 -----CRLIWKIEDVDIDTDRRDIEEVVWEDPP----PVTFWDKF 560
                 +L + +ED+D+ T   +IE    E       P   W++F
Sbjct: 552 NDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRILPTNRWERF 596

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  314 bits (804), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 173/504 (34%), Positives = 279/504 (55%), Gaps = 17/504 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           E ++++ L  RH                     L   GP G  I+Y+ + T++Y +  + 
Sbjct: 53  EGKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAF 112

Query: 116 GEMATFIP-----VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           GEM  ++P        S +    R++ PS   A G+ Y++ + I  A E +    ++++W
Sbjct: 113 GEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYW 172

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T AVP  AWI+IF  ++V +N+  V++YGE EFW ASIKVL I+G +I    +  G G  
Sbjct: 173 TDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPN 232

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGEAANP 288
              +GFRYW+NPG     I   NL    FL   S +I  AF +  G EL+ + + E  + 
Sbjct: 233 HDRLGFRYWKNPGGFAHHITGGNL--GNFLDVYSGIIKGAFAFILGPELIALASSECKDQ 290

Query: 289 RKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTS----DDSYVAASPFIISIQNS 344
           R+++ +A K+ V+R++FFYI     I ++V  NDP LTS          +SPF+I IQN+
Sbjct: 291 RRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNA 350

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G  ILPHI NA IL++  SA N+ ++  SR +  ++ +  AP+I  + N+ GVPWV+V F
Sbjct: 351 GIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTF 410

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           + L   LAY+  S+     F W  NI+ ++GF  W    ++++RF +A++Y G+  + LP
Sbjct: 411 SALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGL-ENRLP 469

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGI-DFLAAYISCFLFIAIWIVFQLWF 523
           +  +F   + +++I  +TL+I   G+  F P F  + DF+AAYI+  LF+ +WI  +++ 
Sbjct: 470 YAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYT 529

Query: 524 RCRLIW--KIEDVDIDTDRRDIEE 545
           R    W   +E++D+ T   +IEE
Sbjct: 530 RDFKKWWYPVEEIDVVTGLTEIEE 553

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  313 bits (803), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 188/548 (34%), Positives = 303/548 (55%), Gaps = 15/548 (2%)

Query: 5   QEEPLKNGKIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIREAEVKRELK 64
           ++ P K  K+     EL +  L R  +S                  +G+     +K+ LK
Sbjct: 20  EQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNI------DGKTEGTRLKKALK 73

Query: 65  QRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPV 124
            RH                     L  AGPV  LIAY F+G LV+     LGEMAT+IP+
Sbjct: 74  ARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTMACLGEMATYIPL 133

Query: 125 TSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV--AWISI 182
              FT ++ R+  P+ G A GY Y F + I    +L+    +IQ+W     +    W++I
Sbjct: 134 -DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTI 192

Query: 183 FWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP-VGFRYWRNP 241
           F V++V++N+F VRF+GEFEFW++S KVL ++G ++    ++ G G     +GFRYWR+P
Sbjct: 193 FLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDHDRLGFRYWRHP 252

Query: 242 GPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVF 301
           G           +  +F+ +VS  + A + Y G EL GI A EA NPRKS+P+AIK  ++
Sbjct: 253 GSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMY 312

Query: 302 RILFFYIGSLFFIGLLVPYNDP---KLTSDDSYVAASPFIISIQNSGTPILPHIFNAVIL 358
           RI+ FY+ S+F +G+ V Y+DP   K  +  +  AASPF+++I NSG   LPHI NA +L
Sbjct: 313 RIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGINALPHIINACVL 372

Query: 359 STIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETST 418
             + SA NS++YV SR ++ L+    AP+I ++TN+ G+P+ ++  + LF  LAYM  S+
Sbjct: 373 VFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSS 432

Query: 419 GGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAI 478
                FN+ +N+  + G  SW+ I I+++ F +A+  +G+ +    + A F P  A++++
Sbjct: 433 ASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSL 492

Query: 479 FFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDID 537
           FF  LI +I+ FT F    FD  +F+  YI   +F   +  ++  ++ ++I  ++ VD+ 
Sbjct: 493 FFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLK-VDLY 551

Query: 538 TDRRDIEE 545
           T +  I++
Sbjct: 552 TFKAAIDQ 559

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  314 bits (804), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 174/519 (33%), Positives = 287/519 (55%), Gaps = 21/519 (4%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           +K+ L+ RH                     L+  GP G L +Y+ +  ++Y V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 119 ATFIPVTS-----SFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
             F+P ++     S +    R+  PS G A G+ Y++ + I  A E +    ++ +WT+A
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP- 232
           VP  AWI+IF  ++  +N  PV+ YGE EFW A +K+L I+G L     +  G G T   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKS 291
           +GFRYW++PG     I   N    +FL   + +I   F +  G ELV IT+ EA + R++
Sbjct: 285 LGFRYWQHPGAFAYHITTGN--TGRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDP----KLTSDDSYVAASPFIISIQNSGTP 347
           + +A ++  +R++FFY+ S   IG++V   DP     L    +   +SPF+I+IQN+   
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 348 ILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGL 407
           +LPHI NA ILS+  S+ NS ++  SR +  +++   APRIL R N+ GVP+ +V  +  
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 408 FGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKA 467
           F  LA++  S+G   AF W  NI+ ++GF  W+ I +++++F +A+ +RG+  + +PFK+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 468 KFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRL 527
              P   Y+ I  ++LI +  G+ SF  +++  DF+AAYI+  +F+ +W+  +++ R   
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTRTWS 580

Query: 528 IW--KIEDVDIDTDRRDIEE----VVWEDPPPVTFWDKF 560
            W   + +VD+ T   +IEE    +  +  PP   W KF
Sbjct: 581 TWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKF 619

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  308 bits (789), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 170/504 (33%), Positives = 278/504 (55%), Gaps = 17/504 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +  +K+ LK RH                     L   GP G   +Y  +  ++Y V  +L
Sbjct: 48  DHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNAL 107

Query: 116 GEMATFIPVTSSFTV-----FSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           GEM  ++P   S +         R++ PS G A G+ Y++ + I  A E +    ++Q+W
Sbjct: 108 GEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYW 167

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T+AVP  AWI+IF  ++V +N   V+FYGE EFW AS+K+L I+G L     +  G G  
Sbjct: 168 TTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPH 227

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGEAANP 288
              +GFRYW+ PG     I + N    +FL   + +I   F +  G ELV +T+ EA + 
Sbjct: 228 HDRLGFRYWQKPGAFAYHITSGN--TGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDA 285

Query: 289 RKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTS----DDSYVAASPFIISIQNS 344
           R+++ +A ++ V+R++FFY+ S   IG +V YND  L++          +SPF+I IQN+
Sbjct: 286 RRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNA 345

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G  +LPHI N  ILS+  S+ NS ++  SR +  +S+   AP+IL R N+ GVP+ +V  
Sbjct: 346 GIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVAL 405

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           T L   +AY+  S+     F W  NI+ ++GF  W+ I I+++RF +A+ ++ +  + +P
Sbjct: 406 TSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVP 464

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPS-FDGIDFLAAYISCFLFIAIWIVFQLWF 523
           FK  F P   ++ I  +++I +  G+  F P+ ++  DF+AAY++  +F+ +WI  +LW 
Sbjct: 465 FKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWT 524

Query: 524 RCRLIWKI--EDVDIDTDRRDIEE 545
           R    W I   ++D+ T  ++IEE
Sbjct: 525 RTWKTWAIPVPEIDVTTGLKEIEE 548

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  309 bits (792), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 189/601 (31%), Positives = 306/601 (50%), Gaps = 44/601 (7%)

Query: 2   DKKQEEPLKNGKIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIRE----- 56
           D K+EE +       SS   ++   HR  N                  +NG IRE     
Sbjct: 32  DTKKEEDVVQVTESPSSGSRNN---HRSDNEKDDAIRMEKISKNQSASSNGTIREDLIMD 88

Query: 57  ---------------AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAY 101
                           ++K+ L+ RH                     L   GP G  I+Y
Sbjct: 89  VDLEKSPSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISY 148

Query: 102 LFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQ-----RFLSPSFGAANGYMYWFSWAITF 156
           + +  ++Y +  +LGEM  F+P   S +  S      R++ PS G A G+ Y++ + I  
Sbjct: 149 IIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILV 208

Query: 157 ALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGF 216
           A E +    ++++WT+AVP   WI+IF  ++V +N   V+ YGE EFW ASIK+L I+G 
Sbjct: 209 AAECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGL 268

Query: 217 LIYCLCMVCGAGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QG 274
           +I    +  G G     +GFRYW++PG     +   +L    F    + +I  AF +  G
Sbjct: 269 IILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILG 326

Query: 275 TELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTS----DDS 330
            ELV +T+ E A+ R+++ +A ++ V+R++FFY+     I ++VPYNDP L +       
Sbjct: 327 PELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKP 386

Query: 331 YVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILS 390
              +SPF+I IQN+G  +LPHI N  IL++  SAAN+ ++  +R +  ++++  AP+ L 
Sbjct: 387 GAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLG 446

Query: 391 RTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFM 450
           R NK GVP+V+V  + L   LAY+  S+     FNW  NI+ ++GF  W+   I+++RF 
Sbjct: 447 RINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFR 506

Query: 451 QALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGI-DFLAAYISC 509
           +A+ Y G+  D LPFK    P   ++++  + +I I  G+  F P +  + DF+AAYI+ 
Sbjct: 507 KAIFYNGL-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITL 565

Query: 510 FLFIAIWIVFQLWFRCRLIW--KIEDVDIDTDRRDIEEVVWEDP----PPVTFWDKFWNV 563
            +F+ +W   +L+ R    W   + ++D+ T   +IEE   E      PP  F DKF + 
Sbjct: 566 PIFLVLWFGHKLYTRTWRQWWLPVSEIDVTTGLVEIEEKSREIEEMRLPPTGFKDKFLDA 625

Query: 564 V 564
           +
Sbjct: 626 L 626

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  307 bits (786), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 164/485 (33%), Positives = 273/485 (56%), Gaps = 20/485 (4%)

Query: 89  LTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMY 148
           L N G    L++++ + T+VY +  SL EM  ++P   S      R++ PS G A G+ Y
Sbjct: 76  LHNCGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNY 135

Query: 149 WFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASI 208
            +++AI  A ELS    ++ +W + VP+ AWI+IF V++V +N   V++YGE EFW ASI
Sbjct: 136 AYAYAILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASI 195

Query: 209 KVLAIMGFLIYCLCM-VCGAGVTGPVGFRYWRNPGP----MGPGIIAKNLNEAKFLGWVS 263
           K++ I+G L+  + +   GA      GFRYW+NPGP    + PG      +  +FL    
Sbjct: 196 KLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPG------STGRFLDVWR 249

Query: 264 SLINAAFTY-QGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYND 322
           ++I +AF +    EL+GI   EA + R++  +A ++ ++RI+FFY+     IG+++   D
Sbjct: 250 AVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTD 309

Query: 323 PK----LTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFG 378
           PK    L +     A+SPF+  I N+G P+L H+ N  ILS+  SA NS +Y  +R++  
Sbjct: 310 PKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLA 369

Query: 379 LSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFS 438
           L++   AP+ L++ N+ GVP+ +VI   L   LAY+   T     F WL NI  ++GF  
Sbjct: 370 LAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIG 429

Query: 439 WLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPS-F 497
           W  + I+ +RF + + +  + +  +P++    P +AYY  F   ++ +  GF  F    +
Sbjct: 430 WFAMGIAFIRFRRGIVFNNL-QSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKGRW 488

Query: 498 DGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRDIEEVVWEDPP--PVT 555
           + +DF+AAY++  +++ +++  +LWFR R    +E +D+ T   + EE     PP  P  
Sbjct: 489 NVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDVITGLVEAEEESKMTPPRIPKN 548

Query: 556 FWDKF 560
            W+KF
Sbjct: 549 LWEKF 553

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  307 bits (786), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 173/529 (32%), Positives = 287/529 (54%), Gaps = 22/529 (4%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
            E  +++ LK RH                     L   GP G  I+Y+ + ++VY +   
Sbjct: 73  NEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCG 132

Query: 115 LGEMATFIP-----VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
            GEM  ++P      + S      R++  S G A  + Y++ + I  A E +    ++++
Sbjct: 133 FGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEY 192

Query: 170 WTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGV 229
           WT AVP   WI IF  ++V +N  PV++YGE EFW ASIK+L I+G +I    +  G G 
Sbjct: 193 WTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGP 252

Query: 230 TGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGEAAN 287
               +GFRYW+ PG     I+       +FL   S +I   F +  G ELV +T+ E  +
Sbjct: 253 NHDRLGFRYWQRPGAFTEHIMKGGF--GRFLDIYSGVIKGGFAFILGPELVCLTSAECED 310

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL----TSDDSYVAASPFIISIQN 343
            R+++ +A ++ ++R++FFY+     I ++V YNDP L     S      +SPF+I IQN
Sbjct: 311 QRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQN 370

Query: 344 SGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVI 403
           +G  +LPHI NA ILS+  SA N+ ++  +R +  ++++  APR+  + N+ GVP+V++ 
Sbjct: 371 AGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAIS 430

Query: 404 FTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDL 463
            +G    LA++  S+     FNW  NI+ ++GF  W+   ++++RF +A+ + G+  D L
Sbjct: 431 LSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRL 489

Query: 464 PFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYISCFLFIAIWIVFQLW 522
           PFK    P   YY++F ++LI +  G+ +F P ++ G DF+AAYI+  +F+ +W+  +LW
Sbjct: 490 PFKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLW 549

Query: 523 FRC---RLIWKIEDVDIDTDRRDIEE---VVWEDP-PPVTFWDKFWNVV 564
            R    R   +++ +D+ T   DIEE   ++ E    P T W KF + V
Sbjct: 550 TRTFTKRWWRRVDQIDVTTGLVDIEERTKILDETRVEPSTRWQKFMDAV 598

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  306 bits (785), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 171/499 (34%), Positives = 269/499 (53%), Gaps = 12/499 (2%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
           +  ++ +K  LK RH                     L  AGP G LI +   GT++YS+ 
Sbjct: 73  KTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMV 132

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW-T 171
            ++GE+A   PV   FT ++ RF+  SFG A  ++Y   W +   LE+      + +W T
Sbjct: 133 MAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGT 192

Query: 172 SAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTG 231
                  ++++F+V++V +NMF V+ YGE EF  + IKV+ ++GF+I  + ++CG G   
Sbjct: 193 DPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDH 252

Query: 232 P-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
             +G +YW NPG         +    +F G+ +  + AAF++ G+ELVG+   EA  PRK
Sbjct: 253 KYIGAQYWYNPGAF-----VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRK 307

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPIL 349
           SVP A K+V +RI  FYI  L  IG+LVP + P+L    S   AASPF+I+I N G   L
Sbjct: 308 SVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIVNHGIKGL 367

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P + N VIL  ++S  NS +Y  SR +  L+     P I    ++ G P V +  +  FG
Sbjct: 368 PSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFG 427

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            +A++  S      FNWL+ ++G++  F+W  I + H+R+  AL  +G S D+LPF+A  
Sbjct: 428 LIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPA 487

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP---SFDGIDFLAAYISCFLFIAIWIVFQLWFRC- 525
               +Y+  F   L+ I Q +    P     +  DF  AY+S  +FIA++   ++W R  
Sbjct: 488 GVWGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHKIWKRNW 547

Query: 526 RLIWKIEDVDIDTDRRDIE 544
           +L   ++D+DIDT RR+++
Sbjct: 548 KLFIPLKDLDIDTGRREVD 566

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  306 bits (784), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 181/496 (36%), Positives = 279/496 (56%), Gaps = 12/496 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
            + ++ +LK RH                     L  AGP G LI +   GT+++++  +L
Sbjct: 85  RSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMAL 144

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           GE+A   PV+  FT ++ RF+  SFG A  + Y   W +   LE+      + +W + V 
Sbjct: 145 GELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVR 204

Query: 176 IV-AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
               ++++FW+++V +NMF VR YGE EF  + IKV A++GF+I  + +VCG G  G   
Sbjct: 205 YTDGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYV 264

Query: 235 F-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
             RYW NPG         + +  KF G+ S  + AAF++ G+EL+G+   EA NPRK+VP
Sbjct: 265 GARYWHNPGAF-----VGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVP 319

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL-TSDDSYVAASPFIISIQNSGTPILPHI 352
            A K+V +RIL FYI  L  IG LVPYNDP+L +S     +ASPF+I+I   G   LP +
Sbjct: 320 SAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGLPSV 379

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            N VIL +++S  NS +Y  SR +  LS+    P+I+S  ++ G P V +  +  FG +A
Sbjct: 380 INVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIA 439

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S      FNWLL I+G++ FF+W  I I H+RF  AL+ +G   D+LPF +     
Sbjct: 440 FVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVI 499

Query: 473 LAYYAIFFMTLIIIIQGFTSFCP---SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLI 528
            +Y+ +F   L++I Q + +  P   S    +F +AY++  + +A +I  +LW +  + +
Sbjct: 500 GSYWGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLWKKNWKFL 559

Query: 529 WKIEDVDIDTDRRDIE 544
             +EDVDIDT RRD +
Sbjct: 560 IPLEDVDIDTGRRDTD 575

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  305 bits (780), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 171/522 (32%), Positives = 288/522 (55%), Gaps = 23/522 (4%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
           E+K+ LK RH                     L   GP G  I+Y  + +++Y + Q +GE
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 118 MATFIPVTSS----FTVF-SQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
           M  ++P + S    F  +   +++  S G A+ + Y++ + I  A E +    ++++WT+
Sbjct: 134 MVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWTT 193

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
           +VP  AWI+IF   +V +N   V+FYGE EFW ASIK+L I+G +I    +  G G    
Sbjct: 194 SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 253

Query: 233 -VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGEAANPRK 290
            +GFRYW+NPG     I   +     FL   + +I   F +  G E++ +T+ E  + R+
Sbjct: 254 RLGFRYWQNPGGFAHHIRGGSF--GSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRR 311

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTS----DDSYVAASPFIISIQNSGT 346
           ++ +A ++ V+R++FFYI     I ++V YNDP L +    +     +SPF+I IQN+G 
Sbjct: 312 NIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGI 371

Query: 347 PILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTG 406
            +LPHI NA ILS+  SA N+ ++  SR +  ++++  APRI ++ N+ GVP+ +V  + 
Sbjct: 372 KVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSS 431

Query: 407 LFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFK 466
               LAY+  S+     FNW  NI+ ++GF  W+ + I+++RF +A+ + G+ +  LP+ 
Sbjct: 432 AISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSRLPYT 490

Query: 467 AKFMPGLAYYAIFFMTLIIIIQGFTSFCPSF-DGIDFLAAYISCFLFIAIWIVFQLWFRC 525
           A+ MP L Y+ +  +++I +  G+  F P F D  +F+AAYI+  +F  +WI  +++ R 
Sbjct: 491 ARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHRVYRRK 550

Query: 526 RLI---WK-IEDVDIDTDRRDIEEVVWEDPP----PVTFWDK 559
                 WK IE++D+ T   +IEE   E       P  +W+K
Sbjct: 551 IFTLKWWKSIEEIDVVTGVEEIEEKTRECDASRVLPTKWWEK 592

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  303 bits (777), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 171/493 (34%), Positives = 269/493 (54%), Gaps = 12/493 (2%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           ++ +LK RH                     L  AGP G LI ++  G+++Y +  S+ E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW-TSAVPIV 177
           A   PV   FT ++ RF+  S+G AN + Y   W +T  LE+      + +W T      
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGF-R 236
            ++++FWV++V +NMF VR YGE EF  +  K+L I+GF+I  + ++CG G        R
Sbjct: 204 GFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGAR 263

Query: 237 YWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 296
           YW +PG       A + +  KF G+ S  + AAF++ G+ELVG+ A EA+NPRK VP A 
Sbjct: 264 YWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGAA 318

Query: 297 KKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPHIFNA 355
           K+V +RI  FY+  L  IG+LVPY DP+L    S   AASPF+I+I+N G   LP + N 
Sbjct: 319 KQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGLPTLVNV 378

Query: 356 VILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYME 415
           VIL  ++S  NS VY  SR +  L+     P+  S  ++ G P V +  T  FG +A++ 
Sbjct: 379 VILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIAFVA 438

Query: 416 TSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAY 475
            S      F+WL+ ++G++  F+W  I + H+RF +AL  +G S ++L F +      A 
Sbjct: 439 QSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVWGAA 498

Query: 476 YAIFFMTLIIIIQGFTSFCP---SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIWKI 531
           + +F   +++  Q + +  P        DF   Y+S  + +A+W+  ++W +  +L  K 
Sbjct: 499 WGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNWKLFIKA 558

Query: 532 EDVDIDTDRRDIE 544
           ED+DIDT RR+++
Sbjct: 559 EDMDIDTGRRELD 571

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  301 bits (770), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 162/493 (32%), Positives = 268/493 (54%), Gaps = 5/493 (1%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +   + RELK R                      L   GP+   IAYLF G+L+  V  S
Sbjct: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87

Query: 115 LGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           L EMA+F P+   F+ +  R++ P+FG A G+ Y+  +AI  +  L+  G +I +W   V
Sbjct: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDV 147

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPV- 233
            +  W+++ +V +  +N   V+++GE E  +   K+L ++   I CL + CG        
Sbjct: 148 NVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           GFRYWR  G + P ++       KFLGW + ++ + F + G+E++GI  GE ANP+K++P
Sbjct: 208 GFRYWRESGAL-PYLVGGG--TGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLV-PYNDPKLTSDDSYVAASPFIISIQNSGTPILPHI 352
           ++   V FRI F Y+  +F +GL + P N   + +  +   ASPF+I+I +SG  +LP+ 
Sbjct: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            NA +L  IIS+AN+++Y+ SR ++GL+K   AP+I    N+  VP V  +   L G LA
Sbjct: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           YM T       F+++ +   V G  +W +I I+++ + +A++ +GIS DD+PF+  F P 
Sbjct: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444

Query: 473 LAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIE 532
            AY  +FF+T+I    G+ +F   F    F+ +YI  F  I + I ++L+F+ + +   E
Sbjct: 445 AAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSE 504

Query: 533 DVDIDTDRRDIEE 545
                 +  + EE
Sbjct: 505 ISFRTRNEHEGEE 517

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  302 bits (773), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 173/534 (32%), Positives = 286/534 (53%), Gaps = 30/534 (5%)

Query: 56  EAEVKRELKQ----RHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSV 111
           EAE   +LKQ    RH                     L   GP G +I+Y+ + T++Y +
Sbjct: 51  EAEGNGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPI 110

Query: 112 TQSLGEMATFIP-----VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQI 166
             +LGEM  ++P        S      R++  S   A G+ Y++ + I  A E +    +
Sbjct: 111 MNALGEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGV 170

Query: 167 IQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG 226
           + +WT++VP   WI+IF  ++  +N   V+++GE EFW ASIK+L I+G ++    +  G
Sbjct: 171 VTYWTTSVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWG 230

Query: 227 AGVTG-PVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGE 284
            G +   +GF YW++PG     I   +     FL   + +I  AF +  G ELV +T+ E
Sbjct: 231 GGPSHVRLGFHYWKDPGTFAHHITGGSW--GSFLDIYTGIIKGAFAFILGPELVALTSSE 288

Query: 285 AANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDP----KLTSDDSYVAASPFIIS 340
             + R+++ +A K+ ++R++FFYI     I ++V YNDP     L       A+SPF+I 
Sbjct: 289 CNDQRRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIG 348

Query: 341 IQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWV 400
           IQN+G  +LPHI NA ILS+  SA NS ++  SR +  ++ +  AP+I  + N+ GVP+ 
Sbjct: 349 IQNAGIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYY 408

Query: 401 SVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISR 460
           SV  + +   LA++  S+     F+W  NI+ ++GF  W+   I+++RF +A+ Y  +  
Sbjct: 409 SVGLSAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNM-Y 467

Query: 461 DDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSF-DGIDFLAAYISCFLFIAIWIVF 519
           D LPFK    P L +Y++  +++I +  G+ +F P F  G DF+AAYI+  LF+ +W+  
Sbjct: 468 DRLPFKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGH 527

Query: 520 QLWFR-------CRLIWKIEDVDIDTDRRDIEEVVWE----DPPPVTFWDKFWN 562
           + W R        +L + ++++D+ T   + EEV  +      PP T+W KF N
Sbjct: 528 KFWARYKHAVPLLKLYYPVDEIDVITGLAEAEEVAEKLDMNRIPPSTYWGKFIN 581

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  302 bits (774), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 169/507 (33%), Positives = 280/507 (55%), Gaps = 13/507 (2%)

Query: 52  GQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSV 111
           G   + ++K+ +K RH                     L N GP G +I Y  MG+ +Y +
Sbjct: 89  GDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCI 148

Query: 112 TQSLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
            Q+ GE+A  +  ++  F  +    + P+ G +  ++Y   W     LEL      I++W
Sbjct: 149 IQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYW 208

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGV 229
           T++V    +++IF+V+++ +N+F  R Y E EF+  + KVL I GFLI  + + CG AG 
Sbjct: 209 TTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGN 268

Query: 230 TGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
            G +G +YW +PG       + +     F G VS+L+ AAF +  TE + +TA E ANPR
Sbjct: 269 DGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPR 323

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPI 348
           KS+P A KK+++RIL  Y+GS+  IG LVP+N  +L  S  S   ASP++I+I + G  +
Sbjct: 324 KSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKV 383

Query: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLF 408
           +PH+ NAVIL ++IS  NS  Y  SR++  L++   AP  L   ++ G P ++++ + +F
Sbjct: 384 VPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVF 443

Query: 409 GALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAK 468
           G ++++  S   E  F WLL I+G++  F+W  I +SH+RF +A++ +G S  +L FK++
Sbjct: 444 GLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQ 503

Query: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFR 524
                +YYA   M LI+I Q +T+  P      D   F   Y++  + IA++  +++W R
Sbjct: 504 VGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKR 563

Query: 525 C-RLIWKIEDVDIDTDRRDIEEVVWED 550
              L      +D+ ++RR  +E V + 
Sbjct: 564 DWTLYIPASKIDLISNRRIFDEDVLKQ 590

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  300 bits (767), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 165/490 (33%), Positives = 266/490 (54%), Gaps = 10/490 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           E  +K+ L  RH                     LT  GP    ++++ + T+VY +  +L
Sbjct: 48  EHNLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTL 107

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
            EM  ++P   S      R++ PS G A G+ Y +S+A+  A EL+    I+++WT  VP
Sbjct: 108 AEMVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVP 167

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGAGVTGPVG 234
              WI+IF +++V +N   VRFYGE EFW AS+K++ I+  L+  + +   GA     VG
Sbjct: 168 QGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVG 227

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKSVP 293
           FRYWRNPG  G  I   NL   +FL   +++I +AF +    ELVG+   EA + R+++ 
Sbjct: 228 FRYWRNPGAFGYHITGGNL--GRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIE 285

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPK----LTSDDSYVAASPFIISIQNSGTPIL 349
           +A ++ ++RI+FFY+ S   IG++V  ND      L  +    A+SPF+  I NSG P+L
Sbjct: 286 KASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVL 345

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
            H+ N  IL++  SA NS  Y  SR +  LSK   AP+I S+ N+ GVP+ +V    L  
Sbjct: 346 NHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVA 405

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LAY+  S+     F WL NI  ++GF  W  I ++++RF +A+ +  +  D +P+++  
Sbjct: 406 CLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LDRIPYRSPL 464

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPS-FDGIDFLAAYISCFLFIAIWIVFQLWFRCRLI 528
            P  AY+    + +I +  G+  F    +D  DFL +YIS  +F+A ++  +  ++ R  
Sbjct: 465 QPFSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFC 524

Query: 529 WKIEDVDIDT 538
             ++ +D+ T
Sbjct: 525 IPVDQIDVIT 534

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  301 bits (771), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 175/532 (32%), Positives = 288/532 (54%), Gaps = 21/532 (3%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G     ++K+ L+ RH                     L   GP G  I+Y+ +  ++Y 
Sbjct: 102 EGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYP 161

Query: 111 VTQSLGEMATFIPVTSSFTVFSQ-----RFLSPSFGAANGYMYWFSWAITFALELSVVGQ 165
           +  +LGEM  F+P   S +  S      R++  S G A G+ Y++ + I  A E +    
Sbjct: 162 IMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASG 221

Query: 166 IIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVC 225
           ++++WT+AVP   WI+IF  ++V +N+  V+ YGE EFW ASIK+L I+G +I    +  
Sbjct: 222 VVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFW 281

Query: 226 GAGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAG 283
           G G     +GFRYW++PG     +   +L    F    + +I  AF +  G ELV +T+ 
Sbjct: 282 GGGPNHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSA 339

Query: 284 EAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTS----DDSYVAASPFII 339
           E A+ R+++ +A ++ V+R++FFY+     I ++VPYNDP L +          +SPF+I
Sbjct: 340 ECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVI 399

Query: 340 SIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPW 399
            IQN+G  +LPHI N  ILS+  SAAN+ ++  +R +  ++++  AP+ L R N+ GVP+
Sbjct: 400 GIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPY 459

Query: 400 VSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGIS 459
           V+V  + L   LAY+  S+     FNW  NI+ ++GF  W+   I+++RF +A+ Y G+ 
Sbjct: 460 VAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL- 518

Query: 460 RDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGI-DFLAAYISCFLFIAIWIV 518
            D LPFK    P   + ++  + +I +  G+  F P +  I DF+AAYI+  +F+ +W  
Sbjct: 519 FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFG 578

Query: 519 FQLWFRCRLIW--KIEDVDIDTDRRDIEEVVWEDP----PPVTFWDKFWNVV 564
            +L+ R    W   + ++D+ T   +IEE   E      PP +F DKF + +
Sbjct: 579 HKLYTRTWSQWWLPVSEIDVTTGLIEIEEKSREIEEMRLPPSSFKDKFMDAL 630

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  302 bits (774), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 173/536 (32%), Positives = 292/536 (54%), Gaps = 27/536 (5%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
           A+G      +K+ L+ RH                     L   GP G  I+Y+ +  ++Y
Sbjct: 153 ADGDAGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIY 212

Query: 110 SVTQSLGEMATFIPVTSSFTVFSQ-----RFLSPSFGAANGYMYWFSWAITFALELSVVG 164
            +  +LGEM  F+P   S +  S      R++  S G A G+ Y++ + I  A E +   
Sbjct: 213 PIMCALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAAS 272

Query: 165 QIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMV 224
            ++++WT+AVP   WI+IF  ++V +N   V+ YGE EFW ASIK+L I+G +I    + 
Sbjct: 273 GVVEYWTTAVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILF 332

Query: 225 CGAGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITA 282
            G G     +GFRYW++PG     +   +L    F    + +I  AF +  G ELV +T+
Sbjct: 333 WGGGPKHDRLGFRYWQHPGSFAHHLAGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTS 390

Query: 283 GEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTS----DDSYVAASPFI 338
            E A+ R+++ +A ++ V+R++FFY+     I ++VPYNDP L +          +SP++
Sbjct: 391 AECADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYV 450

Query: 339 ISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVP 398
           I IQN+G  +LPHI N  IL++  SAAN+ ++  +R +  ++++  AP+ L + N+ GVP
Sbjct: 451 IGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVP 510

Query: 399 WVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGI 458
           +V+V  + L   LAY+  S+     FNW  NI+ ++GF  W+   I+++RF +A+ + G+
Sbjct: 511 YVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL 570

Query: 459 SRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSF-DGIDFLAAYISCFLFIAIWI 517
             D LPFK    P   ++++  +++I I  G+  F P + +  DF+AAYI+  +F+ +W+
Sbjct: 571 -YDRLPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWL 629

Query: 518 VFQLWFRCRLIW--KIEDVDIDT-------DRRDIEEVVWEDPPPVTFWDKFWNVV 564
             +L+ R    W   + ++D+ T         RDIEE+     PP TF +KF + +
Sbjct: 630 GHKLYTRTWNHWWHSVSEIDVTTGLVEIEEKSRDIEEL---RLPPATFKEKFMDAL 682

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  300 bits (768), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 174/496 (35%), Positives = 277/496 (55%), Gaps = 18/496 (3%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           +K  LK RH                     L  AGP   +I +   G+++YS+  ++ EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV- 177
           A   P++  FT ++ RF+  SFG AN + Y   W +   LE+      + +W +      
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGF-R 236
            ++++FW+++V +N+F V+ YGE EF  ++IKV+ ++GF+I  L +VCG G TG     +
Sbjct: 209 GFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAK 268

Query: 237 YWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 296
           YW +PG    G  A     A+F G+ S  + AAF++ G+EL+GI   EA NPRK+VP A 
Sbjct: 269 YWHDPGAF-VGATAG----AQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAA 323

Query: 297 KKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHIFNA 355
           K+V +RIL FYI SL FIGLLVP ND +L  S +   AASPF+I+I   G   LP + N 
Sbjct: 324 KQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINV 383

Query: 356 VILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYME 415
           VIL  ++S  NS +Y  SR +  L++    P+++S  +++G P V +  +  FG +A++ 
Sbjct: 384 VILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVA 443

Query: 416 TSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAY 475
            S      FNWLL I+G++ FF+W  I + H+RF  AL+ +  S D+LPF +      +Y
Sbjct: 444 QSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSY 503

Query: 476 YAIFFMTLIIIIQGFTSFCPSFD---GIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKI- 531
           + +F + L++  Q + +  P  D     +F +AY+S  + + ++I  +LW +    WKI 
Sbjct: 504 WGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKN---WKIF 560

Query: 532 ---EDVDIDTDRRDIE 544
                +D+DT R+ ++
Sbjct: 561 IPLGQLDLDTGRKQLD 576

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  299 bits (766), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 170/496 (34%), Positives = 281/496 (56%), Gaps = 12/496 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           ++ ++R+LK RH                     L  AGP G LI +  M T++  +  SL
Sbjct: 81  QSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSL 140

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           GEMA   PV+  +T ++ RF+  S+G AN   Y     +   LE+      + +W     
Sbjct: 141 GEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQ 200

Query: 176 I-VAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP-V 233
              A++++FW+ +V++NMF V+ YGE EF  + IKV+ ++GF+I  + +VCG G T   +
Sbjct: 201 YRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYI 260

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G ++W NPG         +    KF G  S  + AAF++  TELVG+ A E  +PRKSVP
Sbjct: 261 GSKFWSNPGAF-----VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVP 315

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHI 352
           +A K+V +RI  FYI SL  +GLLVPY DP+L  S     AASPF+++++N G   LP +
Sbjct: 316 KAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSV 375

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            N VIL+ ++S  NS+V+  SR +  LS+    P +    ++ G P VS+IF+  FG L 
Sbjct: 376 INVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLC 435

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S   +  F+W+L+++G++  F WL IS+ H+RF +AL  +  S D+L F +     
Sbjct: 436 FLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIW 495

Query: 473 LAYYAIFFMTLIIIIQGFTSFCPSFD---GIDFLAAYISCFLFIAIWIVFQLWFRC-RLI 528
            +YY++F + +++I+Q + +  P        +F  AY+S  + +A+++  +++ +  +L+
Sbjct: 496 GSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKLL 555

Query: 529 WKIEDVDIDTDRRDIE 544
              + +DIDT RR+++
Sbjct: 556 IDPKYMDIDTGRRELD 571

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  299 bits (766), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 172/501 (34%), Positives = 276/501 (55%), Gaps = 19/501 (3%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
            ++++ ++L  RH                     L   GP   ++A++ + T ++++  +
Sbjct: 84  NDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNA 143

Query: 115 LGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           LGE+A   PV   F V+  RF+ PSFG A    Y   WA+   LEL      I++W + +
Sbjct: 144 LGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNNTI 203

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP-V 233
              AW++IF+  +   NM  V+ +GE EF ++ IK+LAI+GF I  + + CG G +G  +
Sbjct: 204 NSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYI 263

Query: 234 GFRYWRNPGPM---GPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           G RYW +PG      PG         +F G  +  + AAF+Y GTELV ++A E+ NPR 
Sbjct: 264 GGRYWNDPGAFVGDTPG--------RRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRV 315

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPI 348
           ++P+A K+  + I   YI  L  IG LVPYND +L + +S V  AASP +I+I+N G   
Sbjct: 316 TLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKG 375

Query: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLF 408
           LP + NA+IL  I+S ANS VY  SR M  +++    P+ L+  +K G P  ++  T +F
Sbjct: 376 LPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIF 435

Query: 409 GALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAK 468
           G L+++  S   E  F WL  ++G++  F W  I++SH+RF QA++ +  S ++LPF + 
Sbjct: 436 GLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSI 495

Query: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCP-SFDGID---FLAAYISCFLFIAIWIVFQLWFR 524
                ++Y    + L++I   +TS  P   DG D   F   Y+S  +FI  ++  +++ +
Sbjct: 496 TGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKK 555

Query: 525 C-RLIWKIEDVDIDTDRRDIE 544
             RL  K +D+D+DT RR+I+
Sbjct: 556 DWRLYVKTKDMDLDTGRREID 576

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  300 bits (767), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 178/496 (35%), Positives = 273/496 (55%), Gaps = 12/496 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +A +K  LK RH                     L  AGP G +I +    T++Y +  +L
Sbjct: 92  KAPLKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMAL 151

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           GE+A   PV+  FT ++ RF+  SFG A+ + Y   W  T  LE+      + +W +   
Sbjct: 152 GELAVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPER 211

Query: 176 IV-AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
               ++++FW+++V +N+F VR +GE EF  ++IKVL ++GF+I  + +V G G  G   
Sbjct: 212 YRDGFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFV 271

Query: 235 F-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
             RYW NPG      +  N    +F G  S  + AAF++ G+ELVGITA EAANPRKSVP
Sbjct: 272 GGRYWHNPG----AFVGDNAG-TQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVP 326

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVA-ASPFIISIQNSGTPILPHI 352
           RA K+VV+RI+ FY+GSL  IGLLVPY DP+L    S  A ASPF+I+I   G   LP +
Sbjct: 327 RAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSV 386

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            N VIL  ++S  NS ++ GSR +  LS+    P I    ++ G P V +I    FG +A
Sbjct: 387 INVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIA 446

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S      F WL+ ++G++  F+W  I + H+RF  AL+ +G S ++LPF +     
Sbjct: 447 FIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGII 506

Query: 473 LAYYAIFFMTLIIIIQGFTSFCPSFDGID---FLAAYISCFLFIAIWIVFQLWFRC-RLI 528
            + + +F + L+ I Q + +  P         F  +Y+S  + +A +   +++ +  +L 
Sbjct: 507 GSSWGLFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIYKKNWKLF 566

Query: 529 WKIEDVDIDTDRRDIE 544
            K ED+DIDT RR+ +
Sbjct: 567 IKAEDMDIDTGRRETD 582

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  298 bits (764), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 174/501 (34%), Positives = 275/501 (54%), Gaps = 21/501 (4%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
             E+K+ LK RH                     L N GP G  I+YL + T VY +  +L
Sbjct: 93  NGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNAL 152

Query: 116 GEMATFIPVTSSFTVFS-----QRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           GEM  F+P   S +  S      +++ PS G A  + Y++ + I  A E+S    +I++W
Sbjct: 153 GEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEYW 212

Query: 171 TSA--VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
             A  VP  AWI+IF  L+V +N  PV  YGE EFW ASIK+L I G +I    +  G G
Sbjct: 213 AWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWGGG 272

Query: 229 --VTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGEA 285
               G +GFRYW+NPG     I         FL   + +I   F+   G ELV +T+ E 
Sbjct: 273 PKSDGILGFRYWKNPGSFAHHITGGG--GGNFLDIYTGIIKGGFSVILGPELVCLTSSEC 330

Query: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDP----KLTSDDSYVAASPFIISI 341
           A+ R+++ +A K+ V+R++FFYI     IG++V YNDP     L    +   +SPF+I I
Sbjct: 331 ADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIGI 390

Query: 342 QNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVS 401
           QN+G   +PHI N  IL++  SA N+ ++  SR +  ++++  AP+I  R N+ GVP+ +
Sbjct: 391 QNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYTA 450

Query: 402 VIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRD 461
           V  + L   LAY+  S+     FNW  NI+ ++GF  W+   ++++RF +A+ Y  ++  
Sbjct: 451 VGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYNKLTH- 509

Query: 462 DLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYISCFLFIAIWIVFQ 520
            +PF+AK      +Y++F+++LI +  G+  F P +++  DF+AAYI+  +FI +WI  +
Sbjct: 510 RIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGHK 569

Query: 521 LWFRCRL---IWKIEDVDIDT 538
           ++ R  L   +  I+ +D+ T
Sbjct: 570 VFTRTLLKAWLRPIDKIDVYT 590

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  297 bits (761), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 178/498 (35%), Positives = 276/498 (55%), Gaps = 16/498 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +  +K  LK RH                     L   GP   LI +   GT++YS+  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMAL 142

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW-TSAV 174
           GE+A   P++  FT ++ RF+  SFG AN + Y   W +   LE+      + FW T   
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
               ++++FW+++V +NMF V+ YGE EF  + IKV+ ++GF+I  + + CG G  G   
Sbjct: 203 YRDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 235 F-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
             +YW +PG       A +   AKF G  S  + +AF++ G+ELVG+ A E+ +PRKSVP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVP 317

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPHI 352
           +A K+V +RI  FYI SL  +GLLVPYNDP L    S   AASPF+I+I+  G   LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTV 377

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            N VIL  ++S  NS +Y  SR M  L++ +  P+I +  ++ G P V +  T  FG +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIA 437

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S      FNWLL ++G++  F+W  I I H+RF +AL  +G   D+L FK+     
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 473 LAYYAIFFMTLIIIIQGFTSF-----CPSFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
            +Y+ +F + ++ I Q + +       PS +G  F  AY+S  L +A+++  +++ R  +
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGASPSAEG--FFEAYLSFPLVVAMYLGHKIYKRNWK 555

Query: 527 LIWKIEDVDIDTDRRDIE 544
           L    ED+DIDT RR+++
Sbjct: 556 LFIPAEDMDIDTGRREVD 573

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  297 bits (761), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 172/529 (32%), Positives = 285/529 (53%), Gaps = 23/529 (4%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           + QI E ++K+ ++ RH                     L++AGP G +I Y  M T +Y 
Sbjct: 92  DNQINE-KLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYC 150

Query: 111 VTQSLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
           V Q++GEMA  ++ +   F+ +    + P    A  ++Y   W     LEL      IQ+
Sbjct: 151 VMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQY 210

Query: 170 WTSAVPIVAWISIFWVLLVAMNMFP-VRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-A 227
           WT+ V    ++ IF++L++ +N+F   R Y E EF+    K+L + GF I  + ++CG A
Sbjct: 211 WTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGA 270

Query: 228 GVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
           G +G +G RYW +PG          +N  +F G VS+L+ AAF + GTE + ITA E AN
Sbjct: 271 GNSGFIGARYWHSPGAFRGD---NGIN--RFKGIVSTLVTAAFAFGGTEFLAITASEQAN 325

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGT 346
           PRK++P A KKV++R L  Y+GS+  +G LVPYN  +L  S      ASP++I++ + G 
Sbjct: 326 PRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAVASHGI 385

Query: 347 PILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTG 406
            ++PH  NAVIL ++ S A+S  Y  SR++  L++   AP+I +  +K G P +  +   
Sbjct: 386 RVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGA 445

Query: 407 LFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFK 466
           +   +++   S+     FNWLL+I+G++  F+W  IS+SH+RF +A++ +G S D++ FK
Sbjct: 446 IIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFK 505

Query: 467 AKFMPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLW 522
           ++     + YA   M L++I Q +    P    S D + F  AY++  +FI ++  +++W
Sbjct: 506 SQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKIW 565

Query: 523 FRC-RLIWKIEDVDIDTDR--------RDIEEVVWEDPPPVTFWDKFWN 562
            R  RL  + +++D+   R        R   + + E       W K +N
Sbjct: 566 NRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNAPLWRKIYN 614

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  296 bits (757), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 180/494 (36%), Positives = 277/494 (56%), Gaps = 12/494 (2%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           +K  LK RH                     L  AGP G LI +   GT++YS+  ++GE+
Sbjct: 87  LKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGEL 146

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW-TSAVPIV 177
           A   PV+  FT ++ RF+  SFG A  + Y   W IT  LE+      + +W   A    
Sbjct: 147 AVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRD 206

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGF-R 236
            ++++FWV  V +N+F V+ YGE EF  A IKV+ I+GF+I  + ++CG G  G     +
Sbjct: 207 GFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGAK 266

Query: 237 YWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 296
           YW +PG         +    KF G+ +  I A+F++ G+E+VG+   E+ NPRKSVP A 
Sbjct: 267 YWHHPGAF-----VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPGAA 321

Query: 297 KKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPHIFNA 355
           K+V +RI  FY+  L  IG+LVPYND +L    S   AASPF+I++ N G   LP + N 
Sbjct: 322 KQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVVNQGIRGLPSVINV 381

Query: 356 VILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYME 415
           VIL +++S  NS++Y+ SR +  L++    P+I++  ++NG P V++     FG +A++ 
Sbjct: 382 VILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIAFVA 441

Query: 416 TSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAY 475
            S+     FNWLL ++G++  FSW  I I H+RF +AL  +G S D+LPF +      +Y
Sbjct: 442 ESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIAGSY 501

Query: 476 YAIFFMTLIIIIQGFTSFCP---SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIWKI 531
           + IF   L++I Q +    P   S +  DF  AY+S  + +A +I  ++W +  +L  K 
Sbjct: 502 WGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYIFHKIWKKNWKLYIKA 561

Query: 532 EDVDIDTDRRDIEE 545
           ED+DIDT RR+++ 
Sbjct: 562 EDMDIDTGRREVDR 575

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  295 bits (755), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 174/549 (31%), Positives = 285/549 (51%), Gaps = 20/549 (3%)

Query: 4   KQEEPLKNGKIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIREAEVKREL 63
           + E+ +  GK  S+   L D  L +  N +                +N  +    + + L
Sbjct: 22  EDEKSILEGK-SSTQSSLLDLTLKKCDNGIEVVNDATSTV------SNASVTNVNLNKNL 74

Query: 64  KQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIP 123
             RH                     L + GP   +I ++ + T +++V  +LGEMA   P
Sbjct: 75  SIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGEMAAAFP 134

Query: 124 VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIF 183
           V   F V+  RF+ PS G A    Y   W +   LEL      I++W   +   AW++IF
Sbjct: 135 VVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNDTINSDAWVAIF 194

Query: 184 WVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGF-RYWRNPG 242
           + ++   NM  V+ +GE EF ++ +K+LAI+GF I  + + CG G  G     +YW NPG
Sbjct: 195 YAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLGGKYWHNPG 254

Query: 243 PMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFR 302
                    + +  KF G  S  + AAF+Y G E+  ++A E+ +PR+++P+A K+  + 
Sbjct: 255 SF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKRTFWL 309

Query: 303 ILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPILPHIFNAVILST 360
           I   YI  L  IG LVPY++P+L S  S V  A+SP +I+I+N G   LP + NA+IL +
Sbjct: 310 ITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIS 369

Query: 361 IISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGG 420
           IIS ANS VY  SR M  ++     P++L   +K G P  +++FT  FG L+++  S   
Sbjct: 370 IISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAASDKQ 429

Query: 421 EAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFF 480
              F WL  ++G++  F W+ I+ISH+RF QA++ +  S D+LP+ ++     ++Y +  
Sbjct: 430 AEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWYGVIV 489

Query: 481 MTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRCR-LIWKIEDVD 535
           + L++I+  +TS  P      D   F   Y+S  + IA ++  +L +R + ++  +ED+D
Sbjct: 490 LFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKKQIVVALEDMD 549

Query: 536 IDTDRRDIE 544
           IDT RR ++
Sbjct: 550 IDTGRRQVD 558

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  294 bits (752), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 179/508 (35%), Positives = 278/508 (54%), Gaps = 25/508 (4%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           N   R   + R+L  RH                     L   GP   +IA+  + T +++
Sbjct: 63  NTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFT 122

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           +  +LGE+A   PV   F V+  R + PS G A    Y   WA+   LEL      I++W
Sbjct: 123 IVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYW 182

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG-V 229
            ++V   AW+++F+V +   ++  V+ +GE EF ++ +K+LAI GF I  + ++CG G  
Sbjct: 183 NNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPK 242

Query: 230 TGPVGFRYWRNPGPM---GPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAA 286
            G +G +YW +PG      PG        ++F G  S  + AAF+Y GTELVG++A E+A
Sbjct: 243 NGYIGAKYWNDPGSFVGASPG--------SQFKGLCSVFVTAAFSYSGTELVGVSAAESA 294

Query: 287 NPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNS 344
           NPR ++P+A K+  + I   Y+  L  IG LV ++DPKL S  S V  AASP +I+I+N 
Sbjct: 295 NPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENG 354

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G   LP + NA+IL  IIS ANS+VY  SR M  +++    PRI +  +  G P V++IF
Sbjct: 355 GIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIF 414

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           T +FG L+++  S   E  F WL  ++G++  F WL I+ISH+RF +AL  +G S D+LP
Sbjct: 415 TLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELP 474

Query: 465 FKAKFMPGL--AYYAIFFMTLIIIIQGFTSFCPS-FDGID---FLAAYISCFLFIAIWIV 518
           + +  M G+  ++Y    + L++I   +TS  P+   G D   F   Y+S  +F+  ++ 
Sbjct: 475 YLS--MTGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVG 532

Query: 519 FQLWFRCRLIWKIED--VDIDTDRRDIE 544
            +L+ R    W I    +D++T RR I+
Sbjct: 533 HKLYKR-NWSWMIRSNKIDVNTGRRMID 559

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  291 bits (746), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 153/492 (31%), Positives = 268/492 (54%), Gaps = 6/492 (1%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G   EA + REL                         L   GP+   +AYLF G+++  
Sbjct: 25  GGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISIFLAYLFTGSILAV 84

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           V  SL EMA F P+   F+ +  +++ P+FG A G+ Y+  +AI  +  L+  G +I +W
Sbjct: 85  VIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW 144

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
              + +  W+++ +     +N   VR++G+ E ++   K+  ++   I CL + CG G  
Sbjct: 145 RPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIVCLVITCGGGPD 204

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              +GFRYWR  G + P ++  N    KFLGW + +I + F + G+E++GI  GE ANPR
Sbjct: 205 HTTIGFRYWRESGFL-PYLVKGN--TGKFLGWWACVIQSIFGFMGSEMIGIIYGETANPR 261

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLV-PYNDPKLTSDDSYVAASPFIISIQNSGTPI 348
           K++P+A + V+ RI  FYI  +F +GL V P+N   + +  +   ASPF+I+I  SG  +
Sbjct: 262 KTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHSTDANASPFVIAISTSGIKV 321

Query: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLF 408
           LP   NA +L  I S+A +++Y+ SR ++GL+K   AP+I  R NK+ +P V  +   L 
Sbjct: 322 LPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKHKIPMVGCVVGSLL 381

Query: 409 GALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAK 468
           G LAYM T       F ++ +   V G  +W +I ++++ + + ++  G+  D++PF+  
Sbjct: 382 GFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKSHGVRLDEIPFRMP 441

Query: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLI 528
           F P  AY A+FF+++I    G+++F   F+   F+ +YI  F  + + + ++L+++ + +
Sbjct: 442 FQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSYIGIFANVLLVLGYKLYYKTKWV 501

Query: 529 WKIEDVDIDTDR 540
            K E++  +  +
Sbjct: 502 -KPEEITFEKKQ 512

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  293 bits (749), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 179/502 (35%), Positives = 287/502 (57%), Gaps = 9/502 (1%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+  +  +K++LK RH                     L  AGPV  LI+Y F+G LV+ 
Sbjct: 54  DGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFF 113

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           V   +GEMA +IP+   FT ++ R+  P+ G A GY Y   + I    +L+    +IQ+W
Sbjct: 114 VMSCIGEMAAYIPL-DGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYW 172

Query: 171 --TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYC-LCMVCGA 227
                V    WI+I  V++V +N F V+F+GEFEFW++S KV+ ++G +I   + M+ G 
Sbjct: 173 IPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGT 232

Query: 228 GVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
                +GFRYW++PG       + + +  +F+ +VS  +   F Y G EL GI A EA N
Sbjct: 233 PTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAEN 292

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL---TSDDSYVAASPFIISIQNS 344
           PRK++P+AIK  ++RI+ FYI ++F +G+ V  NDP L    +  +  AASPF+++I NS
Sbjct: 293 PRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNS 352

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G   LPHIFNA +L  + SA NS++YV SR ++ L+    AP+I ++TN+ G+P+ S+  
Sbjct: 353 GIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGV 412

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
             LF  LAYM  S+G    FN+ +N+  + G  +W+ I I+++ F +A+  +GI +    
Sbjct: 413 AVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFA 472

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWF 523
           + A   P  AY+++FF  L+ +I+ FT F    FD  +F+  YI   LF   +  ++   
Sbjct: 473 YVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVK 532

Query: 524 RCRLIWKIEDVDIDTDRRDIEE 545
           + + I K E+VD+ + +  I++
Sbjct: 533 KTK-IRKPEEVDLFSFKAAIDQ 553

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  293 bits (749), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 188/571 (32%), Positives = 289/571 (50%), Gaps = 36/571 (6%)

Query: 2   DKK-----QEEPLKNGKIKSSSYEL------DDYPLHRRTNSVHXXXXXXXXXXXXXXXA 50
           DKK     QEEPL+   +  SSYE       D  P    ++                   
Sbjct: 5   DKKNFVYAQEEPLEGRDVGHSSYETGSGEITDSKP---TSSGSRWQDFVDGFKRVELGDL 61

Query: 51  NGQIREAE----------VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIA 100
           +  + +AE          ++R LK RH                     L   GP   LI 
Sbjct: 62  DPNLTQAEKVAIATARSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIG 121

Query: 101 YLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALEL 160
           +  +G ++YSV  ++GE+A   PV   FT +  RF+  SFG A  Y+Y   W +   LE+
Sbjct: 122 WGLIGLMIYSVVMAMGELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEI 181

Query: 161 SVVGQIIQFW-TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIY 219
                 + +W T A     ++++F+V++V +NMF V+ YGE EF  + IKV  ++GF+I 
Sbjct: 182 VAASITVNYWGTPAKYRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIIL 241

Query: 220 CLCMVCGAGVTGPVGF-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELV 278
            + ++CG G  G     +YW NPG         N  + +F    S  + AAF++ GTELV
Sbjct: 242 GIVLICGGGPVGGYVGGKYWHNPGAFN----GDNAGQ-RFKAVCSVFVTAAFSFAGTELV 296

Query: 279 GITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPF 337
           G+ A E  NPRK++PRA K+V +RI  FYI SL  IGLLVPY    L    S   AASPF
Sbjct: 297 GLAAAETENPRKALPRAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPF 356

Query: 338 IISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGV 397
           +++I+  G   LP + N VIL +++S  NS+VY  SR +  L+     P+I S  ++ G 
Sbjct: 357 VLAIKTHGISGLPSVINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGR 416

Query: 398 PWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRG 457
           P V ++ T  FG L ++  S      FNWL+ ++G++  F+W FI I H+RF +AL  +G
Sbjct: 417 PLVGILATCTFGLLCFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQG 476

Query: 458 ISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP---SFDGIDFLAAYISCFLFIA 514
            S D+L F +      +Y+ +  + L+ I Q + +  P   + +  DF  AY+S  + + 
Sbjct: 477 RSTDELAFTSYVGVWGSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLF 536

Query: 515 IWIVFQLWFRC-RLIWKIEDVDIDTDRRDIE 544
            ++  +L+ R      + +D+DIDT RR+++
Sbjct: 537 FYLAHKLYTRNWTFAKRAKDIDIDTGRRELD 567

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  292 bits (748), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 168/514 (32%), Positives = 280/514 (54%), Gaps = 23/514 (4%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           N   R+ ++K+ L  RH                     L   GP G + +YL + T+VY 
Sbjct: 94  NEDGRKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYP 153

Query: 111 VTQSLGEMATFIPVTSSFTVFS-----QRFLSPSFGAANGYMYWFSWAITFALELSVVGQ 165
           +   LGEM  ++P   S +  S     +R+L  S   A G+ Y++ + +  A E +    
Sbjct: 154 IMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASG 213

Query: 166 IIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVC 225
           ++++WT  VP  AWI +F +++  +NM PVR YGE EFW A  K+L I+G +I    +  
Sbjct: 214 VVEYWTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFILFW 273

Query: 226 GAGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAG 283
           G G     +GFRYW  PG     I   N +   FL     +I  AF++  G ELV + + 
Sbjct: 274 GGGPNHDRLGFRYWITPGSFANTI--TNGSFGNFLDVYKGIILGAFSFILGPELVVLPSS 331

Query: 284 EAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTS----DDSYVAASPFII 339
           E ++PR+++ +A K+ ++R++FFYI     I ++V YNDP L++    D     +SPF+I
Sbjct: 332 ECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSPFVI 391

Query: 340 SIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPW 399
            IQN+G  +LPHI N  IL +  S+ N+ ++  SR +  ++ +  AP+ L + N+ GVP+
Sbjct: 392 GIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFGVPY 451

Query: 400 VSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGIS 459
           V+VI + +   +AY+  S      F W  N++ ++GF  W+ +S++++RF +A+EY G+ 
Sbjct: 452 VAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYHGM- 510

Query: 460 RDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYISCFLFIAIWI- 517
           +D LP+     P L  Y++    +I I  GF    P +++  DF+AAY++  +F+ IWI 
Sbjct: 511 KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMIWIG 570

Query: 518 ------VFQLWFR-CRLIWKIEDVDIDTDRRDIE 544
                  F+++ R CR  +++ED+D+ T   +IE
Sbjct: 571 HKFYKYRFKIFTRQCRWWYQVEDIDVITGLEEIE 604

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  291 bits (744), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 170/524 (32%), Positives = 280/524 (53%), Gaps = 21/524 (4%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +++++ ++L  RH                     L+  GP   +IA+  + T ++++  S
Sbjct: 60  KDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNS 119

Query: 115 LGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           LGE++   PV   F V+  RF+ PSFG A  + Y   WAI   LEL      I++W  ++
Sbjct: 120 LGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNKSI 179

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVC-GAGVTGPV 233
              AW+SIF+V +   NM  V+ +GE EF ++ +K+LAI+GF I  + ++C G    G +
Sbjct: 180 NPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFI 239

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G +YW +PG       A+     +F G  +  I AAF+Y G ELVG++A E+ NPR ++P
Sbjct: 240 GGKYWNDPGAFVGDTPAQ-----RFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLP 294

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPILPH 351
           +A K+  + I   Y+  L  IG LVP NDP L +  S V  AASP +I+IQN G   LP 
Sbjct: 295 KAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPS 354

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
           + NA+IL  ++S ANS VY  SR +  +++    PR L+  +K G P  ++  T L G L
Sbjct: 355 LMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLL 414

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           +++  S   +  F WL  ++G++  F W  I+++H+RF  A++++  S ++LP+ +    
Sbjct: 415 SFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGE 474

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCPS----FDGIDFLAAYISCFLFIAIWIVFQLWFR-CR 526
             ++Y    + L++I   +TS  P+     D   F  +Y+S  +FIA ++  ++W R  R
Sbjct: 475 WGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWKRNLR 534

Query: 527 LIWKIEDVDIDTDRRDIEEVVWEDPPPVT--------FWDKFWN 562
           L  K+ +VD+D+ R D +    +              F+ + WN
Sbjct: 535 LYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIRLWN 578

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  292 bits (747), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 172/536 (32%), Positives = 291/536 (54%), Gaps = 27/536 (5%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
           A+G     ++K+ L+ RH                     L   GP G  I+Y+ +  ++Y
Sbjct: 96  ADGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIY 155

Query: 110 SVTQSLGEMATFIPVTSSFTVFSQ-----RFLSPSFGAANGYMYWFSWAITFALELSVVG 164
            +  +LGEM  F+P   S +  S      R++  S G A G+ Y++ + I  A E +   
Sbjct: 156 PIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAAS 215

Query: 165 QIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMV 224
            ++++WT+AVP   WI++F +++V +N   V+ YGE EFW ASIK+L I+G +I    + 
Sbjct: 216 GVVEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILF 275

Query: 225 CGAGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITA 282
            G G     +GFRYW++PG     +   +L    F    + +I  AF +  G ELV +T+
Sbjct: 276 WGGGPKHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTS 333

Query: 283 GEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDP----KLTSDDSYVAASPFI 338
            E A+ R+++ +A ++ V+R++FFY+     I ++VPYNDP     L        +SPF+
Sbjct: 334 AECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFV 393

Query: 339 ISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVP 398
           I IQN+G  +LPHI N  IL++  SAAN+ ++  +R +  ++++  AP+ L + N+ GVP
Sbjct: 394 IGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVP 453

Query: 399 WVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGI 458
           +V+V  + L   LAY+  S+     FNW  NI+ ++GF  W+   I+++RF +A+ Y G+
Sbjct: 454 YVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGL 513

Query: 459 SRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGI-DFLAAYISCFLFIAIWI 517
             D LPFK    P   ++++  +++I I  G+  F P +  + DF+AAY++  +F+ +W+
Sbjct: 514 -YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWL 572

Query: 518 VFQLWFRCRLIWKIEDVDIDTDR---------RDIEEVVWEDPPPVTFWDKFWNVV 564
             +L+ R    W +   +ID  R         R+IEE+     PP +  DKF + +
Sbjct: 573 GHKLYTRTWHQWWLPVSEIDVTRGLVEIEEKSREIEEL---RLPPTSIKDKFMDTL 625

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  292 bits (748), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 166/515 (32%), Positives = 278/515 (53%), Gaps = 20/515 (3%)

Query: 50  ANGQIR--EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTL 107
            NGQ++  E  +K+ +K RH                     L NAGP G +I Y  MG+ 
Sbjct: 131 GNGQMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSC 190

Query: 108 VYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQI 166
           +Y + Q+ GEMA  +  +   F  +    + P FG A  ++Y   W     LEL      
Sbjct: 191 IYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLT 250

Query: 167 IQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VC 225
           I++WT+ V   A++ IF+V+++ + +F  R Y E EF+    K+L I+GF I  + +   
Sbjct: 251 IKYWTTTVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAG 310

Query: 226 GAGVTGPVGFRYWRNPGPMGPGIIAKNLNE-AKFLGWVSSLINAAFTYQGTELVGITAGE 284
           GAG  G +G +YW +PG        +  N   +F G +++ ++AAF +  TE + +TA E
Sbjct: 311 GAGNDGYLGAKYWHDPGAF------RGTNGIQRFKGIMATFVSAAFAFGATEFIALTAAE 364

Query: 285 AANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQN 343
            +NPRK++P A KKV++R++  ++G++  +G LVP++ D  + +  S   ASP++++I  
Sbjct: 365 QSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISI 424

Query: 344 SGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVI 403
            G  ++PH  NAVIL ++ S ANS  Y  SR++ GL++   AP+     ++ G P+ ++ 
Sbjct: 425 HGVRVVPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMC 484

Query: 404 FTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDL 463
              LFG +A+   S   +  F WLL I+G++  F+W+ I +SH+RF +A+  +G S  ++
Sbjct: 485 CAALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEI 544

Query: 464 PFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIV 518
            FKA+     +YYA   M L +I Q + +  P       D   F   Y++  + IA +  
Sbjct: 545 GFKAQLGVYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFG 604

Query: 519 FQLWFRC-RLIWKIEDVDIDTDRR--DIEEVVWED 550
           ++LW R  RL  + +D+D+D+ R+  D E +  ED
Sbjct: 605 YKLWKRDWRLFIRAKDIDLDSYRQVFDEELLKQED 639

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  290 bits (742), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 175/509 (34%), Positives = 284/509 (55%), Gaps = 18/509 (3%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G+     +K++L+ RH                     L  AGP   LIAY  MG +V++
Sbjct: 51  DGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFT 110

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           V   LGEMA +IP+   FT ++ R+  P+ G A G+ Y F + +    +L+    +IQFW
Sbjct: 111 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFW 169

Query: 171 TSAVPIV--AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
             A  +    WI++   ++V +N   VRF+GEFEFW++S KVL ++  +I  L +  G G
Sbjct: 170 IPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGG 229

Query: 229 VTGP-VGFRYWRNPGPMGPGIIAKNLNE-----AKFLGWVSSLINAAFTYQGTELVGITA 282
            T   +GFRYW +PG       +K          KF+ ++S  + A F Y GTEL GI A
Sbjct: 230 PTHDRLGFRYWSDPGAFKE--YSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVA 287

Query: 283 GEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAAS---PFII 339
            E  +PR++VPRAIK  ++RI+ FY+ ++F +G+ V YNDP L    S   ++   P+++
Sbjct: 288 AECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVV 347

Query: 340 SIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPW 399
           +I+N+  P+LP++FNA +L+ + SA NS++YVGSR ++GL+    AP++ +RTNK GVP+
Sbjct: 348 AIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPY 407

Query: 400 VSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGIS 459
            ++    LF  LAYM  S     AF + +N+T + G  SW+ I I+++ F +A   +GI 
Sbjct: 408 NALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIP 467

Query: 460 RDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIV 518
           +  L + A   P   + A+ F   + +I+ F +F     D   F+  YI   ++I  +I 
Sbjct: 468 KSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIG 527

Query: 519 FQLWFRCRLIWKIEDVDIDTDRR--DIEE 545
           +++  + + I   ++VD+ T +   D+EE
Sbjct: 528 YKIVHKTKWI-PSKEVDLFTFKEAIDLEE 555

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  291 bits (745), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 165/513 (32%), Positives = 280/513 (54%), Gaps = 19/513 (3%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
           AN   +   +K+ ++ RH                     L +AGP G LI Y  MG+++Y
Sbjct: 107 ANTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILY 166

Query: 110 SVTQSLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQ 168
            + Q+ GEMA  +  +T  +  +    +   FG A  ++Y   W     LEL      I+
Sbjct: 167 CIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIK 226

Query: 169 FWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGA 227
           +WT++V    ++ IF+VL++ +N+F  R Y E EF+    K+L + GF I  + + V GA
Sbjct: 227 YWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGA 286

Query: 228 GVTGPVGFRYWRNPGPMGPGIIAKNLNEA--KFLGWVSSLINAAFTYQGTELVGITAGEA 285
           G  G +G +YW +PG       A N   A  +F G  ++L+ AAF + G+E + IT  E 
Sbjct: 287 GNDGFIGGKYWHDPG-------AFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQ 339

Query: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQNS 344
           +NPRK++P A K++++RILF ++ ++  +G LVPYN D  L S      ASP++I++ + 
Sbjct: 340 SNPRKAIPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASH 399

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G  ++PH  NAVIL +++S ANS+ Y  +R+   LS+   AP++ S  ++ G P +++  
Sbjct: 400 GVRVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGV 459

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           + LF  +A+   S   E  F WLL I+G++  F+W  I +SH+RF +A++ +G S  +L 
Sbjct: 460 SALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELG 519

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQ 520
           FK++     + YA   M LI+I Q + +  P      D   F   Y++  + IA+++ ++
Sbjct: 520 FKSQTGVWGSAYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYK 579

Query: 521 LWFRC-RLIWKIEDVDIDTDRR--DIEEVVWED 550
           +W +  +L  + + +D+D+ R+  D E +  ED
Sbjct: 580 VWHKDWKLFIRADKIDLDSHRQIFDEELIKQED 612

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  291 bits (746), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 162/507 (31%), Positives = 274/507 (54%), Gaps = 16/507 (3%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
            +  +K+ +K RH                     L NAGP G +I Y  MG+ +Y + Q+
Sbjct: 139 NQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQA 198

Query: 115 LGEMAT-FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
            GE+A  +  +   F  +    + P+ G +  ++Y   W     LEL      I++WT  
Sbjct: 199 CGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVK 258

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGP 232
           V    ++ IF+VL++ +N+F  + Y E +F+    K+L I+GF I  + + CG AG  G 
Sbjct: 259 VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGY 318

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +G RYW NPG         N    +F G V++ + AAF +  +E + +TA E +NPRK++
Sbjct: 319 IGSRYWHNPGAF-----RGNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 373

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPY-NDPKLTSDDSYVAASPFIISIQNSGTPILPH 351
           P A KK+++RILF ++GSL  +G LVPY +D  L +  S   ASP++I++ + G  ++PH
Sbjct: 374 PSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKASPYVIAVASHGVRVVPH 433

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
             NAVIL +++S AN   Y  SRI+  L+K   AP+     ++ G P V+++ + +FG +
Sbjct: 434 FINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGII 493

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           A+  +S   E  F WLL I+G++  F+W+ I +SH+RF +A++ +G S  ++ +K++   
Sbjct: 494 AFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGI 553

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC- 525
             + YAI  M L +I Q + +  P           F   Y++  + IA+++ +++W +  
Sbjct: 554 WGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFYKVWKKDW 613

Query: 526 RLIWKIEDVDIDTDRR--DIEEVVWED 550
            L    + +D+ TDR+  D E +  ED
Sbjct: 614 TLFIPADKIDLVTDRQIFDEELLKQED 640

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  290 bits (742), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 184/522 (35%), Positives = 277/522 (53%), Gaps = 20/522 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +  +K  LK RH                     L   GP   LI +   GT++Y++  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW-TSAV 174
           GE+A   P++  FT ++ RF+  SFG AN + Y   W +   LE+      + FW T   
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
               ++++FW+ +V +NMF V+ YGE EF  + IKV+ ++GF+I  + + CG G TG   
Sbjct: 203 YRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYI 262

Query: 235 F-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
             +YW +PG       A +   AKF G  S  + AAF++ G+ELVG+ A E+  PRKSVP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVP 317

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPHI 352
           +A K+V +RI  FYI SL  IGLLVPYND  L    S   AASPF+I+I+  G   LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSV 377

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            N VIL  ++S  NS +Y  SR M  L++ +  P I S  ++ G P V +  T  FG +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIA 437

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S      FNWLL ++G++  F+W  I I H+RF +AL  +G   D+L FK+     
Sbjct: 438 FVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVW 497

Query: 473 LAYYAIFFMTLIIIIQGFTSFCPSFD---GIDFLAAYISCFLFIAIWIVFQLWFRC-RLI 528
            +Y+ +F + ++ I Q + +  P  D      F  AY+S  L + ++I  +++ R  +L 
Sbjct: 498 GSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLF 557

Query: 529 WKIEDVDIDTDRRDI------EEVVWEDPPPVT--FWDKFWN 562
              E +DIDT RR++      +E+  E     T   W + WN
Sbjct: 558 IPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWN 599

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  290 bits (743), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 160/506 (31%), Positives = 273/506 (53%), Gaps = 15/506 (2%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +  E+K+ +K RH                     L NAGP G LI Y  MGT +Y + Q+
Sbjct: 102 KNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQA 161

Query: 115 LGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
            GE+A ++  ++  F V+    + P+FG +  ++Y   W     LEL      I++WT+ 
Sbjct: 162 AGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTT 221

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGAGVTGP 232
           V    ++ IF+VL++ +N F  R Y E EF+    K+L ++GF I  + +   GAG  G 
Sbjct: 222 VNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGY 281

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +G RYW  PG       A +     F G +++++ AAF +  TE + +TA E +NPRK++
Sbjct: 282 IGDRYWHTPGAF-----AGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAI 336

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPH 351
           P A KKV++RILF ++GS+  +G LVPY+  +L  S  S   ASP+++++   G  ++PH
Sbjct: 337 PSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVSTHGVKVVPH 396

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
             NAVIL +++S  NS  Y  SR+++ L++   AP+     ++ G P+ +++  G+F  +
Sbjct: 397 FINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAII 456

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           ++   S   E  F WLL I+G++  F+W  I +SH+RF +A+  +  S  ++ FKA+   
Sbjct: 457 SFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGV 516

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
             +YY  F + +I+I Q + +  P      D   F   Y++  + I  ++ +++W +   
Sbjct: 517 WGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKKDWS 576

Query: 527 LIWKIEDVDIDTDRR--DIEEVVWED 550
           L  +  ++D+D  R+  D E +  ED
Sbjct: 577 LFIRANNIDLDKHRQIFDEELLKQED 602

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  289 bits (739), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 164/506 (32%), Positives = 276/506 (54%), Gaps = 17/506 (3%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
            ++   ++L  RH                     LT  GP   +I ++ + T ++++  +
Sbjct: 66  EDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNA 125

Query: 115 LGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           LGE+++  PV   F V+  RF+ PSFG A    Y   WA+   LEL      I++W S +
Sbjct: 126 LGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNSTI 185

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVC-GAGVTGPV 233
              AW++IF+ ++   N+  V+ +GE EF ++ +K+LAI+GF I  + + C G    G +
Sbjct: 186 NSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYI 245

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G +YW NPG         N +  +F G  S  + AAF+Y GTEL+ ++A E+ NPR ++P
Sbjct: 246 GGKYWSNPGAF-----VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLP 300

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY--VAASPFIISIQNSGTPILPH 351
           +A K+  + I   YI  L  +G LVP +DP+L    S   VAASP +I+I+N G   LP 
Sbjct: 301 KACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPS 360

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
           + NA+IL  ++S ANS VY  SR M  +++    P+  S  ++ G P  +++ T +FG L
Sbjct: 361 LMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLL 420

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           +++  S   E  F WL  ++G++  F W  I++SH+RF   ++ RG S D+LPF +  M 
Sbjct: 421 SFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVS--MT 478

Query: 472 GL--AYYAIFFMTLIIIIQGFTSFCPSFDGI----DFLAAYISCFLFIAIWIVFQLWFRC 525
           G+  +YY    + +++++  +T+  PS +G+     F   Y+S  + +  +I  +L+ + 
Sbjct: 479 GVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKS 538

Query: 526 -RLIWKIEDVDIDTDRRDIEEVVWED 550
            RL+    ++DID+ RR ++  V +D
Sbjct: 539 WRLLTPTTEIDIDSGRRAVDIEVLKD 564

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  290 bits (741), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 167/508 (32%), Positives = 276/508 (54%), Gaps = 17/508 (3%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +   +K+ +K RH                     L + GP G+ I +L MG  VY V Q+
Sbjct: 86  KHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQA 145

Query: 115 LGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW--T 171
            GE+A  +  +   F  +    + P+ G A  ++Y   W   F LEL      I+FW  +
Sbjct: 146 AGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGS 205

Query: 172 SAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA-GVT 230
            +V    +++IF+VL++ +N F  R Y E EF+  S KVL ++GF I  + +  GA G +
Sbjct: 206 RSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTS 265

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           G +G +YWR+PG +G        +   F G V++L+NAAF+   +E V +TA E ANPRK
Sbjct: 266 GYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRK 320

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPIL 349
           S+P A KK++++I   ++GS+  IG LVP +  +L  S+DS +  SP++I+++  G  ++
Sbjct: 321 SIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVNVV 380

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P   NAVIL +++S  NS  Y  SR++  L++   AP+I    ++ G P +++I + LFG
Sbjct: 381 PSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFG 440

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            + ++  S   E  F WLL I+G++  F+W  I +SH+RF +AL  +G S D+L FKA+ 
Sbjct: 441 TICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQT 500

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
               +Y +   M L +I Q + S  P      D   F   Y++  +F+  +  +++W + 
Sbjct: 501 GIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWNKD 560

Query: 526 -RLIWKIEDVDIDTDRR--DIEEVVWED 550
            RL  + + +D+ + RR  D + +  ED
Sbjct: 561 WRLFIRADQIDLVSHRRIFDADVLKQED 588

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  290 bits (741), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 171/519 (32%), Positives = 282/519 (54%), Gaps = 14/519 (2%)

Query: 52  GQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSV 111
           G   + ++K+ +K RH                     L N GP G +I Y  MG+ +Y +
Sbjct: 89  GDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCI 148

Query: 112 TQSLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
            Q+ GE+A  +  ++  F  +    + P+ G +  ++Y   W     LEL      I++W
Sbjct: 149 IQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYW 208

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGV 229
           T++V    +++IF+VL +A+N+F  R Y E EF+  + KVL I GF I  + + CG AG 
Sbjct: 209 TTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGN 268

Query: 230 TGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
            G +G +YW +PG       + +     F G VS+L+ AAF +  TE + +TA E ANPR
Sbjct: 269 DGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPR 323

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPI 348
           KS+P A KKV++RI+  ++GS+  +G LVP+N  +L  S  S   ASP++I+I + G  +
Sbjct: 324 KSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKV 383

Query: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLF 408
           +PH  NAVIL +++S  NS  Y  SR++  L++   AP  L   ++ G P +++I + +F
Sbjct: 384 VPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAVF 443

Query: 409 GALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAK 468
           G ++++  S   E  F WLL I+G++  F+W  I +SH+RF +A++ +G S  +L FK++
Sbjct: 444 GLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQ 503

Query: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFR 524
                +YYA   M LI+I Q +T+  P      D   F   Y++  + IA++  +++W R
Sbjct: 504 VGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKR 563

Query: 525 C-RLIWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWN 562
              L      +D+ ++RR  +E V +      F +K  N
Sbjct: 564 DWTLYIPASKIDLISNRRIFDEDVLKQ-EDAEFREKLRN 601

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  289 bits (739), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 166/498 (33%), Positives = 276/498 (55%), Gaps = 13/498 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           E ++K+ +  RH                     L N GP G +I Y  MG+ +Y + Q+ 
Sbjct: 87  ETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAA 146

Query: 116 GEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GE+A ++  ++ +F  +    +  +FG +  ++Y   W     LEL      I++WT++V
Sbjct: 147 GELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSV 206

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPV 233
               +++IF+VL++ +NMF  R Y E EF+    KVL I+GF I  + + CG AG  G +
Sbjct: 207 NPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYI 266

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G RYW NPG        K ++   F G +S+++ AAF +  TE + +TA E ANPR+++P
Sbjct: 267 GGRYWNNPGAF---YGTKPIHH--FKGIISTMVTAAFAFGATEFIALTAAEQANPRRAIP 321

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHI 352
            A KKVV+RIL  ++  +  IG LVP+N P+L  S  S   ASP++I++ + G  ++PH 
Sbjct: 322 SAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAVASHGVRVVPHF 381

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            NAVIL +++S  NS  Y  SR++  L+    AP  L   +++G P  +++ + +FG ++
Sbjct: 382 INAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLIS 441

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S   E  F WLL I+G++  F+W+ I +SH+RF +AL  +G    +L +K++    
Sbjct: 442 FVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGVA 501

Query: 473 LAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RL 527
            +YYA F M  I+I Q + +  P      D   F   Y++  LF+ ++  F++W R  RL
Sbjct: 502 GSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFKIWKRDWRL 561

Query: 528 IWKIEDVDIDTDRRDIEE 545
              +E +D+D+ R+  +E
Sbjct: 562 YIPLEQIDLDSHRKTFDE 579

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  288 bits (738), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 171/494 (34%), Positives = 266/494 (53%), Gaps = 18/494 (3%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           +KR LK RH                     L   GP   +IA++  G++VYSV Q+LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV- 177
           A  +PV+ S+  +  RF+ PSFG A  Y Y     IT  LEL      + +W        
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYAD 208

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT--GPVGF 235
           A++++F++++V +N+F V+ YGE EF  + IKV AI+GF+I  + +VCG G +  G +G 
Sbjct: 209 AFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGA 268

Query: 236 RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 295
           RYW NPG    G          F G+ +  + +AF++ G+E+  + A E  NPRK +PRA
Sbjct: 269 RYWYNPGGFAHG----------FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRA 318

Query: 296 IKKVVFRILFFYIGSLFFIGLLVPYNDPKL-TSDDSYVAASPFIISIQNSGTPILPHIFN 354
            K+V +RI  FY+ SL  IG LVPY D  L  +     +ASPF+I+I  +G   LP + N
Sbjct: 319 AKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVN 378

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
            VIL  ++S  N  VY  SR +  L+     PR     ++ G P V ++   +FG L+++
Sbjct: 379 VVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFL 438

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             S+     F+W+L I+G+  FF W  I + H+RF +AL  +G S D+L +KA+     +
Sbjct: 439 SASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGS 498

Query: 475 YYAIFFMTLIIIIQGFTSFCP---SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIWK 530
            Y I  + +++  Q + +  P   S +   F +AY+S  + I  +   +L+ R    + K
Sbjct: 499 LYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRSWTFLIK 558

Query: 531 IEDVDIDTDRRDIE 544
             D+DIDT RR+++
Sbjct: 559 SSDIDIDTGRREMD 572

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  288 bits (737), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 169/500 (33%), Positives = 275/500 (55%), Gaps = 17/500 (3%)

Query: 57  AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLG 116
           A + R LK RH                     L  AGP G LI +    T++  +  SLG
Sbjct: 81  APLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLG 140

Query: 117 EMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW-TSAVP 175
           E+A   PV+  +  ++ RF+  S+G AN + Y     +   LE+      + +W T    
Sbjct: 141 ELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKY 200

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPV-G 234
            +A++++FWV++V++N+F VR +GE E   + IKV+ I+GF+I  + ++ G G    V G
Sbjct: 201 KLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIG 260

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
            +YW +PGP        N    KF G  S  + AAF++ G+EL+G+ A E   PRKS+P+
Sbjct: 261 GKYWNDPGPF-----VGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPK 315

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAA-SPFIISIQNSGTPILPHIF 353
           A K+V +RI  FYI SL  +GLLVP N+  L +     AA SPF+I++      +LP I 
Sbjct: 316 AAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSII 375

Query: 354 NAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAY 413
           N VIL+ +IS  NS+VY  SR M  L++    P+I    ++ G P  ++ FT LFG L +
Sbjct: 376 NVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCF 435

Query: 414 METSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGL 473
           +  +      F+WLL I+G++ FF+WL I+++H+RF  AL+ +G + ++L F +      
Sbjct: 436 VAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFIG 495

Query: 474 AYYAIFFMTLIIIIQGFTS-FCPSFDG-------IDFLAAYISCFLFIAIWIVFQLWFRC 525
           + YA+  + ++++ Q + + + PS DG       I F   Y+S  + I +++  ++W R 
Sbjct: 496 SCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRN 555

Query: 526 -RLIWKIEDVDIDTDRRDIE 544
            +   K +++DIDT RR+++
Sbjct: 556 WKFFIKAKEMDIDTGRRELD 575

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  288 bits (738), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 162/506 (32%), Positives = 278/506 (54%), Gaps = 15/506 (2%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +   +K+ ++ RH                     L +AGP G LI Y  MG+++Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQA 171

Query: 115 LGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
            GEMA  +  +T  +  +    +   FG A  ++Y   W     LEL      I++WT++
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGAGVTGP 232
           V    ++ IF+VL++ +N+F  R Y E EF+    K+L + GF I  + + V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGF 291

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +G +YW +PG           +  +F G V++L+ AAF + G+E + IT  E ANPRK+V
Sbjct: 292 IGGKYWHDPGAFN-----GKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAV 346

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPH 351
           P A K++++RILF ++ ++  +G LVPYN  +L  S      ASP++I++ + G  ++PH
Sbjct: 347 PGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPH 406

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
             NAVIL +++S ANS+ Y  +RI+  LS+   APR+ +  +K G P +++  + LFG +
Sbjct: 407 FINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVI 466

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           A+   S   +  F WLL I+G++  F+W  I +SH+RF +A++ +G S  +L F+++   
Sbjct: 467 AFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGV 526

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
             + YA   M LI+I Q + +  P      D   F   Y++  + IA+++ +++W +  +
Sbjct: 527 WGSTYACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWK 586

Query: 527 LIWKIEDVDIDTDRR--DIEEVVWED 550
           L  + + +D+ + R+  D E +  ED
Sbjct: 587 LFIRADKIDLISHRQIFDEELIKQED 612

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  287 bits (735), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 164/500 (32%), Positives = 267/500 (53%), Gaps = 13/500 (2%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            I    + ++L  RH                     LT  GP   +I ++ + T +++V 
Sbjct: 82  DINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVI 141

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
            SLGE+A   PV   F V+  RF+ PSF  A    Y   W +   LEL      I++W  
Sbjct: 142 NSLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWND 201

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
            +   AW++IF+  +   NM  V+ +GE EF ++ +K+LAI+GF I  + + CG G  G 
Sbjct: 202 KINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGG 261

Query: 233 VGF-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
               +YW NPG         +   ++F G  S  + AAF+Y G E+  ++A E+ NP+++
Sbjct: 262 YIGGKYWHNPGAF-----VGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKET 316

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPIL 349
           +P+A K+  + I   Y+G L  IG LVPYNDP+L +  S V  AASP +I+I+N G   L
Sbjct: 317 IPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGL 376

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P + NA+IL  I+S ANS VY  SR M  ++     P+ LS+ +K G P  +++ T  FG
Sbjct: 377 PSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFG 436

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            L+++  S   E  F WL  ++G++  F W+ I++S +RF  A++ +G S D++PF ++ 
Sbjct: 437 LLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQS 496

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
               A+Y +  + L+++   +TS  P    +     F   Y+S  + IA ++  +LW R 
Sbjct: 497 GTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRD 556

Query: 526 -RLIWKIEDVDIDTDRRDIE 544
            RL+  + ++D+D+ RR ++
Sbjct: 557 WRLLVPLMEMDLDSGRRVLD 576

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  286 bits (733), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 167/500 (33%), Positives = 265/500 (53%), Gaps = 13/500 (2%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            I    + + L  RH                     L + GP   +I ++ + T +++V 
Sbjct: 69  DINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVI 128

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
            +LGEMA   PV   F V+  RF+ PS G A    Y   W +   LEL      I++W  
Sbjct: 129 NALGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNE 188

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
            +   AW++IF+ ++   NM  V+ +GE EF ++ IK+LAI+GF I  + + CG G  G 
Sbjct: 189 TINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGG 248

Query: 233 VGF-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
               +YW +PG      +  N +  KF G  S  + AAF+Y G E+  ++A E+ +PR +
Sbjct: 249 FIGGKYWNHPGSF----VGHN-SGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTT 303

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPIL 349
           +P+A K+  + I   Y+  L  IG LVPY+DP+L S  S V  A+SP +I+I+N G   L
Sbjct: 304 IPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGL 363

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P + NA+IL +IIS ANS VY  SR M  ++     PRIL+R +  G P  ++IFT  FG
Sbjct: 364 PSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFG 423

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            L+++  S      F WL  ++G++  F W+ I++SH+RF Q++  +  S D+LPF ++ 
Sbjct: 424 LLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQT 483

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
               ++Y    + L+++   +TS  P    S D   F   Y+S  + +A +   +L+ R 
Sbjct: 484 GVWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRK 543

Query: 526 R-LIWKIEDVDIDTDRRDIE 544
           R  +  + D+D+DT RR ++
Sbjct: 544 REFMVGLADMDLDTGRRQVD 563

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  288 bits (736), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 162/496 (32%), Positives = 275/496 (55%), Gaps = 16/496 (3%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +  E+K  +K RH                     L N+GP G +I Y  MG+ +Y + Q+
Sbjct: 119 KSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQA 178

Query: 115 LGEMAT-FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
            GEMA  +  +   F  +    + P+ G +  ++Y   W     LEL      I++WT+ 
Sbjct: 179 TGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTK 238

Query: 174 VPIVAWISIFWVLLVAMNMFP-VRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTG 231
           V    ++ IF+VL++ +N+      Y E EF+  S K+L ++GF I  + ++CG AG  G
Sbjct: 239 VDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDG 298

Query: 232 PVGFRYWRNPGPM-GPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
            +G RYW +PG   G   I +      F G VS+L+NAAF +  +E++G+TA E +NPRK
Sbjct: 299 YIGGRYWHDPGAFRGEHAIDR------FKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRK 352

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQNSGTPIL 349
           ++P A KK+++RI+  Y+GS+  +G LVP+N D  L S    V ASP+++++   G  ++
Sbjct: 353 AIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVV 412

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           PH  NAVIL +++S ANS  Y  SR++ GL++   AP+I    ++ G P + +    L  
Sbjct: 413 PHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVN 472

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            +++  TS   +  F WLL I+G++  F+W  I +SH+RF +A+  +G S  ++ FK++ 
Sbjct: 473 VISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQC 532

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPSFDG-ID---FLAAYISCFLFIAIWIVFQLWFRC 525
               ++YA   M LI+I Q + +  P  +G +D   F   Y++  + IA++  ++++ + 
Sbjct: 533 GVWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKD 592

Query: 526 -RLIWKIEDVDIDTDR 540
            RL  + +D+D+D +R
Sbjct: 593 WRLFIRAKDIDLDINR 608

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  285 bits (728), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 168/513 (32%), Positives = 273/513 (53%), Gaps = 26/513 (5%)

Query: 51  NGQIREAE-----------VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALI 99
           NG++ E +           ++R  KQRH                     L   GP   LI
Sbjct: 27  NGEVYELDFQEAIGESSQTLQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLI 86

Query: 100 AYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALE 159
           A++F G+L+  V  SL EMA+F P+  SF+ ++ R++ P+ G A G+ Y+  +AI  A E
Sbjct: 87  AFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASE 146

Query: 160 LSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIY 219
           LS +G ++Q+W   + I  +I +F V+L+++N   ++FYGE EFW A +K L ++   + 
Sbjct: 147 LSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVT 206

Query: 220 CLCMVCGAGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELV 278
            L + CG G +   +GFRYWR    + P ++       +FLGW + +I + + Y G+E +
Sbjct: 207 GLVLTCGGGPSKETIGFRYWREYAFV-PYLVKGT--TGRFLGWWACVIQSCYAYIGSETI 263

Query: 279 GITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL-TSDDSYVAASPF 337
           G+  GEA NP+K++P A + V+FRI  FYI  +  +GL++  +D  L  +  S  + SPF
Sbjct: 264 GVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIISPHDKTLANAKTSDASGSPF 323

Query: 338 IISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGV 397
           +I+  N+G   LP   NA+++  I SAAN+ +YV SR  +GL+K  +AP+I    N+ GV
Sbjct: 324 VIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGV 383

Query: 398 PWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRG 457
           P+   +  GL   L++M  S      F +L +   V G  +WL + IS++ + +A  +  
Sbjct: 384 PFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHD 443

Query: 458 ISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWI 517
           + RD +PF+  F P  AY  +FF++LII   G+++F   F    F+ +YI   +FI    
Sbjct: 444 VPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIAGFKYKSFIVSYIGIAVFIG--- 500

Query: 518 VFQLWFRCRLIWKIEDVDIDTDRRDIEEVVWED 550
                    L WK       T   D+  ++ E+
Sbjct: 501 -------NTLFWKFWKKSAATRPEDLRSIMVEE 526

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  287 bits (734), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 170/514 (33%), Positives = 275/514 (53%), Gaps = 15/514 (2%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
            G+ +E  +K+ +K RH                     L +AGP G  I Y  MG+ +Y 
Sbjct: 117 EGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYC 176

Query: 111 VTQSLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
           + Q+ GEMA T+  +   F  +    +SP  G A  ++YW  WA    LEL      I++
Sbjct: 177 IIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKY 236

Query: 170 WTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AG 228
           WT+ V    ++ IF+ L++ +N+F  R Y E EF+    KVL I GF I  + + CG AG
Sbjct: 237 WTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAG 296

Query: 229 VTGPVGFRYWRNPGPM-GPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
             G +G +YW +PG   G   I +      F G  ++L+ AAF + G+E + +TA E +N
Sbjct: 297 NDGYIGGKYWHDPGAFRGDKAIDR------FKGVAATLVTAAFAFGGSEFIALTASEQSN 350

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQNSGT 346
           PRK++P A KK+++RI+  ++GS+  +G LVP+N D  + SD S   ASP++I+I + G 
Sbjct: 351 PRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGV 410

Query: 347 PILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTG 406
            ++PH  NAVIL +++S  NS  Y  SRI+  LS+   AP+  +  ++ G P  +++   
Sbjct: 411 RVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGA 470

Query: 407 LFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFK 466
           LF  +A+   S+  E  F WLL I+G++  F+W  I +SH+RF +A+  +G S  ++ FK
Sbjct: 471 LFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFK 530

Query: 467 AKFMPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLW 522
           ++     +YYA   M L++I Q +    P      D   F  +Y++  + IA ++ +  W
Sbjct: 531 SELGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFW 590

Query: 523 FRC-RLIWKIEDVDIDTDRRDIEEVVWEDPPPVT 555
            +   L  + +D+D+D  R+  +E V       T
Sbjct: 591 KKDWTLFIRAKDIDLDHHRQIFDEDVLRQEDEET 624

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  286 bits (731), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 168/491 (34%), Positives = 269/491 (54%), Gaps = 11/491 (2%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           ++  LK RH                     L  AGP G LI +   GT++YS+  +LGE+
Sbjct: 81  LQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMALGEL 140

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW-TSAVPIV 177
           A   PV+  FT ++ RF+  S+G AN   Y   W +   LE+      + +W T+     
Sbjct: 141 AVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGTNPRYRD 200

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG-VTGPVGFR 236
            ++++FW+ +  +N+F V+ YGE EF  + IKV+ ++GF+I  + + CG G V G +G R
Sbjct: 201 GFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYIGGR 260

Query: 237 YWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 296
           YW +P     G    +   A+F G  S  + AAF++ G+ELVG+ + E ANPRKSVP+A 
Sbjct: 261 YWHHP----YGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVPKAA 316

Query: 297 KKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPHIFNA 355
           K+V +RI  FY+ +L  +GLLVPY + +L    S   AASPF+I+I   G   LP + N 
Sbjct: 317 KQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPFVIAITTHGIRGLPSVVNV 376

Query: 356 VILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYME 415
           VIL  ++S  NS +Y  SR +  L++    P+     +++G P  S++ T  FG +A++ 
Sbjct: 377 VILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGLVAFVA 436

Query: 416 TSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAY 475
            S      FNWLL ++G++  F+W  I + H+RF +AL  +G   D+L F +      +Y
Sbjct: 437 QSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAGVYGSY 496

Query: 476 YAIFFMTLIIIIQGFTSFCP---SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIWKI 531
           + +F + L+ I Q + +  P     +   F  AY+S  + IA ++  +++ +  ++  K 
Sbjct: 497 WGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHKIYKKNWKIFIKA 556

Query: 532 EDVDIDTDRRD 542
           ED+DIDT R+D
Sbjct: 557 EDMDIDTGRKD 567

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  285 bits (729), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 160/508 (31%), Positives = 268/508 (52%), Gaps = 24/508 (4%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
            +K  L+ RH                     L N GP   +I+Y+ + T+VY +    GE
Sbjct: 55  NLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGE 114

Query: 118 MATFIPVTSS-------FTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
           M  ++P                 +++  S G A  + Y++ + +  A E +    I+++W
Sbjct: 115 MVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYW 174

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           TS +P    I +F  ++  +N  PV+FYGE EFW A IK+  I G +I    + CG    
Sbjct: 175 TSKIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPN 234

Query: 231 GP----VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGEA 285
                 VGF YW+NP      +   +L    FL   ++LI  AF +  G ELV +T+ E 
Sbjct: 235 NEDNSFVGFHYWKNPSSFRDYVTNGSL--GNFLDVYNALIKGAFAFILGPELVSLTSSEC 292

Query: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTS----DDSYVAASPFIISI 341
            + R+++ +A ++ V+R++FFYI     I ++VPYNDP L +    +     +SPF+I I
Sbjct: 293 VDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGI 352

Query: 342 QNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVS 401
           QN+G  ILPHI N  IL++ +SA N+ ++  +R +  + K+  APRI SR N++GVP+V+
Sbjct: 353 QNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVA 412

Query: 402 VIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRD 461
           +  + +   LA++  S      F W  NI+ ++GF  W    I+++RF + ++Y G+  D
Sbjct: 413 LSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YD 471

Query: 462 DLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSF-DGIDFLAAYISCFLFIAIW---I 517
            LPFK K    L +Y+  F+ ++I+  G+    P F +  DF+AAYI+  +F+ ++   I
Sbjct: 472 RLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHI 531

Query: 518 VFQLWFRCRLIWK-IEDVDIDTDRRDIE 544
           ++   +R R  WK ++++D+ T   +IE
Sbjct: 532 IYSGRWRQRKWWKPVDEIDVVTGLEEIE 559

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  285 bits (730), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 173/497 (34%), Positives = 273/497 (54%), Gaps = 14/497 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +A ++  LK R                      L   GP G +I +    T++YS+  +L
Sbjct: 100 KAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMAL 159

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           GE+A   PV   FT ++ RF+  SFG AN + Y   W +   LE+      + +W +   
Sbjct: 160 GELAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTR 219

Query: 176 IV-AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
               ++++FW+++V +NMF V+ +GE EF  + IKV  ++GF+I  + +VCG G  G   
Sbjct: 220 YRDGFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFV 279

Query: 235 F-RYWRNPGP-MGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
             +YW +PG  +G G      + A+F G  S  + AAF++ G+EL+GITA EAANPRKS+
Sbjct: 280 GAKYWHDPGAFVGHG------SGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSI 333

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPH 351
           P A K+VV+RI+ FY+G+L  IGLLVPYND +L    S   AASPF+I+I   G   LP 
Sbjct: 334 PGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASPFVIAIVTHGIKGLPS 393

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
           + N VIL  ++S  NS ++  SR +  LS     P++    +++G P V +  T  FG L
Sbjct: 394 VINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLL 453

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           A++  S      FNWLL ++G++  F+W  I + H+RF  AL+ +G   ++L F +    
Sbjct: 454 AFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGV 513

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCPSFDGID---FLAAYISCFLFIAIWIVFQLWFRC-RL 527
             +Y+ +F + L+ I Q + +  P     D   F  +Y+S  + +A +   +++ R  +L
Sbjct: 514 AGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHKIYKRNWKL 573

Query: 528 IWKIEDVDIDTDRRDIE 544
              +ED+DIDT RR+ +
Sbjct: 574 FIPLEDMDIDTGRRETD 590

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  283 bits (725), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 173/506 (34%), Positives = 282/506 (55%), Gaps = 27/506 (5%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           + +IRE+ + R L  RH                     L   GP    I Y  MG +VY 
Sbjct: 50  HDKIRES-LNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYL 108

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGEM+TF+P++ SF  ++++F   SF  A    YWF+ A++ A +L+ +  ++ +W
Sbjct: 109 TMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYW 168

Query: 171 TSA---VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA 227
            S+    P  A   +FWV L+ +N+  VR YGE E+W+A +KV+AI+ F I  + +  G 
Sbjct: 169 KSSQHNFPYWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGH 228

Query: 228 GVTGP-VGFRYWR-NPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEA 285
                 +GF+YW     P   G          F G+V+  +++AF+Y GTE + +TAGEA
Sbjct: 229 NPDHEYIGFKYWSYKEAPFVNG----------FKGFVTIFVSSAFSYGGTESITLTAGEA 278

Query: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSG 345
            NP ++ PR +K V +RIL FY+ ++FFI + +PY+ P L++    V  SPF I  Q +G
Sbjct: 279 RNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPNLSTKS--VMTSPFTIIFQMAG 336

Query: 346 TPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLA-PRILSRTNKNGVPWVSVIF 404
           T       NAVIL++I+SA N  ++ GSR+++ +       P+++++TN+   P+V+VI 
Sbjct: 337 TKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVIL 396

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           T   G L +  +  G    + WL NI GV+   +WL I+++ +RF + L  +G ++ +L 
Sbjct: 397 TWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQ-ELQ 455

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFR 524
           FK    P   Y+ + F+TLII++QG+++F P +   DF + Y+  F+F   W+++ ++ R
Sbjct: 456 FKNWTYPYGPYFLVIFVTLIILVQGWSAFDP-WSTSDFFSYYLELFVFPTCWLIWWIFKR 514

Query: 525 CRLIWKIEDVDIDTDR-----RDIEE 545
            R + K ED+D  TDR     ++IEE
Sbjct: 515 DRFV-KPEDMDFITDRYIQSPQEIEE 539

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  286 bits (731), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 161/506 (31%), Positives = 276/506 (54%), Gaps = 15/506 (2%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +   +K+ ++ RH                     L +AGP G LI Y  MG+++Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 115 LGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
            GEMA  +  +T  +  +    +   FG A  ++Y   W     LEL      I++WT++
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGAGVTGP 232
           V    ++ IF+VL++ +N+F  R Y E EF+    K+L + GF I  + + V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGY 291

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +G +YW  PG    G+ A +    +F G V++L+ AAF + G+E + IT  E +NPRK++
Sbjct: 292 IGGKYWHEPGAFN-GVHAID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQNSGTPILPH 351
           P A K++++RILF ++ ++  +G LVPYN D  L S      ASP++I+I + G  + PH
Sbjct: 347 PGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPH 406

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
             NAVIL +++S ANS+ Y  +R+   LS+   AP+I S  ++ G P +++  + LF  +
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVI 466

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           A+   S   +  F WLL I+G++  F+W  I +SH+RF +A++ +G S  +L FK++   
Sbjct: 467 AFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
             + Y+   M LI+I Q + +  P      D   F   Y++  + I +++ +++W +  +
Sbjct: 527 WGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDWK 586

Query: 527 LIWKIEDVDIDTDRR--DIEEVVWED 550
           L  + + +D+ + R+  D E +  ED
Sbjct: 587 LFIRADKIDLTSHRQIFDEELIKQED 612

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  285 bits (728), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 177/498 (35%), Positives = 279/498 (56%), Gaps = 16/498 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +  +K +LK RH                     L   GP   LI +  MGT++Y++  +L
Sbjct: 82  QTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMAL 141

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW-TSAV 174
           GE+A   P++  FT ++ RF+  SFG A  + Y   W +T  LE+      + +W T   
Sbjct: 142 GELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPK 201

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG-VTGPV 233
               ++++FW+++V +NMF V+ YGE EF  + IKV+ I+GF+I  + + CG G   G +
Sbjct: 202 YRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYI 261

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G +Y+ +PG       A +   AKF G  S  + AAF++ G+ELVG+ A E+ +PRKSVP
Sbjct: 262 GGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVP 316

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPHI 352
           +A K+V +RI  FYI SL  IGLLVPYND +L    S   AASPF+I+I   G   LP +
Sbjct: 317 KAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVIAIVTHGIKGLPSV 376

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            N VIL  ++S  NS ++  SR    L++    P+I +  ++ G P V +I T   G +A
Sbjct: 377 VNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIA 436

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S   E  FNWLL ++G++  F+W  I I H+RF +AL  +G S D+L FK+     
Sbjct: 437 FVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVW 496

Query: 473 LAYYAIFFMTLIIIIQGFTSF-----CPSFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
            +Y+ +F + ++ I Q + +       PS +G  F  AY+S  L +A++I  +++ R  +
Sbjct: 497 GSYWGLFMIVIMFIAQFYVALFPVNGSPSAEG--FFEAYLSFPLVLAMYIGHKIYKRNWK 554

Query: 527 LIWKIEDVDIDTDRRDIE 544
           L+    ++DID+ RR+++
Sbjct: 555 LLIPAGEMDIDSGRREVD 572

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  285 bits (730), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 160/506 (31%), Positives = 275/506 (54%), Gaps = 15/506 (2%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +   +K+ ++ RH                     L +AGP G LI Y  MG+++Y + Q+
Sbjct: 112 KSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 115 LGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
            GE+A  +  +T  +  +    +   FG A  ++Y   W     LEL      I++WT++
Sbjct: 172 CGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGAGVTGP 232
           V    ++ IF+VL++ +N+F  R Y E EF+    K+L + GF I  + + V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGF 291

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +G +YW +PG           +  +F G V++L+ AAF + G+E + IT  E +NPRK++
Sbjct: 292 IGGKYWHDPGAFN-----GKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQNSGTPILPH 351
           P A K++++RILF ++ ++  +G LVPYN D  L S      ASP++I+I + G  ++PH
Sbjct: 347 PGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPH 406

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
             NAVIL +++S ANS+ Y  +R+   LS+   AP+  S  ++ G P +++  + LF  +
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVI 466

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           A+   S   E  F WLL I+G++  F+W  I  SH+RF +A++ +G S  +L FK++   
Sbjct: 467 AFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
             + YA   M LI+I Q + +  P      D   F   Y++  + IA+++ +++W +  +
Sbjct: 527 WGSMYACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWK 586

Query: 527 LIWKIEDVDIDTDRR--DIEEVVWED 550
           L  + + +D+++ R+  D E +  ED
Sbjct: 587 LFIRADKIDLESHRQIFDEELIKQED 612

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  286 bits (731), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 162/519 (31%), Positives = 277/519 (53%), Gaps = 19/519 (3%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           ++  +K+ +K RH                     L NAGP G +I Y  MG+ VY + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 115 LGEMAT-FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
            GE+A  +  +   F  +    + P+ G +  +++   W     LEL      I++WT  
Sbjct: 201 CGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK 260

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGP 232
           V    ++ IF+VL++ +N+F  + Y E +F+    K+L I GF I  + + CG AG  G 
Sbjct: 261 VNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGY 320

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +G RYWR+PG         + +  +F G V++ + AAF +  +E + +TA E +NPRK++
Sbjct: 321 IGSRYWRDPGAF-----RGDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPY-NDPKLTSDDSYVAASPFIISIQNSGTPILPH 351
           P A KK+++RILF ++ SL  +G LVPY +D  L +  S   ASP++I++ + G  ++PH
Sbjct: 376 PSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
             NAVIL +++S ANS  Y  SRI+  L+K   AP+     ++ G P V++I + +FG +
Sbjct: 436 FINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVI 495

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           A+  +S   E  F WLL I+G++  F+W+ I +SH+RF + ++ +G S  ++ +K++   
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGV 555

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC- 525
             + YA+  M L +I Q + +  P           F   Y++  + IA++I +++W R  
Sbjct: 556 WGSAYAVVLMVLALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKRDW 615

Query: 526 RLIWKIEDVDIDTDRR--DIEEVVWEDPPPVTFWDKFWN 562
            L    + +D+ + R   D E +  ED     + D+  N
Sbjct: 616 SLFIPADKIDLVSHRNIFDEELLKQEDEE---YKDRLRN 651

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  283 bits (725), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 175/530 (33%), Positives = 283/530 (53%), Gaps = 23/530 (4%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
              ++K+ LK RH                     L   GP G   +YL + T +Y +  +
Sbjct: 66  ENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMNA 125

Query: 115 LGEMATFIPVTSSFTVFS-----QRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
            GEM  ++P   S +  S     ++++  S G A+ + Y++ + I  A E +    ++++
Sbjct: 126 FGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVEY 185

Query: 170 WTSA--VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA 227
           W  A  VP  AWI+IF   +VA+NM PV FYGE EFW ASIK+L I+G +I    +  G 
Sbjct: 186 WAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWGG 245

Query: 228 GVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGEA 285
           G +   +GFRYW+ PG     I   +     FL   + +I   F +  G ELV +T+ E 
Sbjct: 246 GPSHDRLGFRYWQRPGAFADHI--TDGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSEC 303

Query: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTS----DDSYVAASPFIISI 341
            + R+++ +A ++ V+R++ FY+     I ++V YNDP L +          +SPF+I I
Sbjct: 304 HDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIGI 363

Query: 342 QNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVS 401
           QN+G  +LPHI N  I+++  SA N+ ++  SR +  ++    AP+  S+ N+ GVP+V+
Sbjct: 364 QNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYVA 423

Query: 402 VIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRD 461
           V F+ LF  LAY+  S+     FNW  NI+ ++GF  W+   ++++RF +A+ +  +  D
Sbjct: 424 VGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL-YD 482

Query: 462 DLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSF-DGIDFLAAYISCFLFIAIWIVFQ 520
            LP+K      L +Y++F ++LI +  G+  F P F D  DF+AAYI+  +FI +WI  +
Sbjct: 483 RLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIGHK 542

Query: 521 LWFRCRLIWKI--EDVDIDTDRRDIEEVVWE----DPPPVTFWDKFWNVV 564
           L  R    W I  + +D+ T   +IEE+  E      PP   WDKF + +
Sbjct: 543 LVTRSWRQWYIPVDKIDVFTGLEEIEELTNELDEKRVPPNNAWDKFLDAL 592

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  285 bits (730), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 153/476 (32%), Positives = 261/476 (54%), Gaps = 13/476 (2%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           ++  +K+ +K RH                     L NAGP G +I Y  MG+ VY + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 115 LGEMAT-FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
            GE+A  +  +   F  +    + P+ G +  +++   W     LEL      I++WT  
Sbjct: 201 CGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK 260

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGP 232
           V    ++ IF+VL++ +N+F  + Y E +F+    K+L I+GF I  + + CG AG  G 
Sbjct: 261 VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGY 320

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +G +YWR+PG         +    +F G V++ + AAF +  +E + +TA E +NPRK++
Sbjct: 321 IGSKYWRDPGAF-----RGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPY-NDPKLTSDDSYVAASPFIISIQNSGTPILPH 351
           P A KK+++RILF ++ SL  +G LVPY +D  L +  S   ASP++I++ + G  ++PH
Sbjct: 376 PSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
             NAVIL +++S ANS  Y  SRI+  L+K   AP+     ++ G P V+++ + LFG +
Sbjct: 436 FINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVI 495

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           A+  +S   E  F WLL I+G++  F+W+ I +SH+RF +A++ +G S  ++ +K++   
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGV 555

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLW 522
             + YA+  M L +I Q + +  P           F   Y++  + IA++I F++W
Sbjct: 556 WGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIFFKVW 611

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  284 bits (726), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 158/497 (31%), Positives = 272/497 (54%), Gaps = 22/497 (4%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
           ++K+ ++ RH                     L +AGP G +I Y  M + +Y + Q++GE
Sbjct: 98  KLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGE 157

Query: 118 MA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPI 176
           MA  ++ +   F  +    + P+   +  ++Y   W     LEL      IQ+WT+ V  
Sbjct: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNA 217

Query: 177 VAWISIFWVLLVAMNMFP-VRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVG 234
             ++ IF++L++A+N+F   R Y E EF   S K+L ++GF I  + ++CG AG  G +G
Sbjct: 218 DIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIG 277

Query: 235 FRYWRNPGPM----GPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
            +YWR+PG      GP          +F G VS+L+ AAF++  TE + ITA E +NPRK
Sbjct: 278 GKYWRDPGAFRGSDGPN---------RFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPIL 349
           ++P A KKV++R L  Y+ S+  +GLLVPY+  +L  S  +   ASP+++++   G  ++
Sbjct: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVV 388

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           PH  NAVIL ++ S A+S  Y  SR++  L++   AP++ +  ++ G P +  +   +  
Sbjct: 389 PHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIA 448

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            +A+   S+     FNWLL I+G++  F+W  I +SH+RF +A++ +G S D++ +K++ 
Sbjct: 449 VMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQV 508

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
               + YA   M LI+I Q +    P    S D   F   Y++  +FI +++ +++W R 
Sbjct: 509 GVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRD 568

Query: 526 -RLIWKIEDVDIDTDRR 541
            RL  + +D+D+ + R 
Sbjct: 569 WRLFIRAKDIDLISHRH 585

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  284 bits (727), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 166/547 (30%), Positives = 290/547 (53%), Gaps = 24/547 (4%)

Query: 15  KSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIREAEVKRELKQRHXXXXXXX 74
           K SS +LD+  L+R+++ +                   + ++  +K+ +K RH       
Sbjct: 109 KDSSSQLDN-ELNRKSSYI-------TVDGIKQSPQEQEQKQENLKKSIKPRHTVMMSLG 160

Query: 75  XXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMAT-FIPVTSSFTVFSQ 133
                         L NAGP G +I Y  MG+ VY + Q+ GE+A  +  +   F  +  
Sbjct: 161 TGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPL 220

Query: 134 RFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMF 193
             + P+ G +  +++   W     LEL      I++WT++V    ++ IF+VL+V +N+F
Sbjct: 221 FLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVF 280

Query: 194 PVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPMGPGIIAKN 252
             + Y E +F+    K+L I+GF I  + + CG AG  G +G +YWR+PG         +
Sbjct: 281 GAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAF-----RGD 335

Query: 253 LNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLF 312
               +F G V++ + AAF +  +E + +TA E +NPRK++P A KK+++RILF ++ SL 
Sbjct: 336 TPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLT 395

Query: 313 FIGLLVPY-NDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYV 371
            +G LVPY +D  L +  S   ASP++I++ + G  ++PH  NAVIL +++S AN   Y 
Sbjct: 396 LVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANGAFYT 455

Query: 372 GSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNIT 431
            SRI+  L+K   AP+     ++ G P  +++ + LFG +A+  +S   E  F WLL I+
Sbjct: 456 SSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFTWLLAIS 515

Query: 432 GVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFT 491
           G++  F+W+ I +SH+RF +A++ +G S  ++ +K++     + YA+  M L +I Q + 
Sbjct: 516 GLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVLALIAQFWV 575

Query: 492 SFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIWKIEDVDIDTDRR--DI 543
           +  P           F   Y++  ++IA++I +++W +   L    + VD+ + R   D 
Sbjct: 576 AIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDWSLFIPADKVDLVSHRNIFDE 635

Query: 544 EEVVWED 550
           E +  ED
Sbjct: 636 ELLKQED 642

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  283 bits (723), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 179/496 (36%), Positives = 281/496 (56%), Gaps = 12/496 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
            + ++ +LK RH                     L  AGP G LI +   GT+++++  +L
Sbjct: 85  RSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMAL 144

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           GE+A   PV+  F  ++ RF+  SFG AN + Y F W +   LE+      + +W + V 
Sbjct: 145 GELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVR 204

Query: 176 IV-AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
               ++++FW+++V +NMF VR YGE EF  + IKV+A++GF+I  + +VCG G  G   
Sbjct: 205 YTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYV 264

Query: 235 F-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
             RYW +PG       A +    +F G+ S  + AAF++ G+ELVGI + E+ NPRKSVP
Sbjct: 265 GGRYWHDPGAF-----AGHSPGRRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVP 319

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVA-ASPFIISIQNSGTPILPHI 352
           +A K+V +RIL FYI  L  +GLLVPY DP+L       A ASPF+I+I   G   LP +
Sbjct: 320 QAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIVTHGISGLPSV 379

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            N VIL +++S  NS++Y  SR +  LS+    P+ ++  ++ G P V +     FG +A
Sbjct: 380 VNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGLIA 439

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S   E  FNWLL I+G++ F +W  I   H+RF  AL+  G S D+LPFK+     
Sbjct: 440 FVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPVGII 499

Query: 473 LAYYAIFFMTLIIIIQGFTSFCP---SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLI 528
            +Y+ +    L+++ Q + +  P   S +  DF +AY++  + +A +I  +LW R  +L+
Sbjct: 500 GSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLWKRNWKLL 559

Query: 529 WKIEDVDIDTDRRDIE 544
             ++D+DIDT RR+ +
Sbjct: 560 IPLKDIDIDTGRRETD 575

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  282 bits (722), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 164/505 (32%), Positives = 275/505 (54%), Gaps = 20/505 (3%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
           ++++ ++ RH                     L NAGP G LI Y+ M + +Y + Q+ GE
Sbjct: 79  QLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138

Query: 118 MA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPI 176
           MA  ++ +   F  +    +  ++  A  ++Y   W     LEL      I++W   V  
Sbjct: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP 198

Query: 177 VAWISIFWVLLVAMNMFP-VRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVG 234
             +++IF++L++A+N+F   R Y E EF+    K+L I GF I  + ++CG AG +G +G
Sbjct: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGYIG 258

Query: 235 FRYWRNPGPM---GPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
             YW NPG      PG         +F G VS+L+ AAF++  TE + ITA E +NPRK+
Sbjct: 259 VSYWNNPGAFRGHTPG--------TRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKA 310

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILP 350
           +P A KKV++R LF Y+GS+  +G LVPYN P+L  S  S   ASP++I++ + G  I P
Sbjct: 311 IPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAP 370

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           H  NAVIL +++S ANS+ Y  SR++  L+K   AP+I +  ++ G P   +I   L   
Sbjct: 371 HFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLAT 430

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           +A+  +S      F+WLL I+G++  F+W  I +SH+RF +A++ +G S ++L +K++  
Sbjct: 431 IAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVG 490

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCP-SFDG---IDFLAAYISCFLFIAIWIVFQLWFRC- 525
              + YA   M LI+I Q + +  P + +G    +F   Y++  + +  +  ++ W +  
Sbjct: 491 VWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW 550

Query: 526 RLIWKIEDVDIDTDRRDIEEVVWED 550
            L  + +D+D+ + R   +E V + 
Sbjct: 551 NLFIRAKDIDLISHRHIYDEDVLKQ 575

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  281 bits (718), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 177/496 (35%), Positives = 277/496 (55%), Gaps = 22/496 (4%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
              IRE ++ R LK R                      L   GP    + Y  MG +VY 
Sbjct: 43  EANIRE-DLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTGGPASLFMNYTIMGGVVYL 101

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
              +LGEM+T++P++ SF V++++F S SF  A  + YWF+ A++ A +L+ +  ++ +W
Sbjct: 102 TLLALGEMSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVMDYW 161

Query: 171 TSA---VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA 227
            ++    P  A   IFW ++V +N+  VRFYGE E+W+A +K++AI+ F I  + +  G 
Sbjct: 162 KTSEHGFPYWAASLIFWFVVVCLNVIHVRFYGEAEYWLAMLKIIAIIIFFILSIVVNVGK 221

Query: 228 GVTGP-VGFRYW-RNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEA 285
                 +GF+ W R   P   GI           G+ S  ++A+F Y GTE + +T GEA
Sbjct: 222 NPQHEYIGFKNWTRGEAPFVDGI----------KGFASLFVSASFAYGGTESITLTNGEA 271

Query: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSG 345
            NP ++ P+ +K V +RIL FY+GS FFI + +PY+ P L  D   +  SPF +  Q +G
Sbjct: 272 ENPIRNTPKIVKTVFWRILIFYVGSTFFIAMNIPYDYPGL--DSKSIVTSPFTLVFQMAG 329

Query: 346 TPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAP-RILSRTNKNGVPWVSVIF 404
           T       NAVI++++ISA N  ++ GSRIM+ +      P RI+SRTN+N VP+VSV+ 
Sbjct: 330 TKGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGFLPARIVSRTNRNKVPYVSVLI 389

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           T   GAL +  +  G    + WL NI GV+   +WL I I+ +RF + LE +G +  +L 
Sbjct: 390 TAAVGALCFGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELI 448

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFR 524
           +K    P   Y+ I F++ II+IQG+++F P ++  +F + Y+  F+F   +I++ L  R
Sbjct: 449 YKNWTYPYGPYFVIIFVSFIILIQGWSAFAP-WNVSNFFSYYLELFVFPVCFIIWWLVKR 507

Query: 525 CRLIWKIEDVDIDTDR 540
            R + K ED+D  TDR
Sbjct: 508 DRFV-KYEDMDFTTDR 522

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  280 bits (715), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 175/496 (35%), Positives = 277/496 (55%), Gaps = 22/496 (4%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
              IRE +++R LK RH                     L   GP    + Y  MG +VY 
Sbjct: 47  EANIRE-DLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYL 105

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGEM+T++P++ SF  ++++F S SF  A  + YWF+ A++ A +++ +  ++ +W
Sbjct: 106 TLLCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLVMDYW 165

Query: 171 ---TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA 227
               S  P  A   +FW L+V +N+  VRFYGE E+W+A +KV+AI+ F I  + +  G 
Sbjct: 166 DTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGH 225

Query: 228 GVTGP-VGFRYWRN-PGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEA 285
                 +GF+ W +   P   G          F G+ S  ++A+F Y GTE + +T GEA
Sbjct: 226 NPQHEYIGFKNWNHGEAPFVDG----------FKGFASLFVSASFAYGGTESITLTNGEA 275

Query: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSG 345
           ANP ++ P+ +K V +RIL FY+GS FFI + +PY+ P L  D   V  SPF +  Q +G
Sbjct: 276 ANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGL--DTKSVVTSPFTLVFQMAG 333

Query: 346 TPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAP-RILSRTNKNGVPWVSVIF 404
           T       NAVI++++ISA N  ++ GSR+M+ +      P +I+SRTN+  VP+VSV+ 
Sbjct: 334 TKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLI 393

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           T   G L +  +  G    + WL NI GV+   +WL I I+ +RF + LE +G +  +L 
Sbjct: 394 TSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELR 452

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFR 524
           +K    P   Y+ + F+T II++QG+++F P +D  +F + Y+  F+F   +I++ L+ R
Sbjct: 453 YKNWTYPYGPYFLVIFVTFIILVQGWSAFDP-WDVTNFFSYYLDLFVFPFCFIIWWLYKR 511

Query: 525 CRLIWKIEDVDIDTDR 540
            R + K+ED+D  TDR
Sbjct: 512 DRFV-KLEDMDFVTDR 526

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  281 bits (718), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 161/499 (32%), Positives = 274/499 (54%), Gaps = 13/499 (2%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           RE ++K+ +  RH                     L N GP G  I Y  MG+ +Y + Q+
Sbjct: 75  RETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQA 134

Query: 115 LGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
            GEMA ++  ++ +F  +    + P+ G +  ++Y   W     LEL      I++WT+A
Sbjct: 135 AGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTTA 194

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGP 232
           V    ++ IF+VL V +N+F  R Y E EF+  + KVL I GF I  + + CG AG  G 
Sbjct: 195 VNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGY 254

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +G +YW +PG +      K ++   F G +++++ AAF +  TE + +TA E ANPR+++
Sbjct: 255 LGGKYWHDPGAL---YGTKPIHH--FKGIIATMVTAAFAFGATEFIALTAAEQANPRRAI 309

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQNSGTPILPH 351
           P A KK+V+R+L  ++  +  +G LVPYN D  + S  S   ASP++I+I + G  ++PH
Sbjct: 310 PSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASHGVKVVPH 369

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
             NAVIL +++S  NS  Y  SR++  LS+   AP  L+  ++ G P  +++ + +FG +
Sbjct: 370 FINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIFGLI 429

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           A++  S   E  F WLL I+G++  F+W+ I +SH+RF +AL  +G S  +L +K++   
Sbjct: 430 AFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQTGV 489

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
             +YYA   M  ++  Q + +  P      D  +F   Y++  + IA++  +++W R  +
Sbjct: 490 VGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYRVWKRDWK 549

Query: 527 LIWKIEDVDIDTDRRDIEE 545
           L   +E +D+ + R+  +E
Sbjct: 550 LYIPLEQIDLVSHRKVFDE 568

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  280 bits (717), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 162/500 (32%), Positives = 263/500 (52%), Gaps = 13/500 (2%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            I    + +EL  RH                     L+  GP   +I ++ + T +++V 
Sbjct: 80  DINNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLFTVI 139

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
            SLGE++   PV   F V+S RF+ PSF  A    Y   W +   LEL      I++W  
Sbjct: 140 NSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWND 199

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
            +   AW++IF+  +   NM  V+ +GE EF ++ IK+LAI+GF I  + + CG G  G 
Sbjct: 200 KINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGGPHGG 259

Query: 233 VGF-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
               +YW +PG         + +  KF G  S  + AAF+Y G E+  ++A E+ NPR++
Sbjct: 260 YIGGKYWNDPGAF-----VGHDSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPIL 349
           +P+A K+  + I   Y+  L  IG LVP NDP+L +  S V  A+SP +I+I+N     L
Sbjct: 315 IPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGL 374

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P + NA+IL  ++S ANS VY  SR M  ++     P+ L R +K G P  +++ T  FG
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFG 434

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            L+++  S      F WL  ++G++  F W+ I++SH+RF QA++++  S D+LPF ++ 
Sbjct: 435 LLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPFISQT 494

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
               + Y    + L++I   +TS  P      +   F   Y+S  + I  +   +++ R 
Sbjct: 495 GVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCYFGHKIYTRD 554

Query: 526 -RLIWKIEDVDIDTDRRDIE 544
            RL+ K+ED+D+DT R+ ++
Sbjct: 555 WRLLVKLEDMDLDTGRKQVD 574

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  280 bits (717), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 160/500 (32%), Positives = 264/500 (52%), Gaps = 13/500 (2%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            I    + ++L  RH                     L+  GP   +I ++ + T +++V 
Sbjct: 80  DINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVI 139

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
            SLGE++   PV   F V+S RF+ PSF  A    Y   W +   LEL      I++W  
Sbjct: 140 NSLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWND 199

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
            +   AW++IF+  +   NM  V+ +GE EF ++ IK+L+I+GF I  + + CG G  G 
Sbjct: 200 KINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGG 259

Query: 233 VGF-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
               +YW +PG         + +  +F G  S  + AAF+Y G E+  ++A E+ NPR++
Sbjct: 260 YIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPIL 349
           +P+A K+  + I   Y+  L  IG LVP NDP+L +  S V  A+SP +I+I+N G   L
Sbjct: 315 IPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGL 374

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P + NA+IL  ++S ANS VY  SR M  ++     P+ L+R +K G P  +++ T  FG
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFG 434

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            L+++  S      F WL  ++G++  F W+ I++SH+RF QA++ +  S D+LPF ++ 
Sbjct: 435 LLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQT 494

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
               ++Y    + L++I   +TS  P          F   Y+S  + I  ++  +L+ R 
Sbjct: 495 GVKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYTRN 554

Query: 526 -RLIWKIEDVDIDTDRRDIE 544
             L+ K+ED+D+DT R+ ++
Sbjct: 555 WTLMVKLEDMDLDTGRKQVD 574

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  280 bits (716), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 176/493 (35%), Positives = 271/493 (54%), Gaps = 12/493 (2%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           +KR LK RH                     L  AGP G LI +   GT++Y +  ++GE+
Sbjct: 77  LKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGEL 136

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW-TSAVPIV 177
           A   PV+  FT ++ RF+  SFG AN + Y   W +   LE+      + +W T      
Sbjct: 137 AVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 196

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRY 237
            ++++F+V++V++NMF V+ YGE EF  + IKV+ ++GF+I  + +VCG G  G      
Sbjct: 197 GFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGGA 256

Query: 238 -WRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 296
            W NPG         N    +F G  S  + AAF++ G+ELVG+ + E ANPRKS+PRA 
Sbjct: 257 NWHNPGAF-----VGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRAA 311

Query: 297 KKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPHIFNA 355
           K+V +RI  FYI SL  IGLLVPYND +L    S   AASPF+++I+N G   LP + N 
Sbjct: 312 KQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLPSVVNV 371

Query: 356 VILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYME 415
           VIL  ++S  NS V+  SR +  L++    P+I    ++ G P V + FT  FG L+++ 
Sbjct: 372 VILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLSFIA 431

Query: 416 TSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAY 475
            S      F+WLL ++G++  F+W+ I I H+RF +AL  +G S D+L F +      + 
Sbjct: 432 ASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGVWGSI 491

Query: 476 YAIFFMTLIIIIQGFTSFCP---SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIWKI 531
           Y    + LI+  Q + +  P     D  DF  +Y+S  + + ++I  + + R  +L  + 
Sbjct: 492 YGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRNWKLFIRA 551

Query: 532 EDVDIDTDRRDIE 544
           E++DIDT RR+++
Sbjct: 552 ENIDIDTGRREVD 564

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  280 bits (716), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 162/500 (32%), Positives = 265/500 (53%), Gaps = 13/500 (2%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            I    + ++L  RH                     L+  GP   +I ++ +GT +++V 
Sbjct: 80  DINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVI 139

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
            SLGE++   PV   F V+  RF+ PSF  A    Y   W +   LEL      I++W  
Sbjct: 140 NSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWND 199

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVC-GAGVTG 231
            +   AW++IF+  +   NM  V+ +GE EF ++ IK+L+I+GF I  + + C G    G
Sbjct: 200 KINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGG 259

Query: 232 PVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
            +G +YWRNPG      +  N +  KF G  S  + AAF+Y G E+  ++A E+ NPR++
Sbjct: 260 YIGGKYWRNPG----AFVGHN-SGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPIL 349
           +P+A K+  + I   Y+  L  IG LVP NDP+L +  S V  A+SP +I+I+N     L
Sbjct: 315 IPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGL 374

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P + NA+IL  ++S ANS VY  SR M  ++     P+ L+R +K G P  +++ T  FG
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFG 434

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            L+++  S      F WL  ++G++  F W+ I++SH+RF +A++ +  S D+LPF ++ 
Sbjct: 435 LLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPFISQT 494

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
               ++Y    + L++I   +TS  P          F   Y+S  + I  +   +++ R 
Sbjct: 495 GVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIVCYFGHKIYTRN 554

Query: 526 -RLIWKIEDVDIDTDRRDIE 544
             L+ KIED+D+DT R+ ++
Sbjct: 555 WTLMVKIEDIDLDTGRKQVD 574

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  280 bits (715), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 169/508 (33%), Positives = 268/508 (52%), Gaps = 28/508 (5%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G      +KR LK RH                     L + GP+  +I +   GT +  
Sbjct: 77  DGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVG 136

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+    PV  +F  +S RFL PS       +Y   W     LE+      IQ+W
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYW 196

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
             ++  V W++IF+ ++V++N+F  R +GE EF  +SIKV+ I+GF+I C+ ++CG G  
Sbjct: 197 NQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPD 256

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              VG RYW +PG +  G          F G +S L+ A+++  GTE+V + +GE  NPR
Sbjct: 257 HDFVGARYWHDPGCLSHG----------FPGVLSVLVVASYSLGGTEMVCLASGE-TNPR 305

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           + +P AIK+  +RILFF++ SL  IG LVPY +P L    S V  SPF+I+I+      L
Sbjct: 306 E-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSS-VNNSPFVIAIKLHHIKAL 363

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P I NAVIL +I+S  NS ++  SR +  ++   L P+     ++ G P   ++   LFG
Sbjct: 364 PSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFG 423

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPF-KAK 468
            LA++  S+     F+WL+ I G+A    WL I+ISH+RF  A++ +G S D+L F  A 
Sbjct: 424 LLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAV 483

Query: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCP-------SFDGIDFLAAYISCFLFIAIWIVFQL 521
            M G AY A+   +LI+I Q + +  P       S     F  +Y+   +   +++  ++
Sbjct: 484 GMWGSAYSAL-INSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHKV 542

Query: 522 WFRCRL-----IWKIEDVDIDTDRRDIE 544
           ++R +      I  ++ +D++TDR++I+
Sbjct: 543 FYRYKTGKWWAIMDLDKIDLETDRKNID 570

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  279 bits (714), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 160/510 (31%), Positives = 279/510 (54%), Gaps = 17/510 (3%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           ++A   ++L  RH                     LT  GP   +I ++ + T ++++  +
Sbjct: 68  QDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNA 127

Query: 115 LGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           LGE+++  PV   F V+  RF+ PSFG A    Y   WA+   LEL      I++W   +
Sbjct: 128 LGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTI 187

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVC-GAGVTGPV 233
              AW++IF+ +++  N+  V+ +GE EF ++ +K+LAI+GF I  + + C G    G +
Sbjct: 188 NSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYI 247

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G +YW NPG    G  A +    +F G  S  + AAF+Y GTEL+ ++A E+ NPR ++P
Sbjct: 248 GGKYWSNPGAF-VGHTAGD----RFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLP 302

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY--VAASPFIISIQNSGTPILPH 351
           +A K+  + I   YI  L  +G LV  +DP+L +  S   VAASP +I+I+N G   LP 
Sbjct: 303 KACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPS 362

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
           + NA+IL  ++S ANS VY  SR M  +++    P++ +  ++ G P  +++ T +FG L
Sbjct: 363 LMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLL 422

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           +++  S   E  F WL  ++G++  F W  I++SH+RF + ++ RG + D+LPF +  M 
Sbjct: 423 SFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVS--MT 480

Query: 472 GL--AYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
           G+  +YY    + +++++  +TS  P      +   F   Y+S  + +A +   +L+ R 
Sbjct: 481 GVWGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRS 540

Query: 526 -RLIWKIEDVDIDTDRRDIEEVVWEDPPPV 554
            RL+   +++D+D+ RR ++  + +D   +
Sbjct: 541 WRLLTPTKEIDLDSGRRAVDLELMKDEKRI 570

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  280 bits (715), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 159/500 (31%), Positives = 264/500 (52%), Gaps = 13/500 (2%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            I    + ++L  RH                     L+  GP   +I ++ + T +++V 
Sbjct: 80  DINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVI 139

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
            SLGE++   PV   F V+S RF+ PSF  A    Y   W +   LEL      I++W  
Sbjct: 140 NSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWND 199

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
            +   AW++IF+  +   NM  V+ +GE EF ++ IK+L+I+GF I  + + CG G  G 
Sbjct: 200 KINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGG 259

Query: 233 VGF-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
               +YW +PG         + +  +F G  S  + AAF+Y G E+  ++A E+ NPR++
Sbjct: 260 YIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPIL 349
           +P+A K+  + I   Y+  L  IG LVP NDP+L +  S V  A+SP +I+I+N G   L
Sbjct: 315 IPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGL 374

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P + NA+IL  ++S ANS VY  SR M  ++     P+ L+R +K G P  +++ T  FG
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFG 434

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            L+++  S      F WL  ++G++  F W+ I++SH+RF QA++ +  S D+LPF ++ 
Sbjct: 435 LLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQT 494

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
               ++Y    + L++I   +TS  P      +   F   Y+S  + I  +   +++ R 
Sbjct: 495 GVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYTRN 554

Query: 526 -RLIWKIEDVDIDTDRRDIE 544
             L+ K+ED+D+DT R+ ++
Sbjct: 555 WTLMVKLEDIDLDTGRKQVD 574

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  280 bits (715), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 168/504 (33%), Positives = 273/504 (54%), Gaps = 16/504 (3%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
           E+K+ +K RH                     L N+GP G +I Y  MG+ +Y + Q+ GE
Sbjct: 108 ELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGE 167

Query: 118 MAT-FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPI 176
           +A  +  +T  F  +    + P+FG A  ++Y   W     LEL      I++WT+ V  
Sbjct: 168 LAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDP 227

Query: 177 VAWISIFWVLLVAMNMFP-VRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVG 234
             ++ IF+ L++ +N+      Y E EF+  S K+L + GF I  + ++CG AG  G +G
Sbjct: 228 DVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIG 287

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
            R W NPG         +    +F G VS+L+NAAF +  +E +G+TA E +NPRK++P 
Sbjct: 288 TRLWHNPGSF-----RGDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPS 342

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQNSGTPILPHIF 353
           A KK+++RI+  Y+GS+  +G LVPY+ D  L S  +   ASP++++I   G  ++PH  
Sbjct: 343 AAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKASPYVLAISLHGVRVVPHFI 402

Query: 354 NAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAY 413
           NAVIL +++S  NS  Y  SR +  LS+   AP  L+  ++NG P  +   + L G +A+
Sbjct: 403 NAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAF 462

Query: 414 METSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGL 473
             TS   +  F WLL I+G++  F+W  I +SH+RF +A+  +G S  ++ FK++     
Sbjct: 463 CATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYG 522

Query: 474 AYYAIFFMTLIIIIQGFTSFCPSFDGI----DFLAAYISCFLFIAIWIVFQLWFRC-RLI 528
           + Y+   M LI+I Q +T+  P  +G      F   Y++  +FI ++  F++W +  RL 
Sbjct: 523 SLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLF 582

Query: 529 WKIEDVDIDTDRR--DIEEVVWED 550
            + ED+D+ + R   D E +  ED
Sbjct: 583 IRAEDIDLVSHREIFDEELLKQED 606

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  279 bits (714), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 168/502 (33%), Positives = 273/502 (54%), Gaps = 14/502 (2%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
           ++ ++L  RH                     L++ GP   +I ++ + T +++V  SLGE
Sbjct: 95  QMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGE 154

Query: 118 MATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV 177
           +A   PV   F V+  RF+ PSFG A    Y   W +   LEL      I++W   +   
Sbjct: 155 LAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRYWNDKINSD 214

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGF-R 236
           AW++IF+  +   NM  V+ +GE EF ++ IK+LAI+GF I  + + CG G  G     +
Sbjct: 215 AWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGPKGGYIGGK 274

Query: 237 YWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 296
           YW +PG           +  KF G  S  + AAF+Y G EL  ++A E+ NPR+++P+A 
Sbjct: 275 YWHDPGAF-----VGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAAESLNPRETIPKAA 329

Query: 297 KKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPILPHIFN 354
           K+  + I   Y+  L  IG LVPYN+PKL +  S V  A+SP +I+I+N G   LP + N
Sbjct: 330 KRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIENGGIRGLPSLMN 389

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           A+IL  I+S ANS VY  SR M  +++ +  PR L R ++ G P  + + T  FG L+++
Sbjct: 390 AIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLLSFI 449

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             S   E  F WL  ++G++  F+W+ I++SH+RF QA+ ++GIS D+LP+ +      +
Sbjct: 450 AASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPYISMTGVSGS 509

Query: 475 YYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFR-CRLIW 529
           +Y +  + L+++   +TS  P      D   F   Y+S  + I  ++  +L+ R  RL+ 
Sbjct: 510 WYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKLYIRKKRLLI 569

Query: 530 KIEDVDIDTDRRDIE-EVVWED 550
            + D+D+ +DR+ ++ EV  E+
Sbjct: 570 DVADMDLVSDRKVVDVEVCREE 591

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  280 bits (715), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 174/504 (34%), Positives = 273/504 (54%), Gaps = 21/504 (4%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
            +++ + L  RH                     L   GP   LIA+  + T ++++  SL
Sbjct: 106 SSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSL 165

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           GE+A+  PV   F V+  RF+ PSFG A    Y   WA+   LEL+     I++W + + 
Sbjct: 166 GELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYWNNKIN 225

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGF 235
             AW++IF+V +   NM  V+ +GE EF ++ +K+LAI GF I    ++CG G  G    
Sbjct: 226 SDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIG 285

Query: 236 -RYWRNPGPM---GPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
            +YW +PG      PG        A+F G  S  + AAF+Y GTELVG++A E+ NPR +
Sbjct: 286 AKYWHDPGAFVGDTPG--------AQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYT 337

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY--VAASPFIISIQNSGTPIL 349
           +PRA K+  + I   Y+  L   G LVP NDP+L +  S   VAASP +I+I+N G   +
Sbjct: 338 IPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGV 397

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P + NA+IL  IIS ANS+VY  SR M  +++    P++ +  ++ G P V+++ T +FG
Sbjct: 398 PSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFG 457

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            L+++  S   EA F WL  ++G++  F W  I+ISH+RF +A+  +  S D+LP+ +  
Sbjct: 458 LLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLT 517

Query: 470 MPGLAYYAIFFMTLIIIIQGFTS-FCPSFDG---IDFLAAYISCFLFIAIWIVFQLWFRC 525
               ++Y    +  ++++  +TS F P   G     F   Y+S  +F+  +I  +L+ R 
Sbjct: 518 GVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYISHKLYKRD 577

Query: 526 -RLIWKIEDVDIDTDRR--DIEEV 546
            RL      +D+D+ RR  DIEE+
Sbjct: 578 WRLFIPAGQIDVDSGRRALDIEEL 601

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  277 bits (709), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 170/477 (35%), Positives = 260/477 (54%), Gaps = 15/477 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +  +K  LK RH                     L   GP   LI +   GT++Y++  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW-TSAV 174
           GE+A   P++  FT ++ RF+  SFG AN + Y   W +   LE+      + FW T   
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
               ++++FWV++V +NMF V+ YGE EF  + IKV+ ++GF+I  + + CG G  G   
Sbjct: 203 YRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 235 F-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
             +YW +PG       A +   AKF G  S  + +AF++ G+ELVG+ A E+  PRKSVP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVP 317

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPHI 352
           +A K+V +RI  FYI SL  IGLLVPYND  L    S   AASPF+I+I+  G   LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGLPSV 377

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            N VIL  ++S  NS +Y  SR M  L++ +  P+I +  ++ G P V +  T  FG +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIA 437

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S      FNWLL ++G++  F+W  I I H+RF +AL  +G   D+L FK+     
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 473 LAYYAIFFMTLIIIIQGFTSF-----CPSFDGIDFLAAYISCFLFIAIWIVFQLWFR 524
            +Y+ +F + ++ I Q + +       PS +G  F  AY+S  L +A++I  +++ R
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGGSPSAEG--FFEAYLSFPLVMAMYIGHKIYKR 552

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  278 bits (710), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 167/526 (31%), Positives = 276/526 (52%), Gaps = 21/526 (3%)

Query: 54  IREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQ 113
           +    + + L  RH                     L++ GP   ++ ++ + T +++V  
Sbjct: 38  LNNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVIN 97

Query: 114 SLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
           SLGE+A   P+   F V+  RF+ PS G A    Y   W +   LEL      I++W   
Sbjct: 98  SLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPV 233
           +   AW++IF+V +V  NM  V+ +GE EF ++ +K+LAI+GF I  + +  G G +G  
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 234 G-FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
             F+YW NPG    G      N +KF G  S  + AAF++ G E++ ++A E+ NPRK +
Sbjct: 218 LGFKYWNNPGAFVGGT-----NASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVI 272

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPILP 350
           P+A K+  + +   Y+  L  +G LVPYND +L +  + V  AASP +I+I+N G   LP
Sbjct: 273 PKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLP 332

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
            + NA+IL  I+S ANS VY  SR M  ++     P++LS+ +K G P  ++I T +FG 
Sbjct: 333 SLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGL 392

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           L+++  S      F WL  ++G++  F W+ I+ S +RF +A++ +  S D+LP+ ++  
Sbjct: 393 LSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTG 452

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWF--R 524
              A+Y +  + L+I+   +TS  P      D   F  +++S  + +  +   +L+F   
Sbjct: 453 IWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARN 512

Query: 525 CRLIWKIEDVDIDTDRRDIEE-------VVWEDPPPVTFWDKFWNV 563
            RL    E++DID+ R+ I+E          E     +F  KFW+V
Sbjct: 513 WRLQIGAEEMDIDSGRKIIDEEGLKQEREEEEKAMNSSFLIKFWHV 558

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  278 bits (711), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 169/526 (32%), Positives = 272/526 (51%), Gaps = 23/526 (4%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
           Q  +  +K+ LK  H                     L   GP G  I+Y  M T++Y V 
Sbjct: 46  QSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVM 105

Query: 113 QSLGEMATFIP-------VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQ 165
            +L EM  F+P          S +    R++  S G A G+ Y + + I  A E +    
Sbjct: 106 NALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASG 165

Query: 166 IIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVC 225
           ++ +WT+AVP  AWI+IF  ++V +N   V FYG  E    S+K+  I+G +I  + +  
Sbjct: 166 VVTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFF 225

Query: 226 GAGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAG 283
           G G     +GFR+W++PG     +   +    +    ++ +I A F +  G ELV +T+ 
Sbjct: 226 GGGPNHDRLGFRFWKDPGAWAYHL--ADGGAGRLSDIITGVIRAGFAFILGPELVVLTST 283

Query: 284 EAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDP----KLTSDDSYVAASPFII 339
           EA + R+++ +A ++ V+R++FFY  S    G++V  NDP     L+       +SPF+I
Sbjct: 284 EAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVI 343

Query: 340 SIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPW 399
            IQN+G  +LPHI N  ILS+  S+ NS +Y  +R +  LS+   AP+I +R N+ GVP+
Sbjct: 344 GIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPY 403

Query: 400 VSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGIS 459
             V F   F  LAY+  S+     FNW  NI+ ++GF  W+   ++++RF +A+ +  + 
Sbjct: 404 TGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL- 462

Query: 460 RDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVF 519
            D LPFK  F P   ++ I  + +I +I G+ SF   ++  DF+AAYI+  LF+ +W+  
Sbjct: 463 YDRLPFKTPFQPYFTWFYIILIAIICLINGYESFV-HWNYKDFIAAYITLPLFLILWLGH 521

Query: 520 QLWFRCRLIWKI--EDVDIDTDRRDIEEVVWE----DPPPVTFWDK 559
           + + R    W I   ++D+ T  R+IEE   E      PP   W+K
Sbjct: 522 KAYTRTWSQWMISVSEIDVTTGLREIEEETKELNARRIPPRNLWEK 567

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  277 bits (708), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 171/525 (32%), Positives = 282/525 (53%), Gaps = 20/525 (3%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           ++  + R LK RH                     L+  GP   LIAY  M   V+SV   
Sbjct: 47  QKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAVMSLFVWSVMNQ 106

Query: 115 LGEMATFIPVTSSFTVFS--QRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
           + EM T IP+    T++S  + +++       G+  +++ A+    E++    ++Q+WT 
Sbjct: 107 MTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVTACALLVQYWTD 166

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
           A P + +ISIF VL VA+ M PV+ +GE EFWV+SIK+L I+G +I  + +  G G    
Sbjct: 167 ANPAI-FISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGVVIFFGGGPAQE 225

Query: 233 --VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGT-ELVGITAGEAANPR 289
             +GF YW+ PG   P ++       KFL + +++I + F++    E+V   A EA  PR
Sbjct: 226 HVLGFHYWKKPGAFKPYLVEGG--TGKFLAFWTAIIKSGFSFVLVPEIVSSCAAEAVAPR 283

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAAS----PFIISIQNSG 345
           +++PRA K+ ++R+  FY+  +  +G++V Y++ +L +  +   +S    PF+I I+ +G
Sbjct: 284 RNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAASPFVIGIKEAG 343

Query: 346 TPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFT 405
             +LPHI NA IL++  S     +Y  SR +  ++    APRIL+  NK GVP+     T
Sbjct: 344 IRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNKYGVPYYCTGIT 403

Query: 406 GLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPF 465
            LF  LAY+  S      FNWL NI  ++GF SW+ +SI+++RF   ++   ++ D +PF
Sbjct: 404 SLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVIDVLKLN-DRIPF 462

Query: 466 KAKFMPGLAYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYIS----CFLFIAIWIVFQ 520
           +  +   LAY A+ F +++ +  GF  F   ++D  +F AAYI+      LF+   I ++
Sbjct: 463 RVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAAYITLGFVLVLFVGSTIYYK 522

Query: 521 LWFRCRLIWKIE-DVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVV 564
            W RCR I +IE D+       + EE  ++ P P  + +K W V+
Sbjct: 523 EW-RCRDIAEIEQDILPKITLAEAEEYEYDIPVPRNWLEKIWMVI 566

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  276 bits (706), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 167/494 (33%), Positives = 259/494 (52%), Gaps = 17/494 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
            + VKR LK RH                     L   GP+  L+ +  +G + +S+ +S+
Sbjct: 39  HSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESI 98

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           GE+ T  P    F   ++RF S    A +GY Y   +    A E + +  I+QFW   VP
Sbjct: 99  GELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVP 158

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTG--PV 233
           I  +  IFW   +   +  V  +GE E+W+A  K+L ++ F I+ +  + G G+ G  P+
Sbjct: 159 IYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMSG-GIPGKPPI 217

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           GF+YW+NPG +  G          F G     +  +  Y GTE V + A E+ NPRK+VP
Sbjct: 218 GFQYWKNPGALSHG----------FRGIAVVFVFCSTFYSGTESVALAATESRNPRKAVP 267

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIF 353
            A+++  +RIL  Y+G  FF G+ VPYNDP L +    +  SP  I++  +G     H+ 
Sbjct: 268 LAVRQTFWRILIVYLGISFFYGVTVPYNDPTLGAQTKSLK-SPISIALSRAGWAGGVHLV 326

Query: 354 NAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAY 413
           NA IL T ISA NS++Y+GSR +  L+   LAPRIL+ T+K GVP  ++I     G ++ 
Sbjct: 327 NAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGLISL 386

Query: 414 METSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGL 473
           M  S G   A+N+++N++GV  F  W  ISI+H+RF +A   +G S  +LP++A F P  
Sbjct: 387 MNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRALFYPWT 446

Query: 474 AYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLW-FRCRLIWKIE 532
             +++     + +IQG+TS  P F   DF+ AYI       +++    W  R      I 
Sbjct: 447 TIFSLAANIFLALIQGWTSLVP-FVAKDFVDAYILLPAAGLLYVGINFWKNRNFKTVNIH 505

Query: 533 DVDIDT-DRRDIEE 545
            ++++   RRD++E
Sbjct: 506 GINLEEGQRRDLDE 519

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  278 bits (710), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 171/506 (33%), Positives = 272/506 (53%), Gaps = 15/506 (2%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +  ++K+ ++ RH                     L N GP G  + +  MGT VY V Q+
Sbjct: 85  KHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYCVIQA 144

Query: 115 LGEMATFIPVTSS-FTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
            GEMA   P  S  F  +    + P FG A  ++Y   W   F LEL      I++WT+A
Sbjct: 145 AGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKYWTTA 204

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA-GVTGP 232
           +    ++++F++L++ +N F  R Y E EF+  + KVL I+GF I  + +  GA G  G 
Sbjct: 205 INPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGAAGNDGY 264

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +G +YWR PG  G G  A +     F G VS+L+NAAF+   +E V +TA E ANPRKSV
Sbjct: 265 IGAKYWREPGSFG-GHTAID----HFKGVVSTLVNAAFSLGCSEFVALTAAEQANPRKSV 319

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPH 351
           P A KK+++++   ++GS+  IG LVP N  +L  S DS V  SP++I++ + G  ++PH
Sbjct: 320 PSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVIAVASHGVRVVPH 379

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
             NAVIL +++S  NS  Y  SR++  L++   AP +    ++ G P ++++ +   G L
Sbjct: 380 FINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMMVSITMGCL 439

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
            ++  S   E  F WLL I+G++  F+W  I ISH+RF +AL  +G   D L FKA+   
Sbjct: 440 CFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGLGFKAQTGV 499

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
             +YY+   M L  I Q +T   P      +   F   Y++  +F+A++  ++++ +  +
Sbjct: 500 WGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALYFGYKIYNKNWQ 559

Query: 527 LIWKIEDVDIDTDRR--DIEEVVWED 550
           L    E +D+D  R+  D + +  ED
Sbjct: 560 LFIPAEKIDLDLHRKIFDADVLKQED 585

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  276 bits (707), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 164/500 (32%), Positives = 267/500 (53%), Gaps = 13/500 (2%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            I  + + ++L  RH                     L   GP   +I +  + T +++V 
Sbjct: 80  DIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVI 139

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
            SLGE+A   PV   F V+  RF+ PSF  +    Y   W +   LEL      I++W  
Sbjct: 140 NSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDD 199

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVC-GAGVTG 231
            +   AW++IF+ L++  N+  V+ +GE EF ++ +K+LAI+GF I  + + C G    G
Sbjct: 200 TINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGG 259

Query: 232 PVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
            +G +YW +PG         +    +F G  S  + AAF+Y G E++ ++A E+ NPRK+
Sbjct: 260 YIGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKT 314

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY--VAASPFIISIQNSGTPIL 349
           +P A K+  + I F YI  L  +G LV YND +L +  S   VAASP +I+I+N G   L
Sbjct: 315 IPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGGIKGL 374

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P + NA+IL  I+S ANS VY  SR M  ++     P+ LS  +K G P  ++  T  FG
Sbjct: 375 PSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFG 434

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            L+++  S   E  F WL  ++G++  F W+ I+I+H+RF QA+  +  S D++P+ ++ 
Sbjct: 435 LLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQT 494

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP-SFDGID---FLAAYISCFLFIAIWIVFQLWFRC 525
               +YY    + L++I   +TS  P   DG D   F   Y+S  + IA +I  +L+F+ 
Sbjct: 495 GIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKN 554

Query: 526 -RLIWKIEDVDIDTDRRDIE 544
            R++  +E++D+ T R++++
Sbjct: 555 WRIMTPLEEIDLLTGRKEVD 574

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  278 bits (710), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 155/502 (30%), Positives = 272/502 (54%), Gaps = 19/502 (3%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           + + ++  +++ +K RH                     L  AGP G +I Y  MG+ +Y 
Sbjct: 123 HAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYC 182

Query: 111 VTQSLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
           + Q+ GEMA  +  +  +F  +    +  +FG +  ++Y   W     LEL      IQ+
Sbjct: 183 IIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQY 242

Query: 170 WTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGAG 228
           WT+ V    ++ IF+VL++ +N+F  + Y E EF+  S KVL + GF I  + +   GAG
Sbjct: 243 WTTTVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAG 302

Query: 229 VTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANP 288
             G +G +YW NPG        K+++  +F   +S+   AAF +  +E + I A E +NP
Sbjct: 303 NDGYIGAKYWHNPGAFRGD---KSID--RFKDVMSTFTTAAFAFGASEFIAIGASEQSNP 357

Query: 289 RKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTP 347
           R+++P A K +++RILF ++ S+  +G LVPYN  +L  S  +   ASP++I++ + G  
Sbjct: 358 RRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVR 417

Query: 348 ILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGL 407
           ++PH  NAVIL +++S ANS  Y   RI++ LS+   AP   +  ++ G P  ++I + L
Sbjct: 418 VVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSAL 477

Query: 408 FGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKA 467
           F  +A+   S+  E  F WLL I+G++  F+W+ I +SH+RF +A++ +G S D++ FK+
Sbjct: 478 FSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKS 537

Query: 468 KFMPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWF 523
           +     + YA   MTL +I + + S  P      D  +F   Y++  + I ++  +++  
Sbjct: 538 QVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI-- 595

Query: 524 RCRLIWKI----EDVDIDTDRR 541
            C+  WK+    +D+D+ + R+
Sbjct: 596 -CKRDWKLFIRAKDIDLVSHRK 616

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  276 bits (706), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 167/533 (31%), Positives = 282/533 (52%), Gaps = 28/533 (5%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
           A   I E  + ++L  RH                     L + GP   +I ++ + T ++
Sbjct: 84  AKEDINE-NLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLF 142

Query: 110 SVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
           +V  +LGE+A   PV   F V+  RF+ PS   A    Y   W +   LEL      I++
Sbjct: 143 TVINALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKY 202

Query: 170 WTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVC-GAG 228
           W   +   AW++IF+ ++   NM  V+ +GE EF ++ +K+LAI+GF I  + + C G  
Sbjct: 203 WNDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGP 262

Query: 229 VTGPVGFRYWRNPGPM---GPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEA 285
             G +G  YW +PG      PG         +F G  S  + AAF+Y G EL  ++A E+
Sbjct: 263 QGGFLGGHYWHDPGSFVGDKPG--------TQFKGLCSVFVTAAFSYSGIELTAVSAAES 314

Query: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQN 343
            +PRK++P+A K+  + +   Y+  L  IG LVP++DP+L +  S V  AASP +ISI+N
Sbjct: 315 KDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVISIKN 374

Query: 344 SGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVI 403
           +G   L  + NA+IL +I+S ANS VY  SR M  ++     P++LSR +K G P  +++
Sbjct: 375 AGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAIL 434

Query: 404 FTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDL 463
            T  FG L+++  S      F WL  ++G++  F W+ I+ SH+RF  A++ +  + D+L
Sbjct: 435 STLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDEL 494

Query: 464 PFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVF 519
           P+ ++     ++Y +  + L+++   +TS  P    + D   F   Y+S  + IA ++  
Sbjct: 495 PYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGH 554

Query: 520 QLWFR-CRLIWKIEDVDIDTDRRDIE------EVVWEDP--PPVTFWDKFWNV 563
           +L+ R  +++ K+ED+D++T R+ I+      E++ E       +F  +FW+V
Sbjct: 555 KLYVRNLQVLVKLEDMDLETGRKHIDAHEHRAEILAEKAALSQKSFIKRFWHV 607

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  276 bits (706), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 165/506 (32%), Positives = 268/506 (52%), Gaps = 16/506 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           ++++K+ +K RH                     L   GP   +I Y+ +  + Y + Q+ 
Sbjct: 88  DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAA 147

Query: 116 GEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GEMA   P + ++F  +S  F+S SFG A  ++Y F W     LEL      IQFW   +
Sbjct: 148 GEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFWNDKI 207

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPV 233
               +I IF+V LV ++ F V+ YGE EF     K+L I GF+I  + + CG AG  G +
Sbjct: 208 NPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYI 267

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G  YW NPG       A + +  +F      L+ A F++ G EL  ++  E +NPRKS P
Sbjct: 268 GATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTP 322

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHI 352
            A K+ ++RI+  Y+ ++  IG  VPYND +L  +  S   ASP++++    G  I+PHI
Sbjct: 323 VAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHI 382

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            NAVIL +++S ANS++Y G R++  L++   AP+ L   ++ G P  ++I   +FG +A
Sbjct: 383 INAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIA 442

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S+  E  F WL  I G++  F+W  I +SH+RF QA++ +G S D+L +KA     
Sbjct: 443 FVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIW 502

Query: 473 LAYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
            + Y +FF  L+ + Q + +  P       D   F   Y++  +++A +  + ++ R   
Sbjct: 503 GSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFT 562

Query: 527 LIWKIEDVDIDTDRR--DIEEVVWED 550
           L+  ++ +D+D  RR  D E +  ED
Sbjct: 563 LLNPLDKIDLDFHRRIYDPELMRQED 588

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  274 bits (701), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 172/494 (34%), Positives = 266/494 (53%), Gaps = 22/494 (4%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            IRE ++ R L  RH                     L N GP    + Y  +G +VY   
Sbjct: 41  NIRE-DLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTM 99

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
             LGEM+TF+P++ SF  ++++F S SF  A  + YWF+ A++ A +L+ +  ++ +W +
Sbjct: 100 LCLGEMSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHT 159

Query: 173 A---VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGV 229
           A    P      IFW  ++ +N+  VR YGE E+W+A +KV+AI+ F I  + +  G   
Sbjct: 160 ADHHFPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNP 219

Query: 230 TGP-VGFRYWRN-PGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
               +GF+ W +   P   G          F G+ S  ++A F Y GTE + +T GEA+N
Sbjct: 220 QHEYIGFKNWTHGEAPFVNG----------FKGFASLFVSACFAYGGTESITLTGGEASN 269

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTP 347
           P ++ P+ +K V +RIL FY+ S FFIG+ +PY+ P L++    V  SPF +  Q +GT 
Sbjct: 270 PVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPYDYPGLSTKS--VMTSPFTLVFQMAGTR 327

Query: 348 ILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAP-RILSRTNKNGVPWVSVIFTG 406
                 NAVIL+++ISA N  ++ GSRIM+ ++     P +I+ RTN+   P+V+V+ T 
Sbjct: 328 GAGSFMNAVILTSVISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITW 387

Query: 407 LFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFK 466
             G L    +  G    + WL NI GV+   +WL I I+ +RF + LE +G   D L FK
Sbjct: 388 AVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQG-KTDLLQFK 446

Query: 467 AKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCR 526
               P   Y+ + F   II+IQG+ +F P +   DF + Y+  F+F  ++I++ LW R  
Sbjct: 447 NWTYPFGPYFLVIFTVFIILIQGWQAFDP-WSVTDFFSVYLELFVFPFVYIIWWLWKRDW 505

Query: 527 LIWKIEDVDIDTDR 540
            + K ED+D  TDR
Sbjct: 506 FV-KYEDMDFVTDR 518

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  277 bits (709), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 164/509 (32%), Positives = 269/509 (52%), Gaps = 17/509 (3%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
           Q   A++K+ +K RH                    PL  AGP   +I Y  MGT +Y + 
Sbjct: 144 QDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCII 203

Query: 113 QSLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWT 171
           Q+ GE+A  +  V  SF  F    + P F  A  ++Y   W     LEL      I++WT
Sbjct: 204 QACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWT 263

Query: 172 SAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA-GVT 230
           + V    ++ IF+VL++ +N F  + Y E EF+    KV+ ++GF I  +C+  GA G  
Sbjct: 264 TKVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTD 323

Query: 231 GPVGFRYWRNPGPM-GPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
           G +G +YW +PG   G   I +      F G + + + AAF +  TE + +TA E +NPR
Sbjct: 324 GYIGAKYWNDPGAFRGQTKIER------FKGVMDTFVTAAFAFGATEFIALTAAEQSNPR 377

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQNSGTPI 348
           K++P A KKV +RIL  ++ S+  IG LVPYN D  + S     +ASP++++    G  +
Sbjct: 378 KAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVHV 437

Query: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLF 408
           + H  NAVIL +++S ANS  Y  SR++ GL++   AP+     ++NG P  S++   + 
Sbjct: 438 VQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAII 497

Query: 409 GALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAK 468
             +A+  TS      F WLL I+G++  F+W  I +SH+RF + ++ +G S  +L F+A+
Sbjct: 498 AVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQ 557

Query: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFR 524
                +YYA   + L ++ Q + +  P    + D  +F   Y++  + +A+++ F+LW R
Sbjct: 558 TGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRR 617

Query: 525 C-RLIWKIEDVDIDTDRR--DIEEVVWED 550
             RL  + +++D+ + R   D E +  ED
Sbjct: 618 DFRLFIRAKNIDLISHRIIFDEELLRQED 646

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  275 bits (703), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 158/501 (31%), Positives = 265/501 (52%), Gaps = 14/501 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +  +K  +K RH                     L   GP G +I Y+   T++Y V Q+ 
Sbjct: 65  QQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQAC 124

Query: 116 GEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
            E+   +  +  ++  +    +   FG A   +Y   WA    LEL      +++WTS+V
Sbjct: 125 CELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSV 184

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
               +++IF+V L+ ++ F  R Y E EF   S+KVL + GF+I  + +  GA   G +G
Sbjct: 185 NPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIG 244

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
            +YW +PG  G      +    +F G  S  + AAF Y G+E + +TA E ANPR+SVP+
Sbjct: 245 GQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPK 299

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDD--SYVAASPFIISIQNSGTPILPHI 352
           A K+ ++R++  ++  +  IG LVP+N  +L S +  S   ASPF+I+    G  ++PHI
Sbjct: 300 ATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHI 359

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            N +IL+++IS  NS +Y   RI+  L++  + P+I +  ++ G P V++IF  LFG +A
Sbjct: 360 INFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIA 419

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S   E  F WL  I G++  F+W  I++SHVRF +A+  +G S  +L ++A     
Sbjct: 420 FVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGAL 479

Query: 473 LAYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
            +YYAIFF  +++I Q + +  P       D   F   Y++  + +  ++ ++LW R  R
Sbjct: 480 GSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFR 539

Query: 527 LIWKIEDVDIDTDRRDIEEVV 547
           L+    +VD+ + R+  +E V
Sbjct: 540 LVIPSSEVDLLSHRQIFDEEV 560

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  275 bits (702), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 158/505 (31%), Positives = 271/505 (53%), Gaps = 21/505 (4%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
            +++K+ +K RH                     L  AGP G +I Y     ++Y + Q+ 
Sbjct: 61  SSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAA 120

Query: 116 GEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GE+   +  +T ++T +S   + P+ G +  ++Y   W   F L+L      I++WT   
Sbjct: 121 GELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWTDTN 180

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPV 233
           P + +++I + L+V +N+F  + Y E EF   + KVL ++GF+I  + + CG AG  G +
Sbjct: 181 PDI-FVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYI 239

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G RYW  PG    G          F G       AAF Y G E++ +TA E  NPRKS+P
Sbjct: 240 GARYWHTPGAFSTG----------FKGVCYVFCYAAFAYGGIEVMVLTASEQENPRKSIP 289

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIF 353
            A KKV++RIL  Y+ +   +  LVPY+ P+LTS  S   ASPF+I+I + G  ++PHI 
Sbjct: 290 SACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASRASPFVIAIASHGISVVPHII 349

Query: 354 NAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAY 413
           NAVIL  ++S  NS++Y   R++  LS+   AP++ +  ++ G P +  +     G LA+
Sbjct: 350 NAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLLAF 409

Query: 414 METSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGL 473
           +  S   E  F+WLL I+G++  F W+ I +SHVRF  A++ +G S  ++ +K++     
Sbjct: 410 IAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTGYWG 469

Query: 474 AYYAIFFMTLIIIIQGFTSFCPSFDG-----IDFLAAYISCFLFIAIWIVFQLWFRC-RL 527
           +++AI     +++ Q + +  P  +G      DF  +Y++  + I I+  ++++++  RL
Sbjct: 470 SWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYKDWRL 529

Query: 528 IWKIEDVDIDTDRR--DIEEVVWED 550
                +VD+++ R+  D +E+  ED
Sbjct: 530 CIPATEVDLNSHRKIFDEDELKQED 554

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  275 bits (704), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 166/511 (32%), Positives = 265/511 (51%), Gaps = 16/511 (3%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           N    ++++K+ +K RH                     L   GP   +I Y  +  + Y 
Sbjct: 83  NSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYF 142

Query: 111 VTQSLGEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
           + Q+ GEMA   P + ++F  +S  F+S  FG A  ++Y F W     LEL      I+F
Sbjct: 143 MIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKF 202

Query: 170 WTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AG 228
           W   +    +I IF+V L+ ++ F V+ YGE EF     K+L I GF+I  + + CG AG
Sbjct: 203 WNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAG 262

Query: 229 VTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANP 288
             G +G +YWRNPG       A + +  +F      L+ A F++ G EL  ++  E ANP
Sbjct: 263 NDGYIGGKYWRNPGAF-----AGDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQANP 317

Query: 289 RKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTP 347
           RK+ P A K+ ++RIL  Y+ ++  IG  VPYND +L  +  S   ASP++++    G  
Sbjct: 318 RKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVK 377

Query: 348 ILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGL 407
           ++PHI NAVIL ++IS ANS++Y G R+M  L++    P+ L   ++ G P +++I   +
Sbjct: 378 VVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSV 437

Query: 408 FGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKA 467
           FG + ++  S+  E  F WL  I G++  F+W  I +SH+RF QA++ +G S D+L +KA
Sbjct: 438 FGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

Query: 468 KFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLA-AYISCFLFIAIWIVFQLWFRC- 525
                 + Y +FF  L+ I Q + +  P  +G    A ++   +L   IWI F L +   
Sbjct: 498 TTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYMIY 557

Query: 526 ----RLIWKIEDVDIDTDRR--DIEEVVWED 550
                 +  ++ +D+D  R   D E +  ED
Sbjct: 558 NRDFTFLNPLDKIDLDFHRHIYDPELMRQED 588

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  274 bits (701), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 180/583 (30%), Positives = 294/583 (50%), Gaps = 38/583 (6%)

Query: 1   MDKKQEEPLKNGKIKS--------------SSYELDD-------YPLHRRTNSVHXXXXX 39
           M KK  E L N K+ +              SS +L D         LH   NS       
Sbjct: 1   MSKKSLENLSNEKLPATECGSSNSNLRESISSNDLSDGDRGFVNRKLHNFCNSFKRANSD 60

Query: 40  XXXXXXXXXXA--NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGA 97
                     A  N     ++ K+ +K RH                     L   GP G 
Sbjct: 61  TFDASQDLEGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGL 120

Query: 98  LIAYLFMGTLVYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITF 156
           LI Y  +  + Y + Q+ GEMA   P +  +F V+S  F+S SFG A  ++Y   W    
Sbjct: 121 LIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVL 180

Query: 157 ALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGF 216
            LEL      I++W S++   A+I+IF+ ++V ++ F    YGE EF  ++ KV  I GF
Sbjct: 181 PLELITASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGF 240

Query: 217 LIYCLCMVCGAGVTGPVGF-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGT 275
           +I  + + CG   TG      YWRNPG    G     +   K + +V  L+ A F+Y G 
Sbjct: 241 IILSIVINCGGAGTGGYIGGEYWRNPGAFAGG---SPIGHFKGIAYV--LVTAYFSYGGM 295

Query: 276 ELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL--TSDDSYVA 333
           EL  +T  E ANPRK+VP A KK ++RIL  Y+ ++  IG LVPYN  +L  +S  S   
Sbjct: 296 ELFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATH 355

Query: 334 ASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTN 393
           ASP++I++ + G  ++PHI NAVIL +++S  NS +Y   R++  L++   AP+I S  +
Sbjct: 356 ASPYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVD 415

Query: 394 KNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQAL 453
           + G P V+++   +FG L+++  S   E  F WL  I G++  F+W  I +SHVRF  A+
Sbjct: 416 RAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAM 475

Query: 454 EYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYIS 508
           +Y+G S  +L +K+K     + YAIFF  ++ + Q + +  P       D   F  +Y++
Sbjct: 476 KYQGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADAEAFFQSYLA 535

Query: 509 CFLFIAIWIVFQLWFRC-RLIWKIEDVDIDTDRRDIEEVVWED 550
             ++I+ ++ ++++ +  +L+  ++++D+++ R   ++ + + 
Sbjct: 536 FPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQ 578

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  275 bits (702), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 159/505 (31%), Positives = 272/505 (53%), Gaps = 14/505 (2%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           + A +KR++K RH                     L   GP G  I Y  MG+ +YS+ Q+
Sbjct: 98  KGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQA 157

Query: 115 LGEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
            GE+A   P +T +F  +    + P+   A   +Y   W   F LE+      I++W ++
Sbjct: 158 AGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTS 217

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGP 232
           +    W  IF+V+++ +NM     Y E +F+  + K+L   GF I  + + CG AG +  
Sbjct: 218 INPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVY 277

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +G +YW +PG         +   ++F   VS+L+ AAF +  +E V +TA E ANPRK++
Sbjct: 278 IGGKYWNDPGAFN-----GDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAI 332

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL-TSDDSYVAASPFIISIQNSGTPILPH 351
           P A K+V++RI+  Y+ S+  +G LVPYN P+L  S  S V +SP++I++ + G  ++P 
Sbjct: 333 PSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPS 392

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
             NAVIL +++S  N + Y  SRI+  LS+   AP+     ++ G P  ++I   L G +
Sbjct: 393 FINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCI 452

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
            ++  S+  E+ F WL+ ++G++  F+W  I ISHVRF +A++ +  S  +L F+++   
Sbjct: 453 CFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGV 512

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP--SFDGID---FLAAYISCFLFIAIWIVFQLWFRC- 525
             +YY IF M L+ I Q + +  P    DG D   F A Y++  +F+A++  F++W +  
Sbjct: 513 WGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDW 572

Query: 526 RLIWKIEDVDIDTDRRDIEEVVWED 550
           RL     ++D+ + R+  +E + + 
Sbjct: 573 RLYIPASEIDLISHRKIFDEEILKQ 597

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  273 bits (698), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 160/496 (32%), Positives = 268/496 (54%), Gaps = 19/496 (3%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
            + ++L  RH                     L   GP   +I ++ + + +++V  +LGE
Sbjct: 77  NLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGE 136

Query: 118 MATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV 177
           +A   P+   F V+  RF+ PSF  A    Y   W ++  LEL      I++W   +   
Sbjct: 137 LAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREINSD 196

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGAGVTGPVGFR 236
           AW++IF+V +  +NM  V+F+ E EF ++ IK+LAI+GF I  + + V G    G +G +
Sbjct: 197 AWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGK 256

Query: 237 YWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 296
           YW +PG         +   ++F G  S  + AAF+Y G E+  ++A E+ NPRK++P+A 
Sbjct: 257 YWNDPGAF-----HGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKAT 311

Query: 297 KKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPILPHIFN 354
           K+  + I F YI  L  IG+LVPYND +L S  S V  +ASP +I+I+N+G   LP + N
Sbjct: 312 KRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMN 371

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           A+IL  ++S ANS VYV SR+M  ++ +   P++ S+ +K G P  S+  T   G L+++
Sbjct: 372 AIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFI 431

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             S   E  F WL  I G++  F W+ I+++H+RF  AL+++  S D+L + ++     +
Sbjct: 432 AASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGS 491

Query: 475 YYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
           +Y +  + L++I   + S  P    S D   F   Y+S  + IA +I  +++ +    WK
Sbjct: 492 WYGVIILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKN---WK 548

Query: 531 ----IEDVDIDTDRRD 542
               +E++DID  +++
Sbjct: 549 WVIPLEEIDIDLGKKN 564

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  274 bits (700), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 169/558 (30%), Positives = 275/558 (49%), Gaps = 20/558 (3%)

Query: 8   PLKNGKIKSSSYE----LDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQI-REAEVKRE 62
           P    +   SSYE     D   +HR  NS                     I  + ++K+ 
Sbjct: 19  PKTTPQHSKSSYEPASRQDSTMIHRFVNSFKRAEQPPLKQDSDLEEDTDTIVTDTQLKKT 78

Query: 63  LKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFI 122
           +K RH                     L  AGP   +IAY  +  + Y + Q+ GEMA   
Sbjct: 79  MKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVY 138

Query: 123 P-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWIS 181
           P +  +F  +   F+S  FG A  ++++  W     LEL      +Q+W  ++    ++ 
Sbjct: 139 PTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYWNDSINADVYVV 198

Query: 182 IFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGAGVTGPVGFRYWRN 240
           IF+V L+ ++ F V+ YGE EF     K+L + GF+I+ + + V GAG +G +G +YW +
Sbjct: 199 IFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHD 258

Query: 241 PGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVV 300
           PG         + N  +F G    L+ A F+Y G EL  ++  E  NPR+S P A K+ +
Sbjct: 259 PGAF-----TSDTNAGRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTPTAAKQSI 313

Query: 301 FRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHIFNAVILS 359
           +RI+  Y+ ++  +G  VP N  +L  S  S   ASP++++    G  ++PHI NAVIL 
Sbjct: 314 YRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHASPYVLAASIHGVKVVPHIVNAVILI 373

Query: 360 TIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTG 419
           ++IS  NS +Y   R+M  L++   AP+ +   ++ G P  ++I   +FG + ++  S+ 
Sbjct: 374 SLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVACSSK 433

Query: 420 GEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIF 479
            E  FNWL  I G+A  F+W  I ISH+RF QA++ +  S D++ +K+ F    +Y+ +F
Sbjct: 434 EEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVF 493

Query: 480 FMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIWKIEDV 534
           F  L+ + Q + +  P          F  +Y++  +F A +  + +W R   L   +E V
Sbjct: 494 FNLLVFVAQFWVALAPPMYTEMSADTFFESYLAFPIFFAFYFGYMIWKRDFTLFSDLESV 553

Query: 535 DIDTDRR--DIEEVVWED 550
           D+D  RR  D E V  ED
Sbjct: 554 DLDYHRRIYDPELVKQED 571

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  274 bits (700), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 158/494 (31%), Positives = 265/494 (53%), Gaps = 18/494 (3%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           +KR LK RH                     L   GP   ++A++  G++VYSV Q++GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV- 177
              +PV+ S+  +  RF+ PSFG A  Y Y     +T  LE+      + +W        
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGV--TGPVGF 235
            ++++F+V ++ +N   V+ YGE EF  + IKVLAI+GF+I  + +VCG G   TG +G 
Sbjct: 204 GFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGT 263

Query: 236 RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 295
           +YW NPG    G          F G+ +  + +AF++ G+E+  + A E+ NPR+ +P+A
Sbjct: 264 KYWHNPGGFAHG----------FKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKA 313

Query: 296 IKKVVFRILFFYIGSLFFIGLLVPYNDPKL-TSDDSYVAASPFIISIQNSGTPILPHIFN 354
            K+V +RI  FY+ SL  IG LVPY +  L  S     +ASPF+I+I+ +G   LP + N
Sbjct: 314 AKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPSVIN 373

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
            VIL  ++S  N+ V+  SR    L+     P+  +  ++ G P   +I + +FG L+++
Sbjct: 374 VVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFL 433

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
            +S      F W+L ++G+  FF+W  I + H+RF Q L  +G S D+L FKA+     +
Sbjct: 434 SSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGS 493

Query: 475 YYAIFFMTLIIIIQGFTSFCP---SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIWK 530
            Y I  +++++  Q + +  P   S     F   Y+S  + I  ++  +++ R  RL+  
Sbjct: 494 IYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRNWRLVIP 553

Query: 531 IEDVDIDTDRRDIE 544
            +++D+DT RR+++
Sbjct: 554 AKELDLDTGRREVD 567

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  274 bits (700), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 168/522 (32%), Positives = 277/522 (53%), Gaps = 21/522 (4%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
            + ++L  RH                     L + GP   +I ++ + T +++V  SLGE
Sbjct: 77  SLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGE 136

Query: 118 MATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV 177
           +A   PV   F V+  RF+ PSF  A    Y   W +   LEL      I++W S +   
Sbjct: 137 LAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNSTINSD 196

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVC-GAGVTGPVGFR 236
           AW++IF+ ++   NM  V+ +GE EF ++ +K+LAI+GF I  + + C G    G +G +
Sbjct: 197 AWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGGK 256

Query: 237 YWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 296
           YW NPG         + +  KF G  S  + AAF+Y G E+  ++A E+ +PRK++P+A 
Sbjct: 257 YWHNPGAF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAA 311

Query: 297 KKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPILPHIFN 354
           K+  + I   Y+  L  +G LVPY+DP+L S  S V  AASP +I+I+N G   L  + N
Sbjct: 312 KRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKGLDSLMN 371

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           A+IL +IIS ANS VY  SR M  ++     P+ L + +K G P  + + T  FG L+++
Sbjct: 372 AIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFI 431

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             S      F WL  ++G++  F W+ I+ISH+RF QA+  +  S D++P+ ++     +
Sbjct: 432 AASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVWGS 491

Query: 475 YYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIW 529
            Y +  + L+++   +TS  P    S D   F   Y+S  + I  +I  +L+F+    + 
Sbjct: 492 LYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSWVV 551

Query: 530 KIEDVDIDTDRRDIE------EVVWEDP--PPVTFWDKFWNV 563
            +E++D+DT R+ ++      EV+ E+     ++F  +FW+V
Sbjct: 552 TLEEMDLDTGRKALDPHLHRAEVIAEEAAVAKMSFIKRFWHV 593

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  273 bits (699), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 169/496 (34%), Positives = 266/496 (53%), Gaps = 12/496 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
            A +K  LK RH                     L  AGP G LI +   GT++Y +  ++
Sbjct: 78  HAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAM 137

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW-TSAV 174
           GE++   P++  FT ++ RF+  SFG AN + Y   W     LE+      + +W T   
Sbjct: 138 GELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGTDPK 197

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
               ++++FWV++V +N+F V+ YGE EF  + IKVL ++GF+I  + + CG G  G   
Sbjct: 198 YRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYI 257

Query: 235 F-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
             +Y+ +PG         +   A+F G  S  + AAF++ G+EL+GI A E+A PRKSVP
Sbjct: 258 GGKYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVP 312

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPHI 352
           +A K+V +RI  FY+ SL  +GLLVPY D +L    S   AASPF+I+I + G   LP +
Sbjct: 313 KAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPFVIAITSHGIRGLPSV 372

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            N VIL  ++S  NS VY  SR +  L++    P+I    +++G P   + FT  FG +A
Sbjct: 373 VNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVA 432

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S      F WLL ++G++  F+W  I   H+RF  AL  +G S D+LPFKA     
Sbjct: 433 FVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFKAPAGIY 492

Query: 473 LAYYAIFFMTLIIIIQGFTSFCPSFDGID---FLAAYISCFLFIAIWIVFQLWFRC-RLI 528
            + + +F + L+ + Q + +  P         F  +Y+S  + +A +   +L+ R  +L+
Sbjct: 493 GSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGHKLYARNWKLL 552

Query: 529 WKIEDVDIDTDRRDIE 544
             +  +DIDT RR+++
Sbjct: 553 IPLSKLDIDTGRREMD 568

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  275 bits (703), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 157/502 (31%), Positives = 269/502 (53%), Gaps = 14/502 (2%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
           ++ ++L  RH                     L   GP   +I ++ + T +++V  SLGE
Sbjct: 140 DMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGE 199

Query: 118 MATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV 177
           +A   PV   F+V+  +F+ PSF  A    Y   W +   LEL      I++W S++   
Sbjct: 200 LAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSINSD 259

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP-VGFR 236
           AW+SIF+V +   NM  V+ +GE EF ++ +K+LAI+GF I  + + CG G +   +G +
Sbjct: 260 AWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGGK 319

Query: 237 YWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 296
           YW +PG           + +KF G  S  + AAF++ G E+  ++A E+ NPR+++P+A 
Sbjct: 320 YWHDPGAF-----VGTTSGSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKAA 374

Query: 297 KKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPILPHIFN 354
           K+  + I   Y+  L  +G LVPYNDP+L +  S V  A+SP +I+I+N     LP + N
Sbjct: 375 KRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSLMN 434

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           A+IL  I+S ANS+VY  SR M  +SK +  P++ ++ ++ G P  ++ F   FG L+++
Sbjct: 435 AIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSFV 494

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             S      F WL  ++G++  F W+ I++ H+RF Q +  + IS D+LPF ++     +
Sbjct: 495 AASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIWGS 554

Query: 475 YYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIW 529
            Y I  + L+++   +TS  P      +   F   Y+S  + +  +I  +++F+  R   
Sbjct: 555 IYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRWYI 614

Query: 530 KIEDVDIDTDRRDIE-EVVWED 550
               +D+ + R+ ++ EVV E+
Sbjct: 615 PASKMDLHSGRKQVDLEVVREE 636

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  275 bits (704), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 162/512 (31%), Positives = 265/512 (51%), Gaps = 18/512 (3%)

Query: 52  GQIRE---AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLV 108
           GQ +E   AE+++ +K RH                    PL  AGP   +I Y  MGT +
Sbjct: 149 GQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCI 208

Query: 109 YSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQII 167
           Y + Q+ GEMA  +  +T SF  F    + P F  A  ++Y   W     LEL      I
Sbjct: 209 YCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTI 268

Query: 168 QFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA 227
           Q+WT+ V    ++ IF+VL++ +N F  + Y E EF   + KVL I GF I  +C+  GA
Sbjct: 269 QYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGA 328

Query: 228 -GVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAA 286
            G  G +G +YW +PG              +F G + + + AAF +  TE + +TA E +
Sbjct: 329 AGTDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQS 383

Query: 287 NPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQNSG 345
           NPRK++P A KK+++R+L  ++ ++  IG LVPY+ D  L S  S   ASP++++I   G
Sbjct: 384 NPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHG 443

Query: 346 TPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFT 405
             +  H  NAVIL ++IS  NS  Y  SR++  L++   AP+I    ++ G P +++  +
Sbjct: 444 VRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCS 503

Query: 406 GLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPF 465
            +   +A+  TS      F WL+ I G++  F+W  I +SH+RF +A++ +G S  ++ +
Sbjct: 504 AVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGY 563

Query: 466 KAKFMPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQL 521
            ++     + YA   M L +I Q + +  P    + D   F + Y++  + I  +  +++
Sbjct: 564 LSQTGILGSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKI 623

Query: 522 WFRC-RLIWKIEDVDIDTDRR--DIEEVVWED 550
           W R  RL  + +D+D+ + R   D E +  ED
Sbjct: 624 WKRDWRLFIRAKDIDLISHRTIYDEELLRQED 655

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  273 bits (699), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 164/506 (32%), Positives = 265/506 (52%), Gaps = 16/506 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           ++++K+ +K RH                     L   GP   +I Y+ +  + Y + Q+ 
Sbjct: 88  DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFVTYFMIQAA 147

Query: 116 GEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GEMA   P + ++F  +S  F+S  FG A  ++Y F W     LEL      IQ+W   +
Sbjct: 148 GEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELITASMTIQYWNDKL 207

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPV 233
               +I IF++ L+ +++F V+ YGE EF     K+L I GF+I  + + CG AG  G +
Sbjct: 208 NPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVINCGGAGDDGYI 267

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G  YW NPG       A + + A+F      L+   F++ G EL  ++  E +NPRKS P
Sbjct: 268 GGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQSNPRKSTP 322

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHI 352
            A K+ ++RI+  Y+ ++  IG  VPYND +L  +  S   ASP++++    G  I+PHI
Sbjct: 323 VAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHI 382

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            NAVIL +++S ANS++Y G R++  LS+   AP+ L   ++ G P  ++I   +FG +A
Sbjct: 383 INAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCIFGVIA 442

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S+  E  F WL  I G++  F+W  I +SH+RF QA++ +G S D+L +KA     
Sbjct: 443 FVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIW 502

Query: 473 LAYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-----R 526
            + Y  FF  L+ I Q + +  P   DG   + ++   +L   IW+ F   +        
Sbjct: 503 GSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGYMIYNRDFT 562

Query: 527 LIWKIEDVDIDTDRR--DIEEVVWED 550
           L+  ++ +D+D  RR  D E +  ED
Sbjct: 563 LLNPLDKIDLDFHRRIYDPELIRQED 588

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  273 bits (697), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 156/514 (30%), Positives = 269/514 (52%), Gaps = 27/514 (5%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G    + +KR LK RH                     +   GP+G ++ +   G+ +  
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 129

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+    PV  +F  +  RFL PS       +Y   W     LE+      +Q+W
Sbjct: 130 TVHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
            S++  V W++IF+ ++V++N+F  R +GE EF  +++K + + GF+I C+ ++CG G  
Sbjct: 190 NSSIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPD 249

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              +G +YW +PG +  G          F G +S L+ A+++  G E+  + +GE  +P 
Sbjct: 250 HEFIGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGIEMTCLASGE-TDP- 297

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K +P AIK+V +RI+FF++ SL  +G LVPY +  L    S V  SPF+I+I+     +L
Sbjct: 298 KGLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVL 356

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P I NAVIL +++S  NS ++  SR +  ++   L P      ++ G P V ++   LFG
Sbjct: 357 PSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 416

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  S      FNWL+ I G+A    WL I++SHVRF  A++ +G S D+L F +  
Sbjct: 417 LLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAV 476

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP-------SFDGIDFLAAYISCFLFIAIWIVFQLW 522
               + Y+     LI+I Q + S  P             F   Y+   + + I+++ +++
Sbjct: 477 GIWGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFIFVIHKIY 536

Query: 523 FRCRL-----IWKIEDVDIDTDRRDIE-EVVWED 550
           +RC++     + +++D+D++TDR+DI+ E+V ++
Sbjct: 537 YRCQMGKWWGVKELKDIDLETDRKDIDIEIVKQE 570

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  272 bits (695), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 175/503 (34%), Positives = 266/503 (52%), Gaps = 19/503 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
            A +KR LK RH                     L  AGP G LI +   GT++Y +  ++
Sbjct: 73  NAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           GE+A   P+   FT ++ RF+  SFG A   +Y   W +   LE+      + +W +   
Sbjct: 133 GELAVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDK 192

Query: 176 IV-AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
               ++++F+V++VA+N F V+ YGE EF  + IKV+ ++G++I  + +VCG G  G   
Sbjct: 193 YRDGFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYI 252

Query: 235 F-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
             R W NPG    G          F G  S  + AAF++ G+ELVG+ A E ANPRKS+P
Sbjct: 253 GGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLP 302

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPHI 352
            A K+V +RI  FYI +L  +GLLVPY   +L    S   AASPF+ISIQN+G   LP +
Sbjct: 303 SAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSV 362

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            N VIL  ++S  NS V+  SR M  L+     P+I    ++ G P V +I T +FG L+
Sbjct: 363 INVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLS 422

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S      F+WLL ++G++  F+W  I + H+R  +AL  +  +  +L F A     
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVW 482

Query: 473 LAYYAIFFMTLIIIIQGFTSFCPSFD---GIDFLAAYISCFLFIAIWIVFQLWFRC-RLI 528
            + Y    + LI++ Q + +  P  D      F  AY+S  + IA +I  ++W +  +L 
Sbjct: 483 GSVYGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLF 542

Query: 529 WKIEDVDIDTDRR--DIEEVVWE 549
            + +++DIDT RR  DIE +  E
Sbjct: 543 IRAKNIDIDTGRRETDIEALKQE 565

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  273 bits (699), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 160/493 (32%), Positives = 259/493 (52%), Gaps = 19/493 (3%)

Query: 60  KRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMA 119
           K  +K RH                     L  +GP G ++ Y  +  + Y V Q+ GEMA
Sbjct: 155 KGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMA 214

Query: 120 TFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVA 178
              P +   F  +   F+S  FG A  +++  +W     LEL      +++WT+++    
Sbjct: 215 IAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPLELITSSITVKYWTTSINPDI 274

Query: 179 WISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVGFRY 237
           ++ IF++ L+ ++   +R Y E EF+  S K+L I GF+I+ + + CG AG  G +G +Y
Sbjct: 275 FVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGHDGYIGGKY 334

Query: 238 WRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 297
           W +PGP      A +   A+F      LINA F+Y GTEL  ++  E  NPRK+VP A K
Sbjct: 335 WHDPGPF-----ASDNGAARFKEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPVAAK 389

Query: 298 KVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVI 357
             V+R+   Y+ ++  IG  VPYN P L  + +   ASP++++ Q  G  I+PH  NAVI
Sbjct: 390 TSVYRVAIIYLLTMILIGFNVPYNSPDLMGNANSKDASPYVLAAQIHGVKIVPHFINAVI 449

Query: 358 LSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETS 417
           L ++IS ANS ++ G R++  L++   AP+ L+  ++ G P +++    LFG +A+  TS
Sbjct: 450 LLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIAFAATS 509

Query: 418 TGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYA 477
              +  F WL  I G++  F+W  I +SH+RF  A++Y G S D++ +KA      +YY 
Sbjct: 510 KKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYKAITGIWGSYYG 569

Query: 478 IFFMTLIIIIQGFTSFCPSFDGIDFLA-AYISCFLFIAIWIVFQLWFRCRLIWK------ 530
           +FF  L++I Q + +      G    A ++   +L   IW+ F L   C +I+       
Sbjct: 570 LFFNLLVLIAQFWVALSAPGSGGQVTAISFFESYLAFVIWVFFYL---CYMIYNKDWTIL 626

Query: 531 --IEDVDIDTDRR 541
             ++D+D+D  RR
Sbjct: 627 IPLKDIDVDYQRR 639

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  273 bits (697), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 156/499 (31%), Positives = 272/499 (54%), Gaps = 13/499 (2%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +  ++K+ +K RH                     L+ AGP   +I Y  MGT +Y + Q+
Sbjct: 116 KSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQA 175

Query: 115 LGEMAT-FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
            GE+A  +  +   F  +    + P+ G +  ++Y   W     LEL      I++WT+ 
Sbjct: 176 AGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTK 235

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGP 232
           V    ++ IF+VL++A+N F  R Y E EF+    KVL + GF I  + +  G AG  G 
Sbjct: 236 VDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGY 295

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +G +YW +PG        K+++  +F G + + + AAF +  TE + +TA E +NPRK++
Sbjct: 296 LGAKYWHDPGAFNGD---KSID--RFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAI 350

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQNSGTPILPH 351
           P A KKV++RI+  ++ S+  IG LVPYN D  L S  S + ASP++I++ + G  ++PH
Sbjct: 351 PSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVVPH 410

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
             NAVIL +++S  NS  Y  SR++  L++   AP+     ++ G P+ +++ + LFG +
Sbjct: 411 FINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVI 470

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           A+  TS      F+WLL I+G++  F+W+ I +SH+RF +A++ +G S  ++ + ++   
Sbjct: 471 AFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGV 530

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
             + YA   + L +I Q + +  P      D  +F   Y++  + IA +  +++W R  +
Sbjct: 531 YGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRDWK 590

Query: 527 LIWKIEDVDIDTDRRDIEE 545
           L  + +D+D+DT R+  +E
Sbjct: 591 LFIRAKDIDLDTHRQIFDE 609

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  271 bits (693), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 160/514 (31%), Positives = 267/514 (51%), Gaps = 27/514 (5%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G    + +KR LK RH                     +   GP+G +I +   G+ +  
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIG 129

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+    PV  +F  +  RFL PS       +Y   W     LE+      +Q+W
Sbjct: 130 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
            S++  V W++IF+ ++V++N+F VR +GE EF  ++IK + + GF+I C+ ++CG G  
Sbjct: 190 NSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPD 249

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              +G +YW +PG +  G          F G +S L+ A+++  G E+  + +GE  +P 
Sbjct: 250 HEFIGAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEMTCLASGE-TDP- 297

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K +P AIK+V +RILFF++ SL  +G LVPY +  L    S V  SPF+I+I+      L
Sbjct: 298 KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKAL 356

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P I NAVIL +++S  NS ++  SR +  ++   L P      ++ G P V ++   LFG
Sbjct: 357 PSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 416

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  S      FNWL+ I G+A    WL I++SH+RF  A++ +G S D+L F +  
Sbjct: 417 LLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAV 476

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP-------SFDGIDFLAAYISCFLFIAIWIVFQLW 522
               + Y+     LI+I Q + S  P             F   Y+   + + I+IV +++
Sbjct: 477 GIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIY 536

Query: 523 FRCRL-----IWKIEDVDIDTDRRDIE-EVVWED 550
           ++C+      +  ++D+D++TDR+DI+ E+V ++
Sbjct: 537 YKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQE 570

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  271 bits (693), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 163/508 (32%), Positives = 264/508 (51%), Gaps = 28/508 (5%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G      +KR LK RH                     +   GP+  +I +   G+ +  
Sbjct: 77  DGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIG 136

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+    PV  +F  +S RFL PS       +Y   W     LE+      +Q+W
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYW 196

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
             ++  V W++IF+  +V++N+F  R +GE EF  +S+KVL I GF+I C+ ++CG G  
Sbjct: 197 NQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPD 256

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              VG +YW +PG +  G          F G +S L+ A+++  GTE+V + +GE  +P 
Sbjct: 257 HDFVGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLASGE-TDP- 304

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K +P AIK+  +RILFF++ SL  IG LVPY +  L    S V  SPF+I+I+     +L
Sbjct: 305 KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS-VNNSPFVIAIKLHQIKVL 363

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P I NAVIL +I+S  NS ++  SR +  ++   L PR     ++ G P   +I   LFG
Sbjct: 364 PSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFG 423

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPF-KAK 468
            LA++  S+     F+WL+ I G+A    WL I+ISH+RF  A++ +G S D+L F  A 
Sbjct: 424 LLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAV 483

Query: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCP-------SFDGIDFLAAYISCFLFIAIWIVFQL 521
            + G AY A+   +LI++ Q + +  P       S     F  +Y+   + I +++  ++
Sbjct: 484 GIWGSAYSAV-INSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKI 542

Query: 522 WFRCRL-----IWKIEDVDIDTDRRDIE 544
           ++R +      +  +  +D++TDR++I+
Sbjct: 543 FYRYKTGKWWSMLPLNKIDLETDRKNID 570

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  271 bits (693), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 153/500 (30%), Positives = 269/500 (53%), Gaps = 13/500 (2%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           +K+ ++ RH                     L NAGP G +I Y  MG+++Y + Q+ GEM
Sbjct: 130 LKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQATGEM 189

Query: 119 A-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV 177
           A  +  +   + V+    +   FG A  ++Y   W     LEL      I++WT++V   
Sbjct: 190 AIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTTSVNSD 249

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVGFR 236
            +++IF+ L++ +N+F  + Y E EF+    KVL ++GF I  + +  G AG  G +G  
Sbjct: 250 IFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGYLGGL 309

Query: 237 YWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 296
           YW  PG         + +   F G   +L+ AAF Y GTE + +TA E +NPR ++P A 
Sbjct: 310 YWHTPGAF-----RGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRAAIPSAA 364

Query: 297 KKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHIFNA 355
           KKV++RI+  Y+ S+  IG LVP++  +L  SD S  +ASP++++    G  ++PH  NA
Sbjct: 365 KKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRVVPHFINA 424

Query: 356 VILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYME 415
           VIL +++S  NS  Y  SR++  L++   AP+     ++ G P  +++ + LFG +A+  
Sbjct: 425 VILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFGVIAFCA 484

Query: 416 TSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAY 475
            S      F WLL I+G++  F+W  I +SH+RF  A++ +G S  ++ + A+     ++
Sbjct: 485 ASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQTGVWGSW 544

Query: 476 YAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIWK 530
           YA+F M LI I Q + +  P         +F   Y++  + I +++ ++++++   L+ K
Sbjct: 545 YALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYKDWTLLIK 604

Query: 531 IEDVDIDTDRRDIEEVVWED 550
            ED+D+ + R+  +E + ++
Sbjct: 605 AEDIDLQSHRQIFDEDLLKE 624

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  270 bits (689), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 161/507 (31%), Positives = 266/507 (52%), Gaps = 17/507 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
             E K+ +K RH                     L+ AGP   +IAY  +  + Y + Q+ 
Sbjct: 90  HQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAA 149

Query: 116 GEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GEMA   P +  SF  ++  F+S  FG A  +++   W     LEL      I++W +++
Sbjct: 150 GEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSI 209

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPV 233
               ++ IF+V L+ ++ F V+ YGE EF   + K+L I GF+I+ + + CG AG  G +
Sbjct: 210 DPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYI 269

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G +YW +PG       A +   ++F G   +L+NA F+Y G EL  ++  +  NPRKS P
Sbjct: 270 GGKYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTP 324

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL--TSDDSYVAASPFIISIQNSGTPILPH 351
            A K  V+RI+  Y+ ++  IG +VP+N  +L   S  + + ASP++++    G  ++PH
Sbjct: 325 AAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPH 384

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
           I NAVIL  +IS ANS++Y G R++  L++   APR LS  ++ G P  +++ + L G +
Sbjct: 385 IINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVI 444

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
            +  TS   E  F WL  I+G++  F+W  I  SH+RF +A++ +  S D L +KA    
Sbjct: 445 GFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGL 504

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLA-AYISCFLFIAIWIVFQLWFRC----- 525
             +Y+ + F  L+   Q + +  P   G    A ++ + +L + IW+VF   + C     
Sbjct: 505 WGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDF 564

Query: 526 RLIWKIEDVDIDTDRR--DIEEVVWED 550
            ++  +  VD+D  R+  D E +  ED
Sbjct: 565 TVLTDLNQVDLDNHRKVYDPEFLRQED 591

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  269 bits (688), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 157/507 (30%), Positives = 270/507 (53%), Gaps = 14/507 (2%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            I  + + ++L  RH                     L   GP   +I ++ + T +++V 
Sbjct: 83  DIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVI 142

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
            SLGE+A   PV   F+V+  RF+ PS   +    Y   W +   LEL      I++W  
Sbjct: 143 NSLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYWND 202

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
            +   AW+SIF+ ++  +NM  V+ +GE EF ++ IK+LAI+GF I  + + CG G  G 
Sbjct: 203 KINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGG 262

Query: 233 VGF-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
               +YW +PG         +   ++F G  S  + AAF+Y G E++ ++A E+ +PRK+
Sbjct: 263 YIGGKYWHDPGAF-----VGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKT 317

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYV--AASPFIISIQNSGTPIL 349
           +P A K+  + I   Y+  L  IG LVPY+DP+L +  S V  A+SP +I+I+N G   L
Sbjct: 318 IPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIAIENGGIKGL 377

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P + NA+IL  ++S ANS VY  SR M  ++     P+ L R +K G P  + + T  FG
Sbjct: 378 PSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFG 437

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            ++++  S      F WL  ++G++  F W+ I+ISH+RF +A++ +G S +++P+ ++ 
Sbjct: 438 LISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQV 497

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
               ++Y    + L++I   +TS  P      +   F   Y+S  + +A ++  + +F+ 
Sbjct: 498 GVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFKN 557

Query: 526 -RLIWKIEDVDIDTDRRDIE-EVVWED 550
            RL     ++D+D+ +RDI+ E++ E+
Sbjct: 558 WRLFTPYNEIDLDSGKRDIDLELLREE 584

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  270 bits (690), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 165/558 (29%), Positives = 286/558 (51%), Gaps = 19/558 (3%)

Query: 1   MDKKQEEPLKNGKIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIREAEVK 60
            +K QEE + N    S S      P  +  +S                        +++K
Sbjct: 65  QEKTQEETIHNSDGSSRS------PFGKFVDSFKRVDEKQTTSDLESGLGEVPGENSDLK 118

Query: 61  RELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMA- 119
           + +K+RH                     L +AGP G +I Y  MG+ +Y + Q+ GE+A 
Sbjct: 119 QTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQACGELAV 178

Query: 120 TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAW 179
            +  + S+F ++    +  +FG A  ++Y   W     LEL      I++WT++V    +
Sbjct: 179 CYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDIF 238

Query: 180 ISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVGFRYW 238
           +SIF+VL++ +N F  R Y E EF+  S KVL + GF I  + + CG AG +G +G +YW
Sbjct: 239 VSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGYIGAKYW 298

Query: 239 RNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKK 298
            +PG         N     F G +++   AAF +  +E + +TA E +NPRK++P+A K 
Sbjct: 299 HSPGAFN-----GNRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAIPKAAKM 353

Query: 299 VVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHIFNAVI 357
           +++RILF ++ S+  IG LVPYN P L  S      ASP+++++ + G  ++PH  NAVI
Sbjct: 354 MIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAVASHGVRVVPHFINAVI 413

Query: 358 LSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETS 417
           L +++S  NS  Y  SR++  L++   AP++ +  +K G P V+++ + LF  +A+   S
Sbjct: 414 LLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTIAFCAAS 473

Query: 418 TGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYA 477
              E  F WLL I+G++  F+W+ I ISH+RF +AL+ +G S  ++ FK++     + YA
Sbjct: 474 PKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQVGIYGSLYA 533

Query: 478 IFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIW-KIE 532
              + L +I Q + +  P      D  +F   Y++  + + ++  +++  R    W    
Sbjct: 534 ATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKIRKRDWKFWIPAH 593

Query: 533 DVDIDTDRRDIEEVVWED 550
            +D+ + R+  +E + + 
Sbjct: 594 RIDLVSHRKVFDEDILKQ 611

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  268 bits (685), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 162/513 (31%), Positives = 271/513 (52%), Gaps = 18/513 (3%)

Query: 51  NGQIREAE---VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTL 107
           +G+I   +   +++ ++ RH                     L   GP G LI YL +  +
Sbjct: 52  DGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIV 111

Query: 108 VYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQI 166
            Y +  + GEMA   P +  +F  +S  F+S  FG A  +++   W   F LEL     +
Sbjct: 112 SYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIV 171

Query: 167 IQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG 226
           I++W  +V    ++ IF++ ++ ++ F  R YGE EF     KVL I+GF+I  + +  G
Sbjct: 172 IKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVG 231

Query: 227 A-GVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEA 285
           A G TG +G RYWRNPG    G     L    ++     L+ A F++ G EL  ++  E 
Sbjct: 232 AIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYV-----LVTAYFSFGGMELYALSVNEL 286

Query: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNS 344
            NP+ ++P A KK V+RIL  Y+ ++  IG LVP++  +L  S  + V  SP++++I+  
Sbjct: 287 PNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMH 346

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G  +LPHI NAVIL ++IS  NS +Y   R++  L++   AP+ L   ++ G P +S+I 
Sbjct: 347 GVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLIL 406

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
             +FG +A+   S   E  F WL  I G++  F+W  I +SH RF QA++ +G S + L 
Sbjct: 407 CAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLG 466

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQ 520
           ++A      + YA+FF  L+ I Q + +  P      D + F   Y++  L++ +++ + 
Sbjct: 467 YRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYM 526

Query: 521 LWFRC-RLIWKIEDVDIDTDRR--DIEEVVWED 550
           ++ R   L+  ++ +D+DT RR  D+E +  E+
Sbjct: 527 VYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEE 559

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  267 bits (682), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 172/495 (34%), Positives = 274/495 (55%), Gaps = 22/495 (4%)

Query: 52  GQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSV 111
             IRE ++ R LK RH                     L   GP    I Y  +G +VY  
Sbjct: 44  ANIRE-DLTRALKPRHINMISIAGIIGTGLYLSTSTSLHKGGPASLFINYSLIGGIVYLT 102

Query: 112 TQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW- 170
              L EM+T++P++ SF  ++++F S SF  A  + YWF+ A++ A +L+ +  ++ +W 
Sbjct: 103 LLCLAEMSTYMPISGSFCTYAKKFGSDSFAMALMWNYWFNDAVSVASDLTALQLVMDYWN 162

Query: 171 --TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
             ++  P  A   IFW  ++++N+  VRFYGE E+W+A +KV+AI+ F I  + +  G  
Sbjct: 163 TDSNHFPYWAASLIFWFFVLSLNVIHVRFYGEAEYWLAMLKVIAIIIFFIMSIIVNVGHN 222

Query: 229 VTGP-VGFRYWR-NPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAA 286
                +GF+ W     P   G          F G+ S  ++A+F Y GTE + +T+GE+ 
Sbjct: 223 PQHEYIGFKNWTVGEAPFVDG----------FKGFASLFVSASFAYGGTESITLTSGESD 272

Query: 287 NPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGT 346
           NP ++ P+ +K V +RILFFYIG+ FFI + VPYN P L+S    V  SPF I  + +GT
Sbjct: 273 NPLRNTPKIVKTVFWRILFFYIGTTFFIAMNVPYNYPGLSSGS--VVTSPFTIVFKMAGT 330

Query: 347 PILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPR-ILSRTNKNGVPWVSVIFT 405
                  NAVI++++ISA N  ++ GSRIM+ +      P+ I+SRTN+  VP+V+V+ T
Sbjct: 331 AGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGYLPKSIVSRTNRYKVPYVAVLIT 390

Query: 406 GLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPF 465
              G L +  +  G    + WL NI GV+   +WL I+I+ +RF Q LE +  +  +L F
Sbjct: 391 WAVGGLCFGASFIGAGTLWTWLQNIVGVSNQLAWLCIAITSIRFRQGLEAQNKTH-ELKF 449

Query: 466 KAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
           K    P   Y+ +  +T II++QG++SF P ++  +F + YI  F+F   +I++ L+ R 
Sbjct: 450 KNWTYPFGPYFLVVAVTFIILVQGWSSFAP-WNVSNFFSVYIELFVFPFCFIIWWLYKRD 508

Query: 526 RLIWKIEDVDIDTDR 540
             + K +D+D  TD+
Sbjct: 509 PFV-KCKDMDFVTDK 522

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  268 bits (684), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 151/495 (30%), Positives = 266/495 (53%), Gaps = 14/495 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           + ++K  +K RH                     L   GP G LI YL   T++Y V Q+ 
Sbjct: 68  QQKLKHNIKTRHLTMISLGTGIGTGLLVASGKALHYGGPGGLLIGYLTTSTMLYCVVQAC 127

Query: 116 GEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
            E+   +  +  ++  +    +   FG A   +Y   WAI   LEL      I++WT +V
Sbjct: 128 CELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAIVLPLELVTASMTIKYWTESV 187

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
               +++IF++ +V ++ F  R Y E EF   ++KVL + GF+I  + + CGA   G +G
Sbjct: 188 NPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMAGFIIMGISLNCGASKLGYIG 247

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
            +YW NPG        +++N  K  G  S  + +AF Y G+E + +TA E ANPR+SVP 
Sbjct: 248 AKYWSNPGTFAG---ERSINHLK--GICSVWVQSAFAYGGSEFIALTAAEQANPRESVPS 302

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKL--TSDDSYVAASPFIISIQNSGTPILPHI 352
           A K+ ++R++  ++  +  I  LVPY   +L  +S  S   ASPF+I+    G  I+PHI
Sbjct: 303 ATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSSGASASHASPFVIAAAYHGVKIVPHI 362

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            NA+IL+++IS  NS +Y   RI+  L+++ L P+I +  ++ G P  +++F  +FG L+
Sbjct: 363 INAIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFTYVDRAGRPLATLLFVCVFGLLS 422

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S   E+ F WL  I G++  F+W  I++SH+RF  A++ +G S  +L + +     
Sbjct: 423 FVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFRAAMKVQGRSLGELGYTSTTGAI 482

Query: 473 LAYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFR-CR 526
            +YYA+FF  ++++ Q + +  P       D   F   Y++  + +  ++ +++W+R  +
Sbjct: 483 GSYYAVFFNIVVLVAQFWIAIAPIDKHGELDAESFFKNYLAFAVLVLFYVGYKIWYREVQ 542

Query: 527 LIWKIEDVDIDTDRR 541
           L+  ++ +D++T R+
Sbjct: 543 LLIPVDKIDLETHRQ 557

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  267 bits (683), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 179/503 (35%), Positives = 269/503 (53%), Gaps = 19/503 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
            A +KR LK RH                     L  AGP G LI +   GT++Y +  ++
Sbjct: 73  NAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW-TSAV 174
           GE+A   PV   +T ++ RF+  SFG A   +Y   W IT  LE+      + +W T A 
Sbjct: 133 GELAVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAK 192

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
              A++++F+V++V +N+F V+ YGE EF  + IKV+A++GF+I  + +VCG G  G   
Sbjct: 193 YRDAFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYI 252

Query: 235 F-RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
             R W NPG    G          F G  S  + AAF++ G+ELVG+ A E ANPRKS+P
Sbjct: 253 GGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIP 302

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPHI 352
            A K+V +RI  FYI +L  +GLLVPY   +L    S   AASPF+ISIQN+G   LP +
Sbjct: 303 SAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSV 362

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            N VIL  ++S  N  V+  SR M  L+     P+I    ++ G P V ++ T +FG L+
Sbjct: 363 INVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLS 422

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S      F+WLL ++G++  F+W  I + H+R  +AL  +  +  +L F A     
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVW 482

Query: 473 LAYYAIFFMTLIIIIQGFTSFCP---SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLI 528
            + Y++  + LI+I Q + +  P         F  AY+S  ++I  +I  ++W +  +L 
Sbjct: 483 GSVYSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLF 542

Query: 529 WKIEDVDIDTDRR--DIEEVVWE 549
            K  D+DID+ RR  DIE +  E
Sbjct: 543 IKASDIDIDSGRRETDIEALKQE 565

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  267 bits (682), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 159/535 (29%), Positives = 268/535 (50%), Gaps = 37/535 (6%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G    + +KR LK RH                     L   GP+  +I +   G+ +  
Sbjct: 55  DGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVG 114

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+    PV  +F  +S RFL PS       +Y   W     LE+      IQ+W
Sbjct: 115 TIHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYW 174

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
            S++  V W++IF+ ++V++N+F  R +GE EF  ++IK + I GF+I C+ ++CG G  
Sbjct: 175 NSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPD 234

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              +G +YW +PG +  G          F G +S L+ A+++  GTE+  + +GE  +P 
Sbjct: 235 HEFIGAKYWHDPGALAHG----------FPGVLSVLVVASYSLGGTEMTCLASGE-TDP- 282

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K +P AIK+V +RILFF++ SL  +G LVPY +  L    S V  SPF+I+I+      L
Sbjct: 283 KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKLHHIKAL 341

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P I NAVIL +I+S  NS ++  SR +  ++   L PR     ++ G P   ++   LFG
Sbjct: 342 PSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFG 401

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  S+     F+WL+ I G+A    WL I++SH+RF  A++ +  + D+L F +  
Sbjct: 402 LLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAV 461

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP-------SFDGIDFLAAYISCFLFIAIWIVFQLW 522
               + Y+     LI+I Q + S  P       S     F  +Y+   + + I+ + +++
Sbjct: 462 GIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVY 521

Query: 523 FRCRL-----IWKIEDVDIDTDRRDIE-----------EVVWEDPPPVTFWDKFW 561
           +R        +  ++D+D++T R++++           ++  +  P +  W  FW
Sbjct: 522 YRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKKKPWIVRWYHFW 576

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  266 bits (681), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 164/513 (31%), Positives = 261/513 (50%), Gaps = 26/513 (5%)

Query: 54  IREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQ 113
           + +  +K+ +K RH                     L  +GP   +I Y+ +  + Y + Q
Sbjct: 48  VTKTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQ 107

Query: 114 SLGEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
           + GEMA   P +  SF  ++  F+S  FG A  ++++  W   F LEL      +++W  
Sbjct: 108 AAGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWND 167

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTG 231
            +    +I IF+  L+ ++ F V+ YGE EF   S KVL + GF+I  + + CG AG  G
Sbjct: 168 KINADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDG 227

Query: 232 PVGFRYWRNPGPM--GPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
            +G +YW +PG    GP I        +F G    L++A F+Y G EL  ++  E  NPR
Sbjct: 228 YIGAKYWHDPGSFADGPPI-------TRFKGVCFILVSAYFSYGGAELFSLSVNEQENPR 280

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVA-ASPFIISIQNSGTPI 348
           KS P A K+ ++RIL  Y+ ++  IG  VP+N  +L    S    ASP++++       +
Sbjct: 281 KSTPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKV 340

Query: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLF 408
           +PH  NAVIL ++IS ANS +Y   R+M  L++   AP+ L+  ++ G P   +I   LF
Sbjct: 341 VPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALF 400

Query: 409 GALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAK 468
           G + ++  S+  E  F WL  I G++  F+W  I +SH+RF QA+++ G S D++ FKA 
Sbjct: 401 GVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAV 460

Query: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLA-AYISCFLFIAIWIVFQLWFRCRL 527
                +YY   F  L+ I Q + +  P   G    A A+   +L   IW+VF   +   +
Sbjct: 461 TGIWGSYYGCAFNILVFIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGY---M 517

Query: 528 IWK--------IEDVDIDTDRR--DIEEVVWED 550
           I+K        +E +D+D  RR  D + +  ED
Sbjct: 518 IYKRDFTILNPLEKIDLDFHRRIYDPDFIKQED 550

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  265 bits (678), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 156/510 (30%), Positives = 261/510 (51%), Gaps = 15/510 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
             ++K+ LK RH                     L   GPVG LIAY+ +G +V     ++
Sbjct: 43  RTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAI 102

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFAL----ELSVVGQIIQFWT 171
            E+A+F+P T +    S++F+  + G      + F W  T++     ELS    ++ +WT
Sbjct: 103 AEVASFMPATGATIRHSEQFIDEAVG------FTFGWISTYSSLMPGELSATAVVMTYWT 156

Query: 172 SAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTG 231
              P + +I+IF VL +  N++ +RFYGE E++   +K+  I   +I  L +  G     
Sbjct: 157 DLSPAI-FITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGGTKQE 215

Query: 232 PVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
            +GF YWRNPGP    ++  +    KF+G+ ++L +  ++Y G + + I AGE  N R +
Sbjct: 216 RLGFHYWRNPGPFAEYLVGGD--TGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHA 273

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPH 351
           +    K V  RI+  Y+ ++F + L+VPYND  + +      +SPF+I+++ +G  +LPH
Sbjct: 274 IFHGAKNVFVRIILLYLITVFVLTLIVPYNDKLIATGSGNARSSPFVIAMERAGIKVLPH 333

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
           I NA+IL++  SA N  +  GSR +F L+    AP+I  +T+K G+PWV V+F   F  L
Sbjct: 334 IVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFLPL 393

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           AYM  S      F+W   +        W+ IS +H+   +AL  +G SR DLP+     P
Sbjct: 394 AYMSCSESSATVFSWFQELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYSTTIAP 453

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWK 530
             A+++     + ++  GF +F   +FD   F + Y    L IA++  ++L+ + R + +
Sbjct: 454 YAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFKKTRYL-R 512

Query: 531 IEDVDIDTDRRDIEEVVWEDPPPVTFWDKF 560
             +VD+ +   DI E     P     W + 
Sbjct: 513 PHEVDLQSIFEDIRENPEYIPETTPLWKRL 542

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  267 bits (682), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 166/550 (30%), Positives = 281/550 (51%), Gaps = 17/550 (3%)

Query: 13  KIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIR-EAEVKRELKQRHXXXX 71
           +IK  S E  +  +HR  +S                     ++    +K+ +K RH    
Sbjct: 39  EIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMM 98

Query: 72  XXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMA-TFIPVTSSFTV 130
                            L+ AGP   +I Y+ +  + Y + Q+ GEM  T+  +  +F  
Sbjct: 99  SLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNA 158

Query: 131 FSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAM 190
           ++  F+S SFG A  +++   W     LEL      +++W   +    +I IF+V L+ +
Sbjct: 159 YNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFI 218

Query: 191 NMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPMGPGII 249
           + F V+ YGE EF   S K+L + GF+I  + + CG AGV G +G +YWR+PG    G  
Sbjct: 219 HFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSG 278

Query: 250 AKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIG 309
           A      +F G    L++A F++ G EL  ++  E +NPRKS P A K+ V+RIL  Y+ 
Sbjct: 279 A-----TRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLL 333

Query: 310 SLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSN 368
           ++  IG  VP+N+ +L  S  S   ASP++++       ++PHI NAVIL ++IS ANS 
Sbjct: 334 TMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSA 393

Query: 369 VYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLL 428
           +Y   R+M  L++   AP+ L+  ++ G P  +++   L G + ++  S   E AF WL 
Sbjct: 394 LYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLA 453

Query: 429 NITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQ 488
            I G++  F+W  I +SH+RF +A++ +G S D++ +KA      +YY +FF  L+ + Q
Sbjct: 454 AIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQ 513

Query: 489 GFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIWKIEDVDIDTDRR- 541
            + +  P       D   F  +Y++  L+I +++ + ++ R    +  ++ +D+D  RR 
Sbjct: 514 FWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRV 573

Query: 542 -DIEEVVWED 550
            D E +  ED
Sbjct: 574 YDPEIMRQED 583

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  269 bits (687), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 156/507 (30%), Positives = 275/507 (54%), Gaps = 17/507 (3%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           N   +  E+K+ +K RH                     L  AGP G +I +  MG+ +Y 
Sbjct: 150 NDNSKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYC 209

Query: 111 VTQSLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
           + Q++GE+A  +  +   F  +    +  +F  A  ++Y   W     LEL      I++
Sbjct: 210 IIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKY 269

Query: 170 WTSAVPIVAWISIFWVLLVAMNMFP-VRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-A 227
           WT+ V    ++ IF++L++ +N+      Y E EF   S K++ ++GF I  + ++CG A
Sbjct: 270 WTTKVDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGA 329

Query: 228 GVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
           G  G +G +YW +PG +       + +  +F G +++L+NAAF +  +E +G+TA E +N
Sbjct: 330 GTDGYIGAKYWHDPGAL-----RGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSN 384

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQNSGT 346
           PRK++P A KK+++RIL  ++ S+  +G LVPYN D  L S  S V ASP++++I   G 
Sbjct: 385 PRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGV 444

Query: 347 PILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTG 406
            ++PH  NAVIL +++S ANS  Y  SR++  L++   AP+I S  ++ G P V +    
Sbjct: 445 RVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAA 504

Query: 407 LFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFK 466
           +FG +A+  TS   +  F WLL I+G++  F+W+ I ISH+RF +A+  +G S  +L F+
Sbjct: 505 IFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFR 564

Query: 467 AKFMPGLAYYAIFFMTLIIIIQGFTSFCP-------SFDGIDFLAAYISCFLFIAIWIVF 519
           ++     + YA   M +I+I Q + +  P         D  +F   Y++  + +A +  +
Sbjct: 565 SQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGY 624

Query: 520 QLWFRC-RLIWKIEDVDIDTDRRDIEE 545
           ++W +  +L  + +++D+ + R   +E
Sbjct: 625 KIWKKDWKLFIRAKNIDLISHRNIFDE 651

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  266 bits (680), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 168/550 (30%), Positives = 274/550 (49%), Gaps = 17/550 (3%)

Query: 13  KIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIR-EAEVKRELKQRHXXXX 71
           ++K  S E     +HR  +S                     +R    +K+ +K RH    
Sbjct: 39  EVKEHSEESRSGLVHRFVDSFRRAESQRLEDDNDLEDGTRSMRSNNHLKKSMKSRHVVMM 98

Query: 72  XXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMA-TFIPVTSSFTV 130
                            L  AGP   +I Y+ +  + Y + Q+ GEM  T+  +  +F  
Sbjct: 99  SLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNA 158

Query: 131 FSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAM 190
           ++  F+S SFG A  +++   W     LEL      I++W   +    +I+IF+V L+ +
Sbjct: 159 YNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDTINADVFIAIFYVFLLFI 218

Query: 191 NMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPMGPGII 249
           + F V+ YGE EF   S K+L I GF+I  + + CG AGV G +G  YWRNPG    G  
Sbjct: 219 HFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFADGSS 278

Query: 250 AKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIG 309
           A      +F G    L+ A F++ G EL  ++  E ANPRKS P A K+ ++RIL  Y+ 
Sbjct: 279 A-----TRFKGICFILVTAYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLL 333

Query: 310 SLFFIGLLVPY-NDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSN 368
           ++  IG  VP+ ND  + S  S   ASP++++    G  ++PHI NAVIL ++IS ANS 
Sbjct: 334 TMILIGFNVPHDNDQLMGSGSSATHASPYVLAASIHGVKVIPHIINAVILISVISVANSA 393

Query: 369 VYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLL 428
           +Y   R+M  L++   AP+ L+  ++ G P  +++     G + ++  S+  E AF WL 
Sbjct: 394 LYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLA 453

Query: 429 NITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQ 488
            I G++  F+W  I +SH+RF +A++ +G S D++ +K+      +YY + F  L+ + Q
Sbjct: 454 AIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQ 513

Query: 489 GFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWFRC-----RLIWKIEDVDIDTDRR- 541
            + +   P  DG   + ++   +L   +WI   L +        L+  ++ +D+D  RR 
Sbjct: 514 FWVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRV 573

Query: 542 -DIEEVVWED 550
            D E +  ED
Sbjct: 574 YDPEIMRQED 583

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  266 bits (679), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 163/506 (32%), Positives = 264/506 (52%), Gaps = 16/506 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           ++++K+ +K RH                     L   GP   +I Y+ +  + Y + Q+ 
Sbjct: 88  DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAA 147

Query: 116 GEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GEMA   P + ++F  +S  F+S  FG A  ++Y F W     LEL      IQFW   +
Sbjct: 148 GEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDKI 207

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPV 233
               +I IF+V L+ ++ F V+ YGE EF     K+L I GF++  + + CG AG  G +
Sbjct: 208 NPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYI 267

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G  YW  PG       A + + A+F      L+ A F++ G EL  ++  E  NPRKS P
Sbjct: 268 GGAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTP 322

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHI 352
            A K+ ++RI+  Y+ ++  IG  VPYND +L  +  S   ASP++++    G  I+PHI
Sbjct: 323 VAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAASIHGVRIVPHI 382

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            NAVIL +++S ANS++Y G R++  L++   AP+ L   ++ G P  ++I   + G +A
Sbjct: 383 INAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVIA 442

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S+  E  F WL  I G++  F+W  I +SH+RF QA++ +G S ++L +KA     
Sbjct: 443 FVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGIW 502

Query: 473 LAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLA-AYISCFLFIAIWIVFQLWFRC-----R 526
            + Y  FF  L+ I Q + +  P  +G    A A+   +L   IW++F + +        
Sbjct: 503 GSIYGSFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMIYNRDFT 562

Query: 527 LIWKIEDVDIDTDRR--DIEEVVWED 550
           L+  ++ +D+D  RR  D E +  ED
Sbjct: 563 LLNPLDKIDLDFHRRVYDPELMRQED 588

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  264 bits (674), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 169/497 (34%), Positives = 268/497 (53%), Gaps = 22/497 (4%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
            +  +RE  + R L  RH                     L   GP   LI Y  +G +VY
Sbjct: 39  TDNNVRE-HLNRSLSPRHVNMIAIAGVIGTGLYLGTGRALHLGGPASLLINYSIIGLIVY 97

Query: 110 SVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
           +   SLGEM+T++P++ SF  F+++F S SF  A    YWF+ A++ A +L+ +  ++ +
Sbjct: 98  ATLLSLGEMSTYMPISGSFCSFAKKFGSESFAFALMCNYWFNDAVSVASDLTALQLVLDY 157

Query: 170 W-TSAVPIVAWIS--IFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG 226
           W TS      WI+  IFWV L+ +N+  V+ YGE E+W+A +KV+AI+ F I  +    G
Sbjct: 158 WKTSESGFPYWIASLIFWVFLLFLNVIHVKIYGEAEYWLAMLKVIAIIIFFILSIVANVG 217

Query: 227 AGVTGP-VGFRYW-RNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGE 284
                  +GFR W R   P   G          F G+ +  ++A+F Y GTE + +T+GE
Sbjct: 218 HNEQHEYIGFRNWTRGDAPFVNG----------FRGFATLFVSASFAYGGTESITLTSGE 267

Query: 285 AANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNS 344
             NP ++ P+ IK V +RIL FYI ++FFIG+ VPY+ P L+     V  SPF I  Q  
Sbjct: 268 TKNPVRNTPKVIKTVFWRILIFYIFTVFFIGMNVPYDYPNLSEKS--VMTSPFTIVFQMV 325

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLS-KSKLAPRILSRTNKNGVPWVSVI 403
           G+       NAVIL++++SA N  ++ GSRI+F L  +    P++++RTN   VP+V+V+
Sbjct: 326 GSKAAGSFMNAVILTSVVSACNHALFAGSRILFNLGLEGYFFPKLVTRTNWYQVPYVAVL 385

Query: 404 FTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDL 463
            T   G L +  +  G    + WL N+ GV+   +WL I +  +RF + L  +G +  +L
Sbjct: 386 VTWAVGGLCFGSSFIGAGTLWIWLQNLVGVSNQIAWLSIGVISIRFRRGLSRQGKTH-EL 444

Query: 464 PFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWF 523
            F     P   Y+ I  ++ II++QG++S  P  D   F + Y+  F+F+A W+V+  + 
Sbjct: 445 KFVNWTYPYGPYFVIISVSFIILVQGWSSSSP-MDVTSFFSYYVELFIFLACWLVWWAFK 503

Query: 524 RCRLIWKIEDVDIDTDR 540
           R   + + +D+D  TD+
Sbjct: 504 RDGFV-REKDMDFVTDK 519

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  266 bits (680), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 165/498 (33%), Positives = 263/498 (52%), Gaps = 13/498 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           E  +K+ +K RH                     L  AGP G +  Y  MGT VY + QS 
Sbjct: 107 EDNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSA 166

Query: 116 GEMAT-FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GEMA  +  +   F  +    + P F         F+     +  +       ++WT+ V
Sbjct: 167 GEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTRV 226

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGAGVTGPV 233
               ++ IF+VL++ +N+F  R Y E EF+    KVL + GF I  + + V GAG  G +
Sbjct: 227 DPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYL 286

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G  YWRNPG        K ++   F G V++L+ AAF + GTE + +TA E +NPRK++P
Sbjct: 287 GNIYWRNPGAFRGD---KGIDH--FKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAIP 341

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHI 352
            A KKV++RI+  Y+ S+  IG LVP+  P+L  S  +  AASP++I++ + G  ++PH 
Sbjct: 342 SAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAASPYVIAVASHGVRVVPHF 401

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            NAVIL +++S  NS  Y  SR++  LSK   AP+     ++ G P  ++I + LFG +A
Sbjct: 402 INAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFGVIA 461

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           +  TS      F WLL I+G++  F+W+ I +SH+RF  A++ +G S  ++ FKA+    
Sbjct: 462 FCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQTGIW 521

Query: 473 LAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RL 527
            +YY+IF M L +I Q + +  P         +F   Y++  + I  +  +++W +   L
Sbjct: 522 GSYYSIFLMILTLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIWKKDWTL 581

Query: 528 IWKIEDVDIDTDRRDIEE 545
             K ED+D+ + R+  +E
Sbjct: 582 YIKAEDIDLISHRQIFDE 599

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  265 bits (677), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 159/505 (31%), Positives = 261/505 (51%), Gaps = 16/505 (3%)

Query: 57  AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLG 116
           + +K+ +K RH                     L+  GP   +I Y+ +  + Y + Q+ G
Sbjct: 73  SHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAG 132

Query: 117 EMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           EMA   P +  +F  ++  F+S  FG A  ++++  W   F LEL      I++W   + 
Sbjct: 133 EMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKIN 192

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVG 234
              +I IF+V L+ ++ F V+ YGE EF   S KVL I GF+I  + + CG AG  G +G
Sbjct: 193 ADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIG 252

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
            +YWR+PG    G   +     KF G    L+ A F+Y G EL  ++  E  NPRKS P+
Sbjct: 253 AKYWRDPGSFAEGDSVE-----KFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQ 307

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHIF 353
           A K+ ++RIL  Y+ ++  IG  VP+N+ +L  S  S   ASP++++    G  ++PH  
Sbjct: 308 AAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFI 367

Query: 354 NAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAY 413
           NAVIL ++IS ANS +Y   R+M  L++   AP+ L   ++ G P  ++I   +FG + +
Sbjct: 368 NAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGF 427

Query: 414 METSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGL 473
           +  S+  E  F WL  I G++  F+W  I +SHVRF Q ++  G S +++ F+A      
Sbjct: 428 VSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWG 487

Query: 474 AYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RL 527
           + Y I F  L+ I Q + +  P       D   F  +Y++  +++  +  + L+ R    
Sbjct: 488 SMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRDFTF 547

Query: 528 IWKIEDVDIDTDRR--DIEEVVWED 550
           +  ++ +D++  RR  D E +  ED
Sbjct: 548 LVPLDKIDLNFHRRIYDPELIRQED 572

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  264 bits (675), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 153/453 (33%), Positives = 241/453 (53%), Gaps = 13/453 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           ++ VKR+LK RH                     L   GP+  L+ +  +G L + + +S+
Sbjct: 53  DSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESI 112

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           GEM T  P    FT  ++RF S +  A  GY Y   +    A E + +  I+QFW   VP
Sbjct: 113 GEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFWGPQVP 172

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPV-G 234
           +  +I IFW       +  V  +GE E+W+A  K+L ++ + I+ +  + G     P  G
Sbjct: 173 LYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFG 232

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
           F+YW +PG +  G          F G  +  +  +  Y GTE V + A E+ NPR++VP 
Sbjct: 233 FQYWNDPGALSNG----------FKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPI 282

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFN 354
           AI++  +RIL  Y+G   F G+ VPYND  L +  + V  SP  I+I  +G P   H+ N
Sbjct: 283 AIRQTFWRILIVYLGISIFYGVTVPYNDENL-NFATKVLKSPIAIAISRAGWPAGVHLVN 341

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           A IL T ISA N ++Y+GSR +  L+   LAP++L+ T++ GVP  ++      G ++ M
Sbjct: 342 AFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLM 401

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             S     A+N+++N++GV  F  W  IS++H+RF +A + +G +RD+LP+KAK  P   
Sbjct: 402 NVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFP 461

Query: 475 YYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYI 507
             +I     + ++QG++ F P FD  +F+ AYI
Sbjct: 462 IVSIIANIFLGLVQGWSYFKP-FDAKNFVDAYI 493

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  264 bits (674), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 167/494 (33%), Positives = 268/494 (54%), Gaps = 23/494 (4%)

Query: 54  IREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQ 113
           IRE  + R L  RH                     L   GP   LI Y+ MG ++Y    
Sbjct: 58  IRE-RLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLINYVIMGGVIYLTML 116

Query: 114 SLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW--- 170
           SLGEM+TF+P++ S+  +S++F+S S+  A     W+S A++ A +L+ +  ++ +W   
Sbjct: 117 SLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVASDLTALQLVLDYWKTN 176

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T   P  A   +FW L++ +N+  V+ YGE E+W+A +KV+A++ F I  +   CG    
Sbjct: 177 THHFPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVIIFFIMAIIANCGHNQQ 236

Query: 231 GP-VGFRYWRN-PGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANP 288
              +GF+ W +   P   G          F G+V+  + ++F+Y GTE V +T GEA NP
Sbjct: 237 HEYIGFKNWSHGDAPFVQG----------FKGFVTIFVTSSFSYGGTETVTLTGGEAKNP 286

Query: 289 RKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPI 348
            ++ P+ IK V +RIL FY+ ++FF+G+ +PY+ P L +    V  SPF I  Q +GT  
Sbjct: 287 VRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNLKTKS--VLTSPFTIVFQMAGTKA 344

Query: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAP--RILSRTNKNGVPWVSVIFTG 406
                NAVI+++ ISA N  ++ GSRI++ +      P  R  ++TN+N  P+V+VI T 
Sbjct: 345 AGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKTNRNKAPYVAVITTW 404

Query: 407 LFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFK 466
             G L +  +  G    F+WL NI GV+   SWL I++  +RF + LE +G    +L F+
Sbjct: 405 AVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKGLEAQG-KVHELKFR 463

Query: 467 AKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCR 526
               P   ++ I F++LII++QG+++F P +    F + Y+   +F A WI + +  R R
Sbjct: 464 NWTYPYGPWFCIIFISLIILVQGWSAFDP-WSTSSFFSFYLELIVFPACWIFWWVIKRDR 522

Query: 527 LIWKIEDVDIDTDR 540
              K +D+D  TD+
Sbjct: 523 FK-KAKDMDFITDK 535

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  263 bits (671), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 159/492 (32%), Positives = 255/492 (51%), Gaps = 21/492 (4%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           VKR LK RH                     L   GP+  L+ +  +G + ++V +S+GE+
Sbjct: 49  VKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESIGEI 108

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVA 178
            T  P    FT  ++RF   +  A  GY Y   +    A E + +  I+QFW   VP+  
Sbjct: 109 ITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYG 168

Query: 179 WISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPV-GFRY 237
           +I IFW       +  V  +GE E+W++  K++ ++ + I+ +  + G     P  GF Y
Sbjct: 169 YILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFGFHY 228

Query: 238 WRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 297
           W +PG +  G          F G     +  +  Y GTE V + A E+ NP K+VP A++
Sbjct: 229 WNSPGSLSHG----------FKGIAVVFVFCSTFYSGTECVALAATESKNPGKAVPLAVR 278

Query: 298 KVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVI 357
           + ++R+L  YIG   F G  VP++DP L++  + V  SP  I+I  +G     H+ NA I
Sbjct: 279 QTLWRVLIVYIGIAVFYGATVPFDDPNLSAT-TKVLKSPISIAISRAGWAGGAHLVNAFI 337

Query: 358 LSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETS 417
           L T ISA N ++Y+GSR +  L+   LAP+IL+ T++ GVP  ++      G ++ M  S
Sbjct: 338 LVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVS 397

Query: 418 TGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYA 477
            G   A+++++N++GV  F  W  IS +H+R  +A   +G S ++LP+KA   P    ++
Sbjct: 398 VGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPWTPIFS 457

Query: 478 IFFMTLIIIIQGFTSFCPSFDGIDFLAAYI----SCFLFIAIWIVFQLWFRCRLIWKIED 533
           +     + +IQG+TSF P FD  +F+ AYI    +  L++AI +     FR   I  ++ 
Sbjct: 458 LIANVFLALIQGWTSFVP-FDAGNFVDAYILLPVAIVLYVAICVFKNHHFR---IVDLKS 513

Query: 534 VDIDTDRR-DIE 544
           VD+D  RR DI+
Sbjct: 514 VDLDEGRRKDID 525

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  261 bits (668), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 160/493 (32%), Positives = 257/493 (52%), Gaps = 21/493 (4%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           VKR LK RH                     L   GP+  L+ ++ +G + ++V +S+GEM
Sbjct: 32  VKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIGIIAFAVMESIGEM 91

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVA 178
            T  P    FT  ++RF S +  A  GY Y   +    A E + +  I+QFW   VP+ A
Sbjct: 92  ITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSSILQFWGPQVPLYA 151

Query: 179 WISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPV-GFRY 237
           +  IFW++     +  V  +GE E+W++ +K+L ++ + I+ +  + G     P  GF Y
Sbjct: 152 YTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMSGGVRNKPAFGFHY 211

Query: 238 WRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 297
           W++PG +  G          F G     +  +  Y GTE V +TA E+ NP KSVP A++
Sbjct: 212 WKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVALTATESKNPTKSVPYAVR 261

Query: 298 KVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVI 357
           + ++RI+  YIG   F G  VP+NDP L S ++ V  SP  I+I  +G     H+ NA I
Sbjct: 262 QTLWRIVVVYIGIAIFYGSTVPFNDPNL-SVNTKVLKSPIAIAISRAGWAGGSHLVNAFI 320

Query: 358 LSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETS 417
           L + ISA N ++Y+GSR +  L+   LAP+ L+ T+K GVP  ++      G ++ M  S
Sbjct: 321 LFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITIFNALGLISLMNMS 380

Query: 418 TGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYA 477
            G   A+++++N++GV  F  W  IS +H+R  +A   +G   ++LP+KA F P    ++
Sbjct: 381 VGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELPYKALFYPWTPIFS 440

Query: 478 IFFMTLIIIIQGFTSFCPSFDGIDFLAAYI----SCFLFIAIWIVFQLWFRCRLIWKIED 533
           +     + +IQG+TS  P F   +F+ AYI    +  L++ + +     FR   I  +  
Sbjct: 441 LISNIFLALIQGWTSLVP-FKAPEFVDAYILLPAAIILYVGVCVFKNHNFR---IVDLTS 496

Query: 534 VDIDTDRR-DIEE 545
           V++D  RR D+E 
Sbjct: 497 VNLDEGRRKDMEN 509

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  263 bits (673), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 157/514 (30%), Positives = 266/514 (51%), Gaps = 27/514 (5%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G    + +KR LK RH                     +   GP+G ++ +   G+ +  
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 129

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+    PV  +F  +  RFL PS       +Y   W     LE+      +Q+W
Sbjct: 130 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
            S++  V W++IF+V++V++N+F VR +GE EF  ++IK + + GF+I C+ ++ G G  
Sbjct: 190 NSSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPD 249

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              VG +YW +PG +  G          F G +S L+ A+++  G E+  + +GE  +P 
Sbjct: 250 HEYVGAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEMTCLASGE-TDP- 297

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K +P AIK+V +RILFF++ SL  +G LVPY +  L    S V  SPF+I+I+     +L
Sbjct: 298 KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVL 356

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P I N VIL +++S  NS ++  SR +  ++   L P      ++ G P V ++   LFG
Sbjct: 357 PSIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 416

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  S      FNWL+ I G+A    WL I++SH+RF  A++ +G   D+L F +  
Sbjct: 417 LLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAV 476

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP-------SFDGIDFLAAYISCFLFIAIWIVFQLW 522
               + Y+     LI++ Q + S  P       S     F   Y+   + + I+I  +++
Sbjct: 477 GIWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAHKIY 536

Query: 523 FRCRL-----IWKIEDVDIDTDRRDIE-EVVWED 550
           ++C+      I  ++D+D++TDR++I+ E+V ++
Sbjct: 537 YKCQTGQWWGIKALKDIDLETDRKNIDIEIVKQE 570

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  263 bits (673), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 152/514 (29%), Positives = 265/514 (51%), Gaps = 27/514 (5%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G    + +KR LK RH                     +   GP+G ++ +   G+ +  
Sbjct: 71  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 130

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+    PV  +F  +  RFL PS       +Y   W     LE+      +Q+W
Sbjct: 131 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 190

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
            S++  V W++IF+ ++V +N+F  R +GE EF  +++K + + GF+I  + ++CG G  
Sbjct: 191 NSSIDPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGGPD 250

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              +G +YW +PG +  G          F G ++ L+ A+++  G E+  + +GE  +P 
Sbjct: 251 HEFIGAKYWHDPGCLANG----------FPGVLAVLVVASYSLGGIEMTCLASGE-TDP- 298

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K +P AIK+V +RILFF++ SL  +G LVPY +  L    S V  SPF+I+++     +L
Sbjct: 299 KGLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAMKLHHIKVL 357

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P I NAVIL +++S  NS ++  SR +  ++   L P      ++ G P V ++   LFG
Sbjct: 358 PTIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 417

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  S      FNWL+ I G+A    WL I++SH+RF  A++ +G S D+L F +  
Sbjct: 418 LLAFLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAV 477

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP-------SFDGIDFLAAYISCFLFIAIWIVFQLW 522
               + Y+     LI+I Q + S  P             F   Y+   + + I++V +++
Sbjct: 478 GIWGSAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFIFVVHKIY 537

Query: 523 FRCRL-----IWKIEDVDIDTDRRDIE-EVVWED 550
           ++C+      +  ++D+D++TDR+DI+ E++ ++
Sbjct: 538 YKCQTGKWWGVKSLKDIDLETDRKDIDIEIIKQE 571

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  263 bits (671), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 155/514 (30%), Positives = 267/514 (51%), Gaps = 27/514 (5%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G      +KR LK RH                     L   GP+  LI +   GT +  
Sbjct: 60  DGSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVG 119

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+    PV  +F  +S RFL PS       +Y   W     LE+      ++FW
Sbjct: 120 TIHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFW 179

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T++V  V W+++F+ L++++N+F VR++G+ +F  + IK++ I GF+I CL ++ G G T
Sbjct: 180 TTSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPT 239

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              +G RYW +PG +  G          F G  + ++ A+++  G+E+  + +GE  +P 
Sbjct: 240 HEFIGARYWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP- 287

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K +P AIK++ +RI+FF++ SL  +G LVPY + +L    S V  SPF+I+I+     +L
Sbjct: 288 KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGG-SNVNNSPFVIAIKMHNIRVL 346

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           PHI N VIL +I+S  NS ++  SR +  ++   L PRI    ++ G P   ++   LFG
Sbjct: 347 PHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFG 406

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  S+     F WL+ + G+A    WL I++SH+RF  A++ +G S D+L F +  
Sbjct: 407 LLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAV 466

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPSFDGID-------FLAAYISCFLFIAIWIVFQLW 522
               + Y+     ++++ Q + S  P     D       F   Y+   + + +++  +++
Sbjct: 467 GMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIY 526

Query: 523 FRCRLI--WKI---EDVDIDTDRRDIE-EVVWED 550
           +R      WKI    ++D+++ R++I+ EVV  +
Sbjct: 527 YRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHE 560

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  263 bits (672), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 161/507 (31%), Positives = 260/507 (51%), Gaps = 26/507 (5%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G    + +K+ LK RH                     L   GP+  +I +   G+ +  
Sbjct: 78  DGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQIIG 137

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+    PV  +F  +S RFL PS       +Y   W     LE+      +Q+W
Sbjct: 138 TIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQYW 197

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
             ++  V W++IF+V +V++N+F VR +GE EF  ++IKV+ I GF++ C+ ++ G G  
Sbjct: 198 NESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGGPD 257

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              VG RYW NPG +  G          F G +S ++ A+++  GTE+  + +GE  +P 
Sbjct: 258 HVYVGSRYWHNPGCLANG----------FPGVLSVMVVASYSLGGTEMTCLASGE-TDP- 305

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K +P AIK+V +RILFF++ SL  +G LVPY +  L    S V  SPF+I+I+     +L
Sbjct: 306 KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKIHHIKVL 364

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P I NAVIL +I+S  NS ++  SR +  ++   L P      ++ G P V +I   LFG
Sbjct: 365 PSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIITNSLFG 424

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  S      F+WL+ I G+A    WL I++SH+RF  A++ +G S ++L F +  
Sbjct: 425 LLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELEFVSAV 484

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP------SFD-GIDFLAAYISCFLFIAIWIVFQL- 521
               + Y+     LI++ Q + S  P      S D    F  +Y+   + + IWI  ++ 
Sbjct: 485 GIWGSVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCIWIGHKIY 544

Query: 522 -WFRCRLIWK---IEDVDIDTDRRDIE 544
            W +   IW    + ++D+D  R++I+
Sbjct: 545 YWRQTGKIWAFTPLAEIDLDEGRKNID 571

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  263 bits (672), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 165/544 (30%), Positives = 275/544 (50%), Gaps = 25/544 (4%)

Query: 13  KIKSSSYELDDYPLHR------RTNSVHXXXXXXXXXXXXXXXANGQIREAEVKRELKQR 66
           ++K  S E  +  +HR      R  S H               +N ++     K+ +K R
Sbjct: 39  EVKEHSEESRNGLVHRFVDSFKRAESQHLEDDNDLEDGTRSMKSNNRL-----KKSMKSR 93

Query: 67  HXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIP-VT 125
           H                     L  AGP   +I Y+ +  + Y + Q+ GEM    P + 
Sbjct: 94  HVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLP 153

Query: 126 SSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWV 185
            +F  ++  F+S SFG A  +++   W     LEL      I++W   +    +I IF+V
Sbjct: 154 GNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDKINSDVFIVIFYV 213

Query: 186 LLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPM 244
            L+ ++ F V+ YGE EF  +S K+L I GF+I  + + CG AGV G +G +YWR+PG  
Sbjct: 214 FLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSF 273

Query: 245 GPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRIL 304
             G  A      +F G    L+ A F++ G EL  ++  E +NPRKS P A K+ V+RIL
Sbjct: 274 AEGNGA-----TRFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRIL 328

Query: 305 FFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIIS 363
             Y+ ++  IG  VP+N+ +L  S  +   ASP++++       ++PHI NAVIL ++IS
Sbjct: 329 IIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVVPHIINAVILISVIS 388

Query: 364 AANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAA 423
            ANS +Y   R+M  L++   AP+ L   ++ G P  ++    L G + ++  S   E A
Sbjct: 389 VANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQA 448

Query: 424 FNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTL 483
           F WL  I G++  F+W  I +SH+RF +A++ +G S D++ +KA      +YY +FF  L
Sbjct: 449 FTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNIL 508

Query: 484 IIIIQGFTSFCPSFDGID-----FLAAYISCFLFIAIWIVFQLWFRC-RLIWKIEDVDID 537
           + + Q + +  P  +G       F  +Y++  L++ +++ + L+ R    +  ++ +D+D
Sbjct: 509 VFMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLD 568

Query: 538 TDRR 541
             RR
Sbjct: 569 YHRR 572

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  263 bits (672), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 162/495 (32%), Positives = 266/495 (53%), Gaps = 13/495 (2%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +   +K+ +K RH                     L N GP   LI Y  + T++Y V QS
Sbjct: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142

Query: 115 LGEMAT-FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
             E+A  +  ++  F  +    +  +F  +  ++Y   W     LEL      I++W  +
Sbjct: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGP 232
           +   A++ IF+V+L+ +N      Y E EF+  + KVL ++GF I  + + CG AG  G 
Sbjct: 203 INPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGY 262

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +G  YW +PG         N    +F G V+ L+NAAF Y G E   +TA E  NP+KS+
Sbjct: 263 LGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPH 351
             A KK+V+RI+  Y+ +   +G LVPYN P+L  S  +   ASPF+I+I + G  ++PH
Sbjct: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPH 377

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
           I NAVIL +++S ANS +Y  SRI+  LS+   AP++ +  ++ G P   ++ + +FG L
Sbjct: 378 IINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLL 437

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
            ++  S   E  F WLL I+G++  F+W  IS+SHVRF +++  +G S D+L +++    
Sbjct: 438 CFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGV 497

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
             AYYA+  + LI+I Q + +  P      D  +F   Y++  + I +++ ++LW+R  R
Sbjct: 498 WGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWR 557

Query: 527 LIWKIEDVDIDTDRR 541
           +I    +VD+ + R+
Sbjct: 558 VIIPANEVDLVSHRK 572

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  262 bits (670), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 157/514 (30%), Positives = 262/514 (50%), Gaps = 27/514 (5%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G    + +KR LK RH                     L   GP+  +I +   GT +  
Sbjct: 70  DGSFDPSNMKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIG 129

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+   +PV  +F  +S RFL PS       +Y   W     LE+      ++FW
Sbjct: 130 TIHGLGELTVRLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFW 189

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T +V  + W+++F+ ++V++N+  VR +GE EF  +S+KV+ I GF+I C+ ++ G G T
Sbjct: 190 TQSVDPIIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPT 249

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              VG RYW +PGP+  G          F G  + ++ A+++  G+E+  + +GE  +P 
Sbjct: 250 HQYVGSRYWHDPGPLANG----------FKGVAAVMVTASYSLGGSEMTCLASGE-TDP- 297

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K +P AIK++ +RILFF++ SL  +G LVPY +  L    S    SPF++++      ++
Sbjct: 298 KELPHAIKQIFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-AENSPFVLALYLHHVKVV 356

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           PHI N VIL +I+S  NS ++  SR +  ++   L P I    ++ G P V ++   +FG
Sbjct: 357 PHIVNGVILVSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFG 416

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++   +     F+WL+ I G+A    WL I++SHVRF  A++ +  S D+L F +  
Sbjct: 417 LLAFLVKFSSISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSV 476

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPSFDGID-------FLAAYISCFLFIAIWIVFQLW 522
               + YA     L ++ Q + +  P     D       F   Y+   + IA++   + +
Sbjct: 477 GVWGSVYAGVLNFLTLVAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCY 536

Query: 523 FRCRL-----IWKIEDVDIDTDRRDIE-EVVWED 550
           FR        I K+ +VD+DT R +I+ E++ E+
Sbjct: 537 FRITTGKWWGIKKLSEVDLDTGRVNIDIEIIKEE 570

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  262 bits (670), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 158/505 (31%), Positives = 265/505 (52%), Gaps = 19/505 (3%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            + +  ++R ++ RH                     L   GP G +I Y  +  + Y + 
Sbjct: 73  DLTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMM 132

Query: 113 QSLGEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWT 171
           Q+ GEMA   P +  +F  +S  F+S  FG A+ ++Y   W   F LEL      I++WT
Sbjct: 133 QAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWT 192

Query: 172 SAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVT 230
            +V    +I+IF+V ++ ++ F  R YGE EF     KVL I GF+I  + + CG AG +
Sbjct: 193 DSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNS 252

Query: 231 GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
           G +G RYW +PG    G  A     +KF G+   L+   F+Y GTEL  +T  E ++PR+
Sbjct: 253 GYIGARYWHDPGAFAVGDPA-----SKFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRR 307

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL--TSDDSYVAASPFIISIQNSGTPI 348
           ++  A K+ ++RIL  Y+ ++  IG LVP+   +L  +   S   ASP+++++   G  +
Sbjct: 308 AIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGVKV 367

Query: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLF 408
           +PHI NAVIL  ++S  NS +Y G R++  L++   AP+ L+  ++ G P +++I   + 
Sbjct: 368 VPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVI 427

Query: 409 GALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAK 468
           G LA++  S   E  F WL  I G++  F+W  I +SH+RF QA++Y G S   L +K+ 
Sbjct: 428 GLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKS- 486

Query: 469 FMPGL--AYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
            + GL  + Y + F  L+ + Q + +  P   +G   + ++   +L   +W VF L +  
Sbjct: 487 -ITGLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMV 545

Query: 526 -----RLIWKIEDVDIDTDRRDIEE 545
                 ++  ++D+DI+  R   +E
Sbjct: 546 YSGEWMILRPLKDIDINHFRCVYDE 570

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  261 bits (667), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 161/489 (32%), Positives = 252/489 (51%), Gaps = 20/489 (4%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           VKR LK RH                     L+  GP+  L+ +  +G + ++V +S+GEM
Sbjct: 44  VKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEM 103

Query: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVA 178
            T  P  S F+  S+RF S +  A +GY Y   +    A E + +  I+QFW   VP+  
Sbjct: 104 ITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYG 163

Query: 179 WISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPV-GFRY 237
           +I IF V      M  V  +GEFE+W+A  K++ ++ + I+ +  + G     P  GF Y
Sbjct: 164 YILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFGFHY 223

Query: 238 WRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 297
           W NPG +  G          F G     +  +  Y GTE V + A E+ NP K+VP AIK
Sbjct: 224 WNNPGALADG----------FKGIAVVFVFCSSFYSGTESVALAATESRNPGKAVPIAIK 273

Query: 298 KVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVI 357
           +  +RI+  Y+G   F G  VPYND  L +    +  SP  I+I  +G     H+ NA I
Sbjct: 274 QTFWRIIIVYLGIAVFYGATVPYNDTSLGAHTKALK-SPIAIAITRAGWEGGVHLVNAFI 332

Query: 358 LSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETS 417
           L T +SA N ++Y+GSR +  L+   LAP+ L  T+K GVP  ++      G ++ M  S
Sbjct: 333 LITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLMNVS 392

Query: 418 TGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYA 477
            G   A+++++N++GV  F  W  IS++H+RF +A + +G S  +LP+K+   P    ++
Sbjct: 393 VGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGPIFS 452

Query: 478 IFFMTLIIIIQGFTSFCPSFDGIDFLAAYI----SCFLFIAIWIVFQLWFRCRLIWKIED 533
           +     + +IQG+T+F P F   DF+ AYI    +  L+I I +V    F+   +  +  
Sbjct: 453 LAANIFLGLIQGWTTFVP-FSAKDFVDAYILLPAAVILYIVISLVKIGGFK---LVDLRT 508

Query: 534 VDIDTDRRD 542
           VD++  RR+
Sbjct: 509 VDLEEGRRE 517

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  262 bits (670), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 166/507 (32%), Positives = 256/507 (50%), Gaps = 23/507 (4%)

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           +KR +K RH                     L   GP G +I Y  +  + Y + Q+ GEM
Sbjct: 83  LKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEM 142

Query: 119 ATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV 177
           A   P +  +F  +S + +S  FG A  ++Y   W     LEL      I++W  ++   
Sbjct: 143 AVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINAD 202

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVGFR 236
            +I+IF+V ++ ++ F  R YGE EF     KVL I+GF+I  + + CG AG    +G +
Sbjct: 203 VFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAK 262

Query: 237 YWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 296
           YW +PG    G  A      KF G    L+   F+Y GTEL  +T  E +NPR+++    
Sbjct: 263 YWYDPGAFAVGSGA-----TKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSIT 317

Query: 297 KKVVFRILFFYIGSLFFIGLLVPYNDPKL--TSDDSYVAASPFIISIQNSGTPILPHIFN 354
           K+ ++RIL  Y+ ++  IG LVP+   +L  +S  S   ASP+++++   G  I+PHI N
Sbjct: 318 KQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATHASPYVLAVSLHGVKIVPHIIN 377

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           AVIL  +IS  NS +Y G RI+  L++   APR L+  ++ G P V++I   +FG LA++
Sbjct: 378 AVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFV 437

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             S   E  F WL  I G++  F+W  I +SHVRF QA+ Y      +L +KA      +
Sbjct: 438 AASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGS 497

Query: 475 YYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYIS----CFLFIAIWIVFQLWFRC 525
              + F  L+ I Q + S  P       D + F  +Y++      LF    IVF+ W   
Sbjct: 498 VLGLSFNILVFIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNW--- 554

Query: 526 RLIWKIEDVDIDTDRR--DIEEVVWED 550
            +I  ++D+D+D  R   D + +  ED
Sbjct: 555 EIIKPLKDIDLDHYRSIYDQDRLYQED 581

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  260 bits (665), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 154/446 (34%), Positives = 231/446 (51%), Gaps = 14/446 (3%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           NG      +KR LK RH                     L   GP+  +I +L  GT +  
Sbjct: 69  NGSFDPDSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVG 128

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+    PV  +F  +  RFL PS       +Y   W     LE+      IQFW
Sbjct: 129 TIHGLGEITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFW 188

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
            +++  V W++IF+V +VA+N+F VR +GE EF  +SIKV+ I GF+I C+ ++ G G T
Sbjct: 189 NTSIDPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPT 248

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              VG RYW +PG +  G          F G  S  + A+++  G+E+  + +GE  +P 
Sbjct: 249 HEYVGARYWHDPGALAHG----------FKGVASVFVTASYSLGGSEMACLASGE-TDP- 296

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K +P AIK+V +RI+FF++ SL  +G LVPY +  L    S V  SPF+I+       +L
Sbjct: 297 KELPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VNNSPFVIACNLYHIKVL 355

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P I NAVIL +I+S  NS ++  SR +  ++   L P+I    ++ G P V +I   LFG
Sbjct: 356 PSIINAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFG 415

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  S+     FNWL+ I G+A    WL I++SH+RF  A++ +  + D+L F +  
Sbjct: 416 LLAFLVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSAV 475

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP 495
               + Y+     LI+I Q + S  P
Sbjct: 476 GIWGSVYSAVVNVLILIAQFYISLWP 501

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  262 bits (669), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 172/578 (29%), Positives = 283/578 (48%), Gaps = 33/578 (5%)

Query: 1   MDKKQE-----EPLKNG----KIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXAN 51
           M+K  E      PL N        S S E+ ++    R   VH                N
Sbjct: 11  MEKNTEFEVTDSPLYNNFNTSTTASLSPEVKEHSEESRNGLVHRFVDSFRRAESQCLEEN 70

Query: 52  GQIREA--------EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLF 103
             + +          +K+ +K RH                     L  AGP   +I Y+ 
Sbjct: 71  NDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVL 130

Query: 104 MGTLVYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSV 162
           +  + Y + Q+ GEM   +  +  +F  ++  F+S SFG A  +++   W     LEL  
Sbjct: 131 VSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELIT 190

Query: 163 VGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLC 222
               I++W  ++    +I IF+V L+ ++ F V+ YGE EF   S K+L + GF+I  + 
Sbjct: 191 SSMTIKYWNDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVV 250

Query: 223 MVCG-AGVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGIT 281
           + CG AGV G +G +YWR+PG    G      N  +F G    L+ A F++ G EL  ++
Sbjct: 251 INCGGAGVDGYIGGKYWRDPGSFADGS-----NATRFKGICFILVTAYFSFGGIELFVLS 305

Query: 282 AGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIIS 340
             E +N RKS P A K+ V+RIL  Y+ ++  IG  VP+N+ +L  S  +   ASP++++
Sbjct: 306 INEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLA 365

Query: 341 IQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWV 400
                  ++PHI NAVIL ++IS ANS +Y   R+M  L++   APR L+  ++ G P  
Sbjct: 366 ASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLR 425

Query: 401 SVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISR 460
           ++    L G + ++  S   E AF WL  I G++  F+W  I +SH+RF +A++ +G S 
Sbjct: 426 ALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSL 485

Query: 461 DDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGID-----FLAAYISCFLFIAI 515
            +L +KA      +YY +FF  L+ + Q + +  P  +G       F   Y++  L+I +
Sbjct: 486 GELGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFM 545

Query: 516 WIVFQLWFRC-RLIWKIEDVDIDTDRR--DIEEVVWED 550
           ++ + L+ +   L+  ++ +D+D  RR  D E +  ED
Sbjct: 546 YLGYMLYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQED 583

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  261 bits (666), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 165/493 (33%), Positives = 270/493 (54%), Gaps = 21/493 (4%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            IRE ++KR+L  RH                     L   GP    + Y   G +VY   
Sbjct: 63  NIRE-DLKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLFMNYSIFGGVVYLTM 121

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
             LGEM+T++P++ SF  ++++F S SF  A  + YWF+ A++ A +L+ +  ++ +W +
Sbjct: 122 MCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWKT 181

Query: 173 A---VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGV 229
                P  A   +FWV ++ +N+  VR YGE E+W+A +KV+AI+ F I  + +  G   
Sbjct: 182 KDHHFPYWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIIIFFILSIVVNVGHNP 241

Query: 230 TGP-VGFRYWRN-PGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287
               +GF  W +   P   G          F G+ S  ++A+F Y GTE + +T GEA N
Sbjct: 242 EHKYIGFHNWNHGDAPFVNG----------FKGFASLFVSASFAYGGTESITLTNGEATN 291

Query: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTP 347
           P ++ P+ IK V +RIL FY+ S FFI + VPY+ P L +    V  SPF I  Q +G+ 
Sbjct: 292 PVRNTPKVIKTVFWRILIFYVFSAFFIAMNVPYDYPGLATKS--VMTSPFTIVFQMAGSK 349

Query: 348 ILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGL 407
                 NAVI++++ISA N  ++ GSR+M+ +S     P+ +++TN+   P+V+V  T  
Sbjct: 350 GAGSFMNAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTKTNRYKAPYVAVAITWA 409

Query: 408 FGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKA 467
            G L +  +  G    + WL NI GV+   +WL I+I+ +RF + LE +G +  +L FK 
Sbjct: 410 VGGLCFGASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRRGLELQGKTH-ELKFKN 468

Query: 468 KFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRL 527
              P   Y+ + F++ +I+IQG+++F P +   +F + Y+  F+F A ++++ L+ R + 
Sbjct: 469 WTYPWGPYFLVVFVSFVILIQGWSAFDP-WSTSNFFSVYLELFVFPACYLIWWLYKRDKF 527

Query: 528 IWKIEDVDIDTDR 540
           I K ED+D  TD+
Sbjct: 528 I-KYEDMDFVTDK 539

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  261 bits (667), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 149/506 (29%), Positives = 265/506 (52%), Gaps = 16/506 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           + ++K+ +K RH                     L   GP G +I Y+   T++Y V Q+ 
Sbjct: 73  QKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQAC 132

Query: 116 GEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
            E+  ++  +  ++  +    +   F  A  ++Y   WAI   LEL      I++W  ++
Sbjct: 133 CELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDSI 192

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
               +++IF+  +V ++ F  + Y E EF   S KVL ++GF+I  + + CGA  +G +G
Sbjct: 193 NPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKSGYIG 252

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
            +YW  PG     +  K ++   F G  S  + +AF Y G+E + +TA E  NPRKSVP+
Sbjct: 253 GKYWHTPGAF---VGEKAIDH--FKGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPK 307

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVA--ASPFIISIQNSGTPILPHI 352
           A K+ ++R+L  ++  +  +G LVPY+ P L       A  ASPF+I+  + G  ++PHI
Sbjct: 308 ATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHI 367

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            NAVIL ++IS  NS  Y   RI+  L++  + P++ +  ++ G P V+++F  +FG ++
Sbjct: 368 INAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLIS 427

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S   E  F WL  I  ++  F+W  IS+SH+RF  A++ +G S  +L +KA     
Sbjct: 428 FVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYW 487

Query: 473 LAYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
            ++YAI F  +++  Q + +  P       D  +F   Y++  + +  +  ++LW+R  +
Sbjct: 488 GSWYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRDWK 547

Query: 527 LIWKIEDVDIDTDRR--DIEEVVWED 550
           L    + VD+++ R+  D + +  ED
Sbjct: 548 LFIPADKVDLESHRKIFDADLIKQED 573

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  260 bits (664), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 156/497 (31%), Positives = 261/497 (52%), Gaps = 18/497 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
             ++K+ LK+RH                     L   GPVG LIAYLF+G +V     ++
Sbjct: 46  RTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAI 105

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFAL----ELSVVGQIIQFWT 171
            E+A+F+P T +    +++F+  S G      + F W  T++     ELS    I+++WT
Sbjct: 106 AEVASFMPATGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSATAVIMRYWT 159

Query: 172 SAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTG 231
              P V +I++F +L V  N++ +RFYGE E+    +K++ I   +I  L +  G G  G
Sbjct: 160 DVSPAV-FITVFGILFVVTNIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLG-GTKG 217

Query: 232 P--VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              +GF YWR PGP    ++  ++   KF+G+ +++ +  ++Y G + + I AGE  N R
Sbjct: 218 QERLGFHYWREPGPFANYLVGGHI--GKFVGFWAAISSVVYSYSGIQNIAILAGETKNSR 275

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
            ++    K V  RI+  Y+ ++F + L+VPYND  + +      +SPF+I++  +G  +L
Sbjct: 276 HAIFHGAKNVFLRIIVLYLVTVFILTLIVPYNDKLIATGTGTARSSPFVIAMNRAGIKVL 335

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           PHI NA+IL++  SA N  +  GSR +F L+    AP+I  RT+K G+P+V VIF   F 
Sbjct: 336 PHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFL 395

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LAYM  S      F W   +        W+ IS +H+   +AL+ +G SR DLP+    
Sbjct: 396 PLAYMSCSKSSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPM 455

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLI 528
            P  A+++     + ++  GF +F    FD   F   Y    L I ++  ++L+ + + +
Sbjct: 456 GPFAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTKYL 515

Query: 529 WKIEDVDIDTDRRDIEE 545
            +  +VD+++   DI+E
Sbjct: 516 -RPHEVDLESIFDDIKE 531

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  262 bits (669), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 151/499 (30%), Positives = 266/499 (53%), Gaps = 12/499 (2%)

Query: 54  IREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQ 113
           I++ E+KR++ QRH                     L +AGP G LI Y  MGT VY V Q
Sbjct: 112 IKKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQ 171

Query: 114 SLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
           + GE+  T+  +   F  +    ++PSF  + G++Y   W     LEL      I++WT+
Sbjct: 172 AAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTT 231

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTG 231
            V    ++ IF++L++ +N F  + Y E +F+   +K+  I GF I  + + CG AG  G
Sbjct: 232 KVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDG 291

Query: 232 PVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
            +G +YW NPG        K ++   F G  S  + +AF + G+E V ++A E ANPRKS
Sbjct: 292 YLGGKYWHNPGAFRG---EKAIDH--FKGVSSVFVTSAFAFGGSEFVALSASEQANPRKS 346

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPH 351
           +P A K +++RI++ Y+ S+  +G LVP++ P+L         SP++++I   G  ++PH
Sbjct: 347 IPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKKTSPYVVAIAMHGVKVVPH 406

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
           + NAVIL  ++S +NS  +  SR++  LS+   AP+     ++ G P  +++ + LFG +
Sbjct: 407 LINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVI 466

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
            +  TS      F+WLL I+G++  F++  I +SH+R   A++ +G S  +L F+++   
Sbjct: 467 CFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGT 526

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
             ++YA   + L ++ + + +  P      D   F   Y++  + I  +  + +W +  R
Sbjct: 527 YGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFR 586

Query: 527 LIWKIEDVDIDTDRRDIEE 545
           +  + +D+D+D  R+  +E
Sbjct: 587 IFIRSKDIDLDFKRQVFDE 605

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  260 bits (665), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 154/515 (29%), Positives = 264/515 (51%), Gaps = 27/515 (5%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
           ++K+ +K RH                     L  AGP G +I Y     ++Y + Q+ GE
Sbjct: 69  KMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAGE 128

Query: 118 MA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPI 176
           +   +  +  ++T +S   + P+ G +  ++Y   W     L+L      +++WT+A P 
Sbjct: 129 LGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYWTNANPD 188

Query: 177 VAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVGF 235
           + ++++F+V+++ +NMF  + Y E EF     KVL I GF+I  + + CG AG +G +G 
Sbjct: 189 I-FVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYIGA 247

Query: 236 RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 295
           +YW +PG    G          F G       AAF+Y G E++ +TA E  NPRKS+P A
Sbjct: 248 KYWHSPGSFAAG----------FKGVCYVFCYAAFSYGGIEVMVLTASEQENPRKSIPNA 297

Query: 296 IKKVVFRILFFYIGSLFFIGLLVPYNDPKL--TSDDSYVAASPFIISIQNSGTPILPHIF 353
            KKV++RIL  Y+ +   +  LVPYN  +L  +S +S   ASP +I++ + G  I+PHI 
Sbjct: 298 CKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVIAVASHGVKIVPHII 357

Query: 354 NAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAY 413
           NAVIL ++IS  NS++Y   R++  LS+   AP+ L+  ++ G P +    T L   +A+
Sbjct: 358 NAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVALIAF 417

Query: 414 METSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGL 473
           +  S   E  F WLL I+G++  F W  I +SHVRF  A+  +G+S   + +K++     
Sbjct: 418 VAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTGYWG 477

Query: 474 AYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RL 527
           +++AI    L++I Q + +  P       +   F   Y++  + +  +  ++++ +  RL
Sbjct: 478 SWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYKVYHKDWRL 537

Query: 528 IWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWN 562
                +VD+ + R   +E +          D  WN
Sbjct: 538 CIPASEVDLSSHRNISDEEILRQE------DYEWN 566

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  260 bits (665), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 154/514 (29%), Positives = 264/514 (51%), Gaps = 27/514 (5%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G      +K+ LK RH                     L   GP+  +I +   G+ +  
Sbjct: 70  DGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVG 129

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+    PV  +F  ++ RFL PS       +Y   W     LE+      +Q+W
Sbjct: 130 TIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYW 189

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
             ++  V +++IF+ ++V++N+F  R +GE EF  +++K++ I GF+I C+ ++ G G  
Sbjct: 190 NDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGGPD 249

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              +G +YW NPG +  G          F G +S L+ A+++  GTE+  + +GE  +P 
Sbjct: 250 HEYIGAKYWHNPGSLAHG----------FKGVLSVLVVASYSLGGTEMTCLASGE-TDP- 297

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K +P AIK+V +RILFF++ SL  +G LVPY +P L    S V  SPF+I+I+     +L
Sbjct: 298 KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSS-VDNSPFVIAIKIHNIKVL 356

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P I NAVIL +I+S  NS ++  SR +  ++   L P      ++ G P   +I   LFG
Sbjct: 357 PSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIIINSLFG 416

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  S+     F+WL+ I G+A    WL I+I HVRF  A++ +  + D+L F +  
Sbjct: 417 LLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELEFVSAV 476

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPSFDGID-------FLAAYISCFLFIAIWIVFQLW 522
               + Y+     LI++ Q + +  P     D       F   Y+   + I ++I  +++
Sbjct: 477 GIWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVLFIGHKIY 536

Query: 523 FRCRLI--WK---IEDVDIDTDRRDIE-EVVWED 550
           +R      W+   ++D+D+DTDR++++ E++ ++
Sbjct: 537 YRVTTGHWWEYIALKDIDLDTDRKNVDIEIIKQE 570

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  259 bits (662), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 160/491 (32%), Positives = 246/491 (50%), Gaps = 20/491 (4%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +  VKR LK RH                     L   GP+  L+ +  +G + +++ +S+
Sbjct: 48  KTGVKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESI 107

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           GEM T  P    FT  ++RF S S  A  GY Y   +    A E + +  I QFW   VP
Sbjct: 108 GEMITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFWGPQVP 167

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPV-G 234
           +  +I IFW    A  M  V  +GE E+W++  K+L ++ F I+    + G     P  G
Sbjct: 168 LYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRPAFG 227

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
           F YW NPG +  G          F G     +  +  Y GTE V  +A E+ NP +++P 
Sbjct: 228 FHYWNNPGALSHG----------FKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIPL 277

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFN 354
           AI++  +RIL  YIG  FF G+ VPYND  L +    +  SP  I+I  +G     H+ N
Sbjct: 278 AIRQTFWRILVVYIGIGFFYGVTVPYNDHNLNAGTKALK-SPISIAITRAGWEGGTHLVN 336

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           A IL T ISA N ++++GSR +  L+   LAP+ L+ T++ GVP  ++      G ++ M
Sbjct: 337 AFILVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVSLM 396

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             S G   A+++++N++GV  F  W  I ++H+RF +A   +G +  +LP+KA F P   
Sbjct: 397 NVSVGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQ 456

Query: 475 YYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYI----SCFLFIAIWIVFQLWFRCRLIWK 530
              I     + +IQG+TSF P F   DF+ AY+    +  L+I I ++    F+      
Sbjct: 457 IIGIAANIFLALIQGWTSFVP-FKAGDFVDAYVLLPAAAVLYIGISLLKTHSFKTV---D 512

Query: 531 IEDVDIDTDRR 541
           +  +D+D  RR
Sbjct: 513 LLTIDLDEGRR 523

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  259 bits (662), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 156/504 (30%), Positives = 254/504 (50%), Gaps = 26/504 (5%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G      +K+ LK RH                     L   GP+  +I +   GT +  
Sbjct: 65  DGSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVG 124

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+    PV  +F  +  RFL PS       +Y   W     LE+      +++W
Sbjct: 125 TIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYW 184

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
            S+VP VAW++IF+  +  +N+  VR +GE EF  + IKVL I+GF+I C+ ++CG G  
Sbjct: 185 GSSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPK 244

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              VG +YW +PGP+  G          F G  +  + A+++  GTE+  + +GE  +P 
Sbjct: 245 HEFVGAKYWSDPGPLANG----------FKGVAAVFVIASYSLGGTEMACLASGE-TDP- 292

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K +P AIK+V +RI+FF++ SL  +G LVPY +  L    S V  SPF+I+I+  G   L
Sbjct: 293 KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSS-VDNSPFVIAIRLHGIKAL 351

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P + NAVIL +++S  NS ++  SR +  ++   L PRI    ++ G P V ++    FG
Sbjct: 352 PSVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFG 411

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  S+  +  F WL+ I G+A    WL I++SH+RF  A++ +G+S D+L F +  
Sbjct: 412 LLAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAV 471

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSF-------CPSFDGIDFLAAYISCFLFIAIWIVFQLW 522
               + Y+     LI++ Q + S         PS    +F   Y+   + + ++   +++
Sbjct: 472 GVYGSVYSATINVLILVAQFYVSLWPVGGWSSPSTRTENFFQNYLCSLILLLLFAGHKIY 531

Query: 523 FRCRL-----IWKIEDVDIDTDRR 541
           +R           + D+D+ TD R
Sbjct: 532 YRISTGKWWGFKALRDIDLLTDMR 555

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  259 bits (661), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 159/515 (30%), Positives = 271/515 (52%), Gaps = 21/515 (4%)

Query: 51  NGQIREA---EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTL 107
           +G++  A   ++K+ +K RH                     L   GP G LI Y F+  +
Sbjct: 60  DGEVTSAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSII 119

Query: 108 VYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQI 166
            Y + Q+ GEMA   P +  +F  +S  F+S  FG A  +++   W     LEL     +
Sbjct: 120 SYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIV 179

Query: 167 IQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG 226
           +++WT+ +    ++ IF++ ++ ++    R YGE EF   S KVL + GF+I  + + CG
Sbjct: 180 VKYWTTKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCG 239

Query: 227 A-GVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEA 285
           A G  G +G +YW  PG    G     ++  K + +V  L+ A F+Y G EL  ++  E 
Sbjct: 240 AVGDDGYIGGKYWHEPGAFAAG---SGIDRFKGIAYV--LVTAYFSYGGMELYALSVNEL 294

Query: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNS 344
            NPRK++P A  K V+RIL  Y+ ++  IG LVP++  KL  S  S V  SP+++++   
Sbjct: 295 PNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPSPYVLALSLH 354

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G  I+PHI NAVIL ++IS  NS +Y G R++  L++   AP+IL   ++ G P +++I 
Sbjct: 355 GIKIVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALII 414

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
             +FG +A++  S   E  F WL  I+G++  F+W  I +SH RF +A++ +G S + L 
Sbjct: 415 CSVFGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLG 474

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDF--LAAYISCFLFIAIWIVFQLW 522
           +++      + YA+ F   ++I Q + +  P  +G  F   + + SC L + +W+   + 
Sbjct: 475 YRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSC-LALPLWLSMAVG 533

Query: 523 FRC-----RLIWKIEDVDIDTDRR--DIEEVVWED 550
           +        ++  +  + +D+ RR  D+E +  ED
Sbjct: 534 YMIVTKNWTILNPLSSISVDSHRRSYDVEVMKQED 568

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  258 bits (660), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 161/514 (31%), Positives = 266/514 (51%), Gaps = 27/514 (5%)

Query: 51  NGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYS 110
           +G      +KR+LK RH                     L   GP+  +I +   G+ +  
Sbjct: 62  DGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVG 121

Query: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170
               LGE+    PV  +F  +S R L PS       +Y   W     +EL      +QFW
Sbjct: 122 TIHGLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFW 181

Query: 171 TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT 230
           T+ V  V W++IF+V++V++N+F V+ +GE EF  + +KV+ I+GF+I  + ++CG G  
Sbjct: 182 TTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPD 241

Query: 231 GP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              +G  YW +PG +  G          F G  S  + A+++  G+E+V + + E  +P 
Sbjct: 242 HRFIGTEYWHHPGALANG----------FKGVASVFVTASYSLGGSEMVCLCSAET-DP- 289

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
           K +P AIK+V +RI+FF++ SL  +G LVPY +  L    S V  SPF+I+I+ SG  +L
Sbjct: 290 KELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSS-VNNSPFVIAIKLSGIRVL 348

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           P I NAVIL +I+S  NS ++  SR +  ++   L PR+    ++ G P V +I   LFG
Sbjct: 349 PSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFG 408

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LA++  S      F+WL+ I G+A    WL I+ISH+RF  A++ +  S D+L FK+  
Sbjct: 409 LLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSV 468

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP-------SFDGIDFLAAYISCFLFIAIWIVFQLW 522
               + Y+     LI+I Q + S  P             F   Y+   + + +++  +++
Sbjct: 469 GVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIY 528

Query: 523 FRCRL-----IWKIEDVDIDTDRRDIE-EVVWED 550
           F+C          + ++D++TDR++I+ E+V ++
Sbjct: 529 FKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQE 562

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  259 bits (662), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 154/495 (31%), Positives = 255/495 (51%), Gaps = 12/495 (2%)

Query: 54  IREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQ 113
           I E+ +K+ +K RH                     L  +GP   ++AY  +  + Y + Q
Sbjct: 96  ISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQ 155

Query: 114 SLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
           + GEMA T+  +  +F  +   F+S  FG A  +++   W     LEL      I++W  
Sbjct: 156 AAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWND 215

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTG 231
            +    ++ IF+V L+ ++ F V+ YGE EF   S K+L I GF+I+ + + CG AG  G
Sbjct: 216 KINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDG 275

Query: 232 PVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
            +G +YW +PG         + N  +F G    L+ A F+Y GTEL  ++  E  NPRKS
Sbjct: 276 YIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKS 330

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPY-NDPKLTSDDSYVAASPFIISIQNSGTPILP 350
            P+A K+ ++RI+  Y+ ++  IG  VP+ ND  + S  S   ASP++++    G  I+P
Sbjct: 331 TPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRIVP 390

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           H  NAVIL ++IS ANS++Y   R++  L++   AP+ L+  ++ G P  ++    LFG 
Sbjct: 391 HFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGV 450

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           + +   S   E  F WL  I G++  F+W  I +SHVRF QA++ +G   ++L +KA   
Sbjct: 451 IGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSG 510

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCPSFD---GIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
              + Y +FF  L+   Q + +  P       + F  +Y++  +F   +  + LW +   
Sbjct: 511 VWGSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWNKDFT 570

Query: 527 LIWKIEDVDIDTDRR 541
            +  +E +D+D  RR
Sbjct: 571 FLIPLESIDLDFHRR 585

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  258 bits (659), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 152/504 (30%), Positives = 258/504 (51%), Gaps = 14/504 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +  +K+ +K RH                     L+  GP   +I Y+ +  + Y + Q+ 
Sbjct: 63  DRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAA 122

Query: 116 GEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GEMA   P +  SF  ++  F+S   G A  +++   W     LEL      IQ+W  ++
Sbjct: 123 GEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYWNDSI 182

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGAGVTGPV 233
               WI IF+V L+ +++F V+ YGE EF   + K+L I GF+I+ + +   GAG  G +
Sbjct: 183 NADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYI 242

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G +YW+NPG       A    +  ++     L+ A F+Y GTEL  ++  E ANPR+S P
Sbjct: 243 GAKYWKNPGSFASSTSAGRFKDVCYV-----LVTAYFSYGGTELYVLSVNEQANPRRSTP 297

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPY-NDPKLTSDDSYVAASPFIISIQNSGTPILPHI 352
           +A K+ ++RIL  Y+ ++  IG  VP+ ND  + +  S   ASP++++    G  ++PHI
Sbjct: 298 KAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASPYVLAASIHGVKVVPHI 357

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            NAVIL  + S  NS++Y   R+   L++   AP+ L+  ++ G P +++    + G +A
Sbjct: 358 INAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGVIA 417

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           +   S+  E  F WL  I  ++  F+W  I +SH+RF  A++ +G   ++L +KA     
Sbjct: 418 FAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTGVW 477

Query: 473 LAYYAIFFMTLIIIIQGFTSFCP---SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLI 528
            + +   F  L+ I Q + +  P   +     F  +Y++  L++  +  + LW R    +
Sbjct: 478 GSMWGFGFCVLVFIAQFWVALSPPGGTISAEGFFESYLAFPLWLFFYFAYMLWKRDFTFL 537

Query: 529 WKIEDVDIDTDRR--DIEEVVWED 550
            K+ED+D+D  RR  D E +  ED
Sbjct: 538 TKLEDIDLDAHRRIYDPEFLRQED 561

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  258 bits (659), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 160/524 (30%), Positives = 271/524 (51%), Gaps = 24/524 (4%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
           EV R LK RH                     L++ GP   LI+Y  M   V+++   + E
Sbjct: 63  EVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTE 122

Query: 118 MATFIPVT--SSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           M   IP++  SS    +  +L+       G+  +++ ++    E++    +I++WT A  
Sbjct: 123 MVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWTDANA 182

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP--V 233
            + +++IF +L   +++ PV+ +GE EF V+ IK+L I+G ++  + +  G G      +
Sbjct: 183 AI-FVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVL 241

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKSV 292
           GF YW  PG     ++  +     FL    ++I + F +    E+    + EAA PRK++
Sbjct: 242 GFHYWNTPGAFNSYLVKGS--TGAFLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNM 299

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL----TSDDSYVAASPFIISIQNSGTPI 348
           PRA ++ V+R+  FY+     IG++V Y++  L    +S  +  AASPF+I IQ +G  I
Sbjct: 300 PRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGIRI 359

Query: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLF 408
           LPHI NA IL++  S + S +Y  SR++  L+    AP+  S+ NK GVP+ SV  T LF
Sbjct: 360 LPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLF 419

Query: 409 GALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAK 468
           G LAY+  S      FNWL NI  ++GF +W+F+SI+++RF +  +Y  I+ D +P++ +
Sbjct: 420 GVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKIN-DRVPYRRR 478

Query: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYISCFLFIAIWIVFQLWFRCRL 527
               LAY +  F  L+ I  GF  F   +++  DF   Y++      ++I   ++++   
Sbjct: 479 GQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSIYYK--- 535

Query: 528 IWKIEDVDI-------DTDRRDIEEVVWEDPPPVTFWDKFWNVV 564
            W   D+D+         D+ D EE     PPP  + ++ W +V
Sbjct: 536 EWTFRDMDVVGREIMPKIDQADQEEKEEYLPPPKNWVERVWRIV 579

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  258 bits (658), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 152/515 (29%), Positives = 265/515 (51%), Gaps = 26/515 (5%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +E +V R+LK RH                     L+  GP   LI+Y+ M   V+ +   
Sbjct: 63  QEHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWCIMNF 122

Query: 115 LGEMATFIPVTSSFTVFSQR--FLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
           L EM   +P++   ++F+    +L+       G   +++ ++    E++    +IQ+WT 
Sbjct: 123 LTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQYWTD 182

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
           A   + +ISIF V+ V++ M PV F+GE EFWV+ IK+  I G +I  + +  G      
Sbjct: 183 ANSAI-FISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGAPNQD 241

Query: 233 --VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGT-ELVGITAGEAANPR 289
             +GF YW++PG   P ++  N    KFL   +++I + F+Y    E+V   A EA +PR
Sbjct: 242 KVLGFHYWKHPGAFNPHLVPGN--TGKFLACWTAIIKSGFSYVLVPEVVVSCAAEAKDPR 299

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL----TSDDSYVAASPFIISIQNSG 345
           +++PR  ++ V+R+  FY+     IG++V Y++ +L     + +S  AASPF+I IQ  G
Sbjct: 300 RNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGIQEVG 359

Query: 346 TPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFT 405
             +LPHI NA IL++  S   S +Y  SR++  ++ +   P+I + TN+ G P+ S    
Sbjct: 360 IRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYSTAAA 419

Query: 406 GLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPF 465
            +F  LAY+  S      F WL NI  ++GF  W+ + + ++RF + +E+  ++ D +PF
Sbjct: 420 SVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANLT-DKMPF 478

Query: 466 KAKFMPGLAYYAIFFMTLIIIIQGFTSF-CPSFDGIDFLAAYISCFLFIAIWIVFQLWFR 524
           + +FM  LAY +  F  ++ +  G+  F   +++  DF A Y +  L   ++I   ++++
Sbjct: 479 RKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLYIGAAIYYK 538

Query: 525 CRLIWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDK 559
                           RD++EV  E  P +   D+
Sbjct: 539 ------------TIKLRDLDEVAAEIIPKIAMADE 561

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  256 bits (655), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 163/497 (32%), Positives = 262/497 (52%), Gaps = 18/497 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
             ++K+ LK+RH                     L   GPVG LIAYLF+G +V     ++
Sbjct: 41  RTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAI 100

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFAL----ELSVVGQIIQFWT 171
            E+A+F+P T +    +++F+  S G      + F W  T++     ELS    I+++WT
Sbjct: 101 AEVASFMPATGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSATAVIMRYWT 154

Query: 172 SAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTG 231
              P V +I+IF VL V  N++ +RFYGE E+    +K++ I   +I  L +  G GV G
Sbjct: 155 DISPAV-FITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLG-GVKG 212

Query: 232 P--VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              +GF YWR+PGP    I+  ++   KF+G+ S+L +  ++Y G + + I AGE  N R
Sbjct: 213 QERLGFHYWRDPGPFAEYIVGGSI--GKFVGFWSALSSVVYSYSGIQNIAILAGETKNSR 270

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
            ++    K V  RI+  Y+ ++F + L+VPYND  + S      +SPF+I++  +G  +L
Sbjct: 271 HAIYHGAKNVFLRIIVLYLVTVFVLTLIVPYNDALIASGTGTAKSSPFVIAMNRAGIKVL 330

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           PHI NA++L++  SA N  +  GSR +F L+    AP+I  +T+K G+P+V VIF   F 
Sbjct: 331 PHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFL 390

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LAYM  S      F W   +        W+ IS +H+   +AL+ +G SR DLP+    
Sbjct: 391 PLAYMSCSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYSTPI 450

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPS-FDGIDFLAAYISCFLFIAIWIVFQLWFRCRLI 528
            P  A+++     + ++  GF +F    FD   F   Y    L I ++  ++L+ + R +
Sbjct: 451 APYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTRYL 510

Query: 529 WKIEDVDIDTDRRDIEE 545
            + E+VD+ +   DI E
Sbjct: 511 -RPEEVDLASIFDDIRE 526

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  258 bits (658), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 157/506 (31%), Positives = 261/506 (51%), Gaps = 16/506 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +  +K+ +K RH                     L  AGP   ++ Y  +  + Y + Q+ 
Sbjct: 75  DDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAA 134

Query: 116 GEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GEMA T+  + +SF  ++  F+S  FG A  +++   W     LEL      I++W   +
Sbjct: 135 GEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDTI 194

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPV 233
               +I IF+V L+ ++ F V+ YGE EF   S K+L I GF+I  + + CG AG  G +
Sbjct: 195 NPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYI 254

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G +YW NPG       A     A+F G    L+   F+Y GTEL  ++  E  NPRKS P
Sbjct: 255 GNKYWINPGAF-----ASESPAARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTP 309

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHI 352
            A K+ ++RIL  Y+ ++  IG  VP++  +L  +  S   ASP++++    G  ++PH 
Sbjct: 310 AAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAASLHGVKVVPHF 369

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            NAVIL +++S ANS +Y   R+M  L++   AP+  +  ++ G P  ++   GLFG + 
Sbjct: 370 INAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIG 429

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           ++  S   E AF WL  I G++  F+W  I ISH+RF  A++ +G S ++L ++A     
Sbjct: 430 FVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGIW 489

Query: 473 LAYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
            + Y++FF  L+ I Q + +  P      +D   F  +Y++  L++  +  + ++ R   
Sbjct: 490 GSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRDFT 549

Query: 527 LIWKIEDVDIDTDRR--DIEEVVWED 550
            +  ++ +D+D  RR  D E +  ED
Sbjct: 550 FLTPLDKIDLDFHRRIYDPELLRQED 575

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  256 bits (655), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 160/527 (30%), Positives = 273/527 (51%), Gaps = 30/527 (5%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
           +++R LK RH                     L+  GP   LI+Y+ M   V+++   L E
Sbjct: 58  QMQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTE 117

Query: 118 MATFIPV--TSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           M    P+   +S    ++ +L+       G+  +++ A+    E++    +IQ+WT A  
Sbjct: 118 MVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWTDANS 177

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP--V 233
            + ++SIF V+ +A+   PV+ +GE EFWV+ IK++ I G +I  + +  G G      +
Sbjct: 178 AI-FVSIFIVITIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVL 236

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKSV 292
           GF YW++PG   P I     N  KFL   +++I + F +    E +   + EA  PR+++
Sbjct: 237 GFHYWKHPGAFKPHI--STGNTGKFLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNM 294

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL----TSDDSYVAASPFIISIQNSGTPI 348
           PRA  + V+R++ FYIG    +G+ V Y++  L     S  S  AASPF+I I+  G  +
Sbjct: 295 PRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKV 354

Query: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLF 408
           LPHI NA IL+   SA  + +Y  SR++  ++    AP+I +R N+ GVP+ S+I    F
Sbjct: 355 LPHIINAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCF 414

Query: 409 GALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAK 468
             LAY+  S      F WL NI+ ++GF SW+F+SI++VRF + ++Y  ++ D + F+  
Sbjct: 415 CFLAYLNCSNSASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDLN-DRIKFRKP 473

Query: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYISCFLFIAIWIVFQLWFRCRL 527
           F    AY++  F  ++ +  G+  F   ++   DF A YI+    + ++I+   +++   
Sbjct: 474 FQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFANYITIGFVVVLFIMGTAYYKE-- 531

Query: 528 IWKIEDVD---------ID-TDRRDIEEVVWEDPPPVTFWDKFWNVV 564
            W+  D++         ID  D  +  E+V E   P T++ K  NV+
Sbjct: 532 -WRFRDMEEIRSELIPKIDMADEEESNEIVIE---PTTWYGKLGNVL 574

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  258 bits (659), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 151/515 (29%), Positives = 269/515 (52%), Gaps = 10/515 (1%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            + E   +R+L  R                      +   GP   LIA+     +   ++
Sbjct: 111 SLEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLS 170

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
           + +  M T++PVT SF  F++RF+  S G A G+ Y+   A     E++ V  ++++WT 
Sbjct: 171 KCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTD 230

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
            +P  A IS+  +L  ++N++ V F+GE EF+++  KV+  +G +I+ + ++ G      
Sbjct: 231 KIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHT 290

Query: 233 V-GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
           V GF+ W NPG     I   + +  +F G++S L+ A + + G + +G  A EA NPRK 
Sbjct: 291 VLGFKNWSNPGAFAEYI--SDGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKV 348

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVA----ASPFIISIQNSGTP 347
           +P + +KV  R++ FYIG    +G+L+PYNDP +       A    ASP++ +++  G  
Sbjct: 349 IPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIR 408

Query: 348 ILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGL 407
           +LPHI N +IL++IISA NS++Y  SR++  L+    APRI   T K GVP    I   +
Sbjct: 409 VLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLV 468

Query: 408 FGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKA 467
              LAY+  S        W LN+   A    ++FI +S+++F +    + +    LP+ +
Sbjct: 469 ICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYS 528

Query: 468 KFMPGLAYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYISCFLFIAIWIVFQLWFRCR 526
             +P LA++++F++ L++++ G+T F   S+D   F+ +Y     F+      +L+   +
Sbjct: 529 SSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTK 588

Query: 527 LIWKIE-DVDIDTDRRDIEEVVW-EDPPPVTFWDK 559
            +  +E D+    +    E+  W E+PP + ++D+
Sbjct: 589 SVRPLEMDLFTGIEELADEDRYWAENPPTLNWFDR 623

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  256 bits (654), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 156/516 (30%), Positives = 271/516 (52%), Gaps = 13/516 (2%)

Query: 53  QIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVT 112
            + E   +R+L  R                      + + GP   LIA+     +   ++
Sbjct: 39  SLEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLS 98

Query: 113 QSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172
           Q +  M T++PVT SF  F++RF+  S G + G+ Y+   A     E++ V  +++FWT 
Sbjct: 99  QCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTD 158

Query: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP 232
            +P  A ISI   L  ++N+F V  +GE EF+++  KV+  +G + + + ++ G      
Sbjct: 159 KIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHK 218

Query: 233 V-GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
           V GF+ W NPG      I+K  +  KF G++S LI A + + G + +G  A EA NPRK 
Sbjct: 219 VLGFKNWSNPGAFAE-YISKG-SAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKV 276

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVA----ASPFIISIQNSGTP 347
           +P + +KV  R++ FYIG    +G+LVP+ND  +    S  A    ASP++ +++  G  
Sbjct: 277 IPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIG 336

Query: 348 ILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGL 407
           +LPHI N +IL++IISA NS++Y  SR++  L+    AP++  +  K GVP    +   L
Sbjct: 337 VLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLF-KITKRGVPIYCCVAVLL 395

Query: 408 FGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKA 467
              LAY+  S        W LN+   A    ++FI IS+++F +  + + I    LP+ +
Sbjct: 396 VCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSS 455

Query: 468 KFMPGLAYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYISCFLFIAIWIVFQLWFRCR 526
            F+P L ++++F++ L++ + G+  F   S+D   F+ +Y     FI ++   +L+ + R
Sbjct: 456 SFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTR 515

Query: 527 LIWKIEDVDIDTDRRDI--EEVVWED-PPPVTFWDK 559
            +  +E +D+ +   ++  E+  WE+ PP +   DK
Sbjct: 516 FVKPVE-MDLFSGIAELAEEDAYWEENPPKMNLLDK 550

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  256 bits (653), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 159/500 (31%), Positives = 252/500 (50%), Gaps = 20/500 (4%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +  VKR LK RH                     L   GP+  L+ +  +G + +SV +S+
Sbjct: 46  QTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESI 105

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           GEM T  P    FT  ++RF S +  A  GY Y   +    A E + +  I+QFW   VP
Sbjct: 106 GEMITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVP 165

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPV-G 234
           +  +I IFW       +  V  +GE E+W+A +K++ ++ + I+ +  + G     P  G
Sbjct: 166 LYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFG 225

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
           F YW +PG +  G          F G     +  +  Y GTE V + A E+ NP K+VP 
Sbjct: 226 FHYWNSPGALSHG----------FKGIAIVFVFCSTFYSGTESVALAATESKNPGKAVPL 275

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFN 354
           A+++ ++RIL  YIG   F G  VP++DP L++  + V  SP  I+I  +G     H+ N
Sbjct: 276 AVRQTLWRILVVYIGIAVFYGATVPFDDPNLSAS-TKVLKSPIAIAISRAGWAGGAHLVN 334

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           A IL T ISA N ++Y+GSR +  L+   LAP+IL+ T++ GVP  ++      G ++ M
Sbjct: 335 AFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLM 394

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             S G   A+++++N++GV  F  W  IS +H+R  +A   +G S ++LP++A F P   
Sbjct: 395 NVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYEALFYPWTP 454

Query: 475 YYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYI----SCFLFIAIWIVFQLWFRCRLIWK 530
             ++     + +IQG++ F P FD  +F+ AYI       L+I I +     FR      
Sbjct: 455 VLSLAANIFLALIQGWSYFVP-FDAGNFVDAYILLPVGILLYIGICVFKSNHFRTV---D 510

Query: 531 IEDVDIDTDRRDIEEVVWED 550
           +  +++D  RR   E    D
Sbjct: 511 LRSINLDEGRRKDMEADLSD 530

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  258 bits (658), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 154/497 (30%), Positives = 270/497 (54%), Gaps = 14/497 (2%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
           ++K+ ++ RH                     L  AGP G +I Y  MG+L+Y + Q+ GE
Sbjct: 115 KLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYCIIQACGE 174

Query: 118 MA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPI 176
           MA  ++ +   F  +    + P F  A  ++Y   W     LEL      I++WT+ V  
Sbjct: 175 MAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKYWTTKVDP 234

Query: 177 VAWISIFWVLLVAMNMFP-VRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT-GPVG 234
             ++ IF+V ++ +N+    R Y E EF   S K+L ++GF I  + ++CG   T G +G
Sbjct: 235 DVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGTDGYIG 294

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
            RYW +PG    G  A +    +F G V++L+ AAF++  +E + +TA E +NPR+++P 
Sbjct: 295 GRYWHDPGAF-RGERAVD----RFKGVVATLVTAAFSFGQSEFIAVTASEQSNPRRAIPS 349

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPHIF 353
           A KK+++R L  Y+ S+  +G LVPYN  +L    S  + ASP+++++ N G  ++PH  
Sbjct: 350 AAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKASPYVLAVANHGVRVVPHFI 409

Query: 354 NAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAY 413
           NAVI+ +++S +NS  Y   R++  LS+   AP+I S  ++ G P + +I   LF  +A+
Sbjct: 410 NAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGIIVASLFAVIAF 469

Query: 414 METSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGL 473
             TS   +  F WLL ++G++  F+W+ I +SH+RF +A+  +G S  +  F ++     
Sbjct: 470 CATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGECGFLSQVGIYG 529

Query: 474 AYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLI 528
           + Y+ F + LI++ Q + +  P      D   F   Y++  ++IA++I ++ + +  RL 
Sbjct: 530 SAYSFFVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALYIGYKCYTKDWRLY 589

Query: 529 WKIEDVDIDTDRRDIEE 545
            K +D+D+   R+  +E
Sbjct: 590 IKSQDIDLVAHRQIYDE 606

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  255 bits (652), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 154/518 (29%), Positives = 270/518 (52%), Gaps = 18/518 (3%)

Query: 58  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGE 117
           ++ R LK RH                     L+  GP   LIAY+ +   V+S+   + E
Sbjct: 54  KIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTE 113

Query: 118 MATFIPVTSSFTVFS--QRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           M   IP+    +++S  + +L+       G+  +++ A+    E++    ++Q+WT A  
Sbjct: 114 MVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWTDANS 173

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP--V 233
            + +ISIF V+ + + M PV+ +GE EFWV+SIK+L I+G +I  + +  G G      +
Sbjct: 174 AI-FISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVL 232

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGT-ELVGITAGEAANPRKSV 292
           GF YW+NPG   P +   N    +FL   +++I + F++    E V   + E   PR+++
Sbjct: 233 GFHYWKNPGAFNPHLAEGN--TGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRNM 290

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL----TSDDSYVAASPFIISIQNSGTPI 348
           P+A ++ ++R+  FYI     +G++V +N+ +L     S  S  AASPF+I IQ +G  I
Sbjct: 291 PKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIKI 350

Query: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLF 408
           LPHI NA IL++  S     +Y  SR ++ ++    AP+I ++ N+ G P+ S     LF
Sbjct: 351 LPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASLF 410

Query: 409 GALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAK 468
             LAY+  S      FNWL NI  ++GF SW+F+S++++RF + +    ++ D +PF+  
Sbjct: 411 SFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLN-DRVPFRRP 469

Query: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYISCFLFIAIWIVFQLWFRCRL 527
           F   LAY    F  ++ +  G+  F   +++  DF A+Y++    I +++V   +++   
Sbjct: 470 FQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSFYYKQWT 529

Query: 528 IWKIEDVDID----TDRRDIEEVVWEDPPPVTFWDKFW 561
               ++++++     D  D EE     P P  F +K W
Sbjct: 530 FRDFKEIEVEILPKIDIADEEERNDVIPVPRNFMEKVW 567

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  255 bits (652), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 153/509 (30%), Positives = 262/509 (51%), Gaps = 22/509 (4%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           E ++ + ++ RH                     L+ +GP+G +I Y+    +V+ + Q+ 
Sbjct: 81  ENDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQAA 140

Query: 116 GEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GE+   +  V  +FT +    + P+FG A  ++Y   W I   L+L      IQFW   V
Sbjct: 141 GELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQFWNVGV 200

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVG 234
            +  ++   +V++V +N+   R Y E EF+    K++ + GF+I  + +  G    GP G
Sbjct: 201 NLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGIPNGPDG 260

Query: 235 F---RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291
           +   +YWRNPG    G          F G  S    AAF+Y G E + ++A E  NP KS
Sbjct: 261 YIGGKYWRNPGLFANG----------FKGVCSVFCYAAFSYGGVETLVLSAAEQKNPLKS 310

Query: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL-TSDDSYVAASPFIISIQNSGTPILP 350
           +P A KKV++RILF Y+ SL  +  LVPY  P L  S  S   +SPF+I+I + G  ++P
Sbjct: 311 IPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFVIAIASHGVSVVP 370

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           H+ NAVIL +++S ANS +YV  R++  L++   AP+ L+  +K G P    +   LFG 
Sbjct: 371 HLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLVVVLFGM 430

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFM 470
           + ++  S   E  F WLL+I+G+   F W+ I +SH+RF  A+  +G    ++ +KA+  
Sbjct: 431 IGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIAYKAQTG 490

Query: 471 PGLAYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
              +Y AI     +++ Q + +  P       D  +F   Y++  + +  ++ F+++++ 
Sbjct: 491 YWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLGFKVYYKQ 550

Query: 526 -RLIWKIEDVDIDTDRRD-IEEVVWEDPP 552
            +L+   + +++D +R   + E   ED P
Sbjct: 551 WQLLIPADKIELDNNRNVYVPEEALEDKP 579

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  253 bits (645), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 152/460 (33%), Positives = 243/460 (52%), Gaps = 17/460 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
              +K+ LK+RH                     L   GPVG LIAYLF+G +V     ++
Sbjct: 45  RTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAI 104

Query: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFAL----ELSVVGQIIQFWT 171
            E+A+F+P T +    +++F+  S G      + F W  T++     ELS    I+++WT
Sbjct: 105 AEVASFMPATGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSATAVIMKYWT 158

Query: 172 SAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTG 231
              P V +I++F VL VA N++ +RFYGE E+    +K++ I   +I  L +  G GV G
Sbjct: 159 DVSPAV-FITVFGVLFVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLG-GVKG 216

Query: 232 P--VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPR 289
              +GF YWR+PGP    ++A ++   KF+G+ +++ +  ++Y G + + I AGE  N R
Sbjct: 217 QERLGFHYWRDPGPFANYLVAGHI--GKFVGFWAAISSVVYSYSGIQNIAILAGETKNSR 274

Query: 290 KSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPIL 349
            ++    K V  RI+  Y+ ++F + L+VPYND  + +      +SPF+I++  +G  +L
Sbjct: 275 YAIFHGAKNVFLRIIVLYLVTVFVLTLIVPYNDKLIATGTGTAKSSPFVIAMNRAGIKVL 334

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           PHI NA+IL++  SA N  +  GSR +F L+    AP+I  +T+K G+P+V VIF   F 
Sbjct: 335 PHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSFL 394

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            LAYM  S      F W   +        W+ IS +H+   +AL+ +G SR DLP   + 
Sbjct: 395 PLAYMSCSESSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTRI 454

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPS-FDGIDFLAAYIS 508
            P  A+++     + +   GF +F    FD   FL   +S
Sbjct: 455 APFAAWFSGIMSVIFLFTGGFYNFMHGHFDIESFLLDTLS 494

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  256 bits (655), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 156/496 (31%), Positives = 269/496 (54%), Gaps = 16/496 (3%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
           +  E+K+ +K RH                     L  AGP G L+ +  MGT +Y + Q+
Sbjct: 145 KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQA 204

Query: 115 LGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
           +GEMA  +  +   F  +    + P+FG +  ++Y   W     LEL      I++WT+ 
Sbjct: 205 VGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTK 264

Query: 174 VPIVAWISIFWVLLVAMNMFP-VRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT-G 231
           V    ++ IF+VL++A+N+      Y E EF   S K+L ++GF I  + ++CG     G
Sbjct: 265 VDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDG 324

Query: 232 PVGFRYWRNPGPM-GPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290
            +G +YW  PG   G   I +      F G +++L+NAAF +  +E +G+TA E +NPRK
Sbjct: 325 YIGGKYWHEPGAFRGEHAIDR------FKGVMATLVNAAFAFGMSEFIGVTASEQSNPRK 378

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQNSGTPIL 349
           ++P A KK+++RI+  ++ S+  +G LVPY+ D  L S    V ASP+++++   G  ++
Sbjct: 379 AIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVV 438

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           PH  NAVIL +++S ANS  Y  SR++  L++   AP+I    ++ G P V +    LFG
Sbjct: 439 PHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFG 498

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            +A+  TS   +  F WLL I+G++  F+W+ I +SHVRF +A+  +G S  +L F+++ 
Sbjct: 499 VIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQV 558

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
               + YA   M  I+I Q + +  P      D  +F   Y++  + +A++  ++++ + 
Sbjct: 559 GAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKN 618

Query: 526 RLIW-KIEDVDIDTDR 540
             I+ + +D+D+ + R
Sbjct: 619 WTIFIRAKDIDLVSHR 634

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  254 bits (648), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 157/508 (30%), Positives = 257/508 (50%), Gaps = 20/508 (3%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +  +K+ +K RH                     L  AGP   +I Y  +  + Y V Q+ 
Sbjct: 74  DDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAA 133

Query: 116 GEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GEMA   P +   F  ++  F+S  FG A  +++   W     LEL      I++W   +
Sbjct: 134 GEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKI 193

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPV 233
               ++ I +V L+ ++ F VR YGE EF   S K+L I GF+I  + + CG AGV G +
Sbjct: 194 NADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYI 253

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G +YWR+PG       A +   ++F G    L+ A F+Y G EL  ++  E  NPR+S P
Sbjct: 254 GGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTP 308

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHI 352
            A K+ ++RIL  Y+ ++  IG  VP+N  +L  +  S   ASP+++++   G  ++PHI
Sbjct: 309 AAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHI 368

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            NAVIL ++ S ANS +Y   R++  L++   AP+  +  ++ G P  ++I   +FG +A
Sbjct: 369 INAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIA 428

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           +   S   E  F WL  I G++  F+W  I +SHVRF  A++ +G S ++L + +  + G
Sbjct: 429 FCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYIS--ITG 486

Query: 473 L--AYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWFRC---- 525
           +  + Y  FF  L+ I Q + +   P   G+    A+   +L   +W+ F L +      
Sbjct: 487 IWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRD 546

Query: 526 -RLIWKIEDVDIDTDRR--DIEEVVWED 550
              +  ++ +D+D  RR  D E +  ED
Sbjct: 547 FTFLTDLKKIDLDNHRRLYDPELLRQED 574

>KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {ON}
           similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W Lysine permease; one of three amino acid
           permeases (Alp1p, Can1p, Lyp1p) responsible for uptake
           of cationic amino acids
          Length = 543

 Score =  252 bits (644), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 169/495 (34%), Positives = 264/495 (53%), Gaps = 22/495 (4%)

Query: 52  GQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSV 111
           G +RE  + R L  RH                     L N GP   LI Y  +G +VY +
Sbjct: 33  GHVRE-NLNRSLTPRHINMISIAGVIGTGLYLGTGKALANGGPASLLINYGIIGLVVYLI 91

Query: 112 TQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW- 170
              LGEM+TF+P++ SF  ++++F S S        YWF+ A++ A +L+ +  I+ +W 
Sbjct: 92  MLCLGEMSTFMPISGSFCSYAKKFGSGSLAFTLMCNYWFNDAVSVASDLTALQLILDYWK 151

Query: 171 --TSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228
              S  P  A   IFW  L+ +N+  VR YGE E+W+A +KV+AI+ F I  + +  G  
Sbjct: 152 NPNSHFPYWAASLIFWFALLLLNVVHVRVYGEAEYWLALLKVIAIIMFFIISIIVNAGHN 211

Query: 229 VTGP-VGFRYWR-NPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAA 286
                +GF+ W     P   G          F G+ S  ++++F + GTE + +TAGEA 
Sbjct: 212 SDHAYIGFKNWGVGDAPFVNG----------FKGFASLFVSSSFAFGGTESITLTAGEAV 261

Query: 287 NPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGT 346
           NP ++ P+ IK V +RIL FY+ + FFIG+ VPYN P L+     V  SPF I  Q  G+
Sbjct: 262 NPVRNTPKIIKTVFWRILIFYVFTAFFIGMNVPYNYPNLSEKS--VMTSPFTIVFQMVGS 319

Query: 347 PILPHIFNAVILSTIISAANSNVYVGSRIMFGLS-KSKLAPRILSRTNKNGVPWVSVIFT 405
                  NAVIL+++ISA N  ++ GSR++F +  +    P  +++TN+  VP+V+V+ T
Sbjct: 320 RGAGSFMNAVILTSVISAGNHALFAGSRVLFNIGLEGYFFPSFITKTNRYQVPYVAVLIT 379

Query: 406 GLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPF 465
              G L +  +  G    + WL NI GV+   +WL IS+  +RF + L  +G +  +L F
Sbjct: 380 WAAGGLCFGSSFIGAGTLWTWLQNIVGVSNQLAWLCISVISIRFRRGLARQGKTH-ELQF 438

Query: 466 KAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525
                P   Y+ + F+T II +QG++SF P +   DF + YI   +F+A++  + LW R 
Sbjct: 439 VNWTYPYGPYFLVVFVTFIIFVQGWSSFAP-WSVSDFFSYYIELIVFVALYAFWWLWKRD 497

Query: 526 RLIWKIEDVDIDTDR 540
             + K +++D  TD+
Sbjct: 498 SFV-KSDEMDFVTDK 511

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  254 bits (649), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 148/495 (29%), Positives = 256/495 (51%), Gaps = 24/495 (4%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           E ++ + +K RH                     L+ +GP G +I Y     ++Y V Q+ 
Sbjct: 103 ETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAA 162

Query: 116 GEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GE+   +  +T ++T +    + P+ G A   +Y   W     L+L      I++WT+ V
Sbjct: 163 GELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTTNV 222

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPV 233
               +++   VL++A+NMF  + Y E EF+    K+L + GF+I  + + CG AG    +
Sbjct: 223 NPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYI 282

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G +YW+ PG    G          F G  +    AAF+Y G E++ +TA E ANPRK++P
Sbjct: 283 GVKYWQTPGAFANG----------FKGVAAVFCYAAFSYGGIEVLVLTANEQANPRKAIP 332

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL---TSDDSYVAASPFIISIQNSGTPILP 350
            A +KVV+R+LF Y+ +   +  LVPYN P L    +D S   ASPF+I++ + G  ++P
Sbjct: 333 DACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQVVP 392

Query: 351 HIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGA 410
           HI NA IL ++IS ANS++Y G R++  LS+   AP+  +  ++ G P + V+ +   G 
Sbjct: 393 HIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMGL 452

Query: 411 LAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYR--GI-SRDDLPFKA 467
           +A++      E  F WLL ++G++  F W+ I+ISH+RF  A+  +  G+ +RD + + A
Sbjct: 453 IAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLRARDVVEYTA 512

Query: 468 KFMPGLAYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLW 522
           +     +  A+     I++ Q + +  P       D   F   Y++  + +  ++ +++W
Sbjct: 513 QTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLLGGYLAYKIW 572

Query: 523 FRC-RLIWKIEDVDI 536
            R  RL     ++D+
Sbjct: 573 HRDWRLCIPANEIDL 587

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  253 bits (646), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 155/504 (30%), Positives = 259/504 (51%), Gaps = 14/504 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +  +K+ +K RH                     L   GP   +I Y  +  + Y + Q+ 
Sbjct: 88  DTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQAA 147

Query: 116 GEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GEMA   P +  +F  ++  F+S  FG A  +++   W     LEL     II++WT  V
Sbjct: 148 GEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWTEKV 207

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPV 233
               ++ IF+V L+ ++   V+ YGE EF     K+L I GF+I+ + + CG AG  G +
Sbjct: 208 NADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDGYI 267

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G +YW +PG         N  E +F G    L++  F+Y GTEL  ++  E  NPRKS P
Sbjct: 268 GGKYWHSPGAFA----GTNAAE-RFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKSTP 322

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHI 352
            A K+ ++RIL  Y+ ++  IG  VP+ND +L  +  S   ASP++++    G  ++PHI
Sbjct: 323 IAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHASPYVLAASIHGVRVVPHI 382

Query: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412
            NAVIL  +IS ANS++Y   R++  L++   AP+ ++  ++ G P  +++   +FG +A
Sbjct: 383 INAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVFGVIA 442

Query: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472
           +   S   E  F WL  I G++  F+W  I +SHVRF QA++ +G   +++ + A     
Sbjct: 443 FSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANTGYW 502

Query: 473 LAYYAIFFMTLIIIIQGFTSFCPSFDGI---DFLAAYISCFLFIAIWIVFQLWFR-CRLI 528
            + Y + F  L+ I Q + +  P    I    F  +Y++  ++IA +  + +W +    +
Sbjct: 503 GSVYGVVFNILVFIAQFWVALAPPKSPITAQSFFESYLAFPIWIAFYFGYMIWNKDYTFL 562

Query: 529 WKIEDVDIDTDRR--DIEEVVWED 550
             ++ +D+D  RR  D E +  ED
Sbjct: 563 NPLDKIDLDHHRRIYDPEVLKQED 586

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  252 bits (644), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 151/503 (30%), Positives = 264/503 (52%), Gaps = 22/503 (4%)

Query: 57  AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLG 116
           A++K+ +K RH                     L  AGP G ++ Y+    ++Y + ++ G
Sbjct: 63  AKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAG 122

Query: 117 EMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           E+   +  +T ++T +S   + P+ G +  ++Y   W   F L+L     IIQ+WT   P
Sbjct: 123 ELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTDINP 182

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVG 234
            + +++I + ++V +N+F  + Y E EF+    KVL I+GF+I  + + CG AG +G +G
Sbjct: 183 DI-FVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYIG 241

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 294
            +YW  P P   G          F G       AAF Y G E++ ++A E  NPRKS+  
Sbjct: 242 DKYWHEPRPFMNG----------FKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISS 291

Query: 295 AIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFN 354
           A KKV++RI+  Y+ +   +  LVP + P L S+ S   ASP +I++   G  I+PHI N
Sbjct: 292 ACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS--RASPLVIAVSFHGVKIVPHIIN 349

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           AVIL  ++S  NS++Y   R++  L++   AP+I +  ++ G P  +     +FG LA++
Sbjct: 350 AVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFL 409

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
             S   +  F WLL I+G++  F W+ I ISH+RF  A++ +G S  ++ +KA+     +
Sbjct: 410 AASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGS 469

Query: 475 YYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIW 529
           + A+    LI+I Q + +  P      D   F  +Y++  + +  +  ++++ +  R+  
Sbjct: 470 WIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKDWRICI 529

Query: 530 KIEDVDIDTDRR--DIEEVVWED 550
              +VD+ + R+  D +E+  ED
Sbjct: 530 PASEVDLISHRQVFDEDELKQED 552

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  251 bits (642), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 157/513 (30%), Positives = 269/513 (52%), Gaps = 19/513 (3%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
           A  Q ++  +++ ++ RH                     +  AG  G LI Y  +G ++ 
Sbjct: 32  AGVQGKKEVLRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIGYGIIGVMLV 91

Query: 110 SVTQSLGEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQ 168
              QS+GE+    P ++  F  + +RF+ PS G +  +++   W I   LEL      I+
Sbjct: 92  CCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLELVTGSMTIK 151

Query: 169 FWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA- 227
           +W +++    ++S+F+ L+  +N F    Y E EF   S+KV+ I+GF+I  + +  G  
Sbjct: 152 YWNASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVIIGFIILGVLIDTGCV 211

Query: 228 GVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAA- 286
           G +G +GFRY      + PG+  KN N  K      +L+NAAF+  G E + ++A E   
Sbjct: 212 GTSGTIGFRYL-----IDPGMFNKNYNIIK--ATAGTLVNAAFSCGGVEFLALSAAEQNR 264

Query: 287 -NPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNS 344
            N  KS+ RA  +V  RI  FY+ S+  +GLLVP+N P L  S  + + +SP++ ++  +
Sbjct: 265 DNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHSSPYVAAVAMN 324

Query: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404
           G  ++PHI NAVIL  +IS ANS +Y  SR +  L++   AP+  ++ NK+G P   +  
Sbjct: 325 GITVVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMRCLFI 384

Query: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464
           + LFG ++++      EA F WLL+I+G++  F+W  I I+H+RF  A++ RG S + L 
Sbjct: 385 SALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSLETLG 444

Query: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP-SFDGIDFLAAYISCFLFIAIWIVFQLWF 523
           +K+      +Y A     +I+++Q + S  P   +G   +  +   ++ + + ++F +  
Sbjct: 445 YKSITGVAGSYIATVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLFYIGH 504

Query: 524 RC-----RLIWKIEDVDIDTDRRDIEEVVWEDP 551
           +       L+ +  +VDI TD RDI     EDP
Sbjct: 505 KVYTKNWSLLIRASNVDITTD-RDIYCPTIEDP 536

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  251 bits (642), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 151/495 (30%), Positives = 253/495 (51%), Gaps = 18/495 (3%)

Query: 57  AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLG 116
           A +++ +K RH                     +  AG  G LI YL +G +V    QS+G
Sbjct: 23  ASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCMQSVG 82

Query: 117 EMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175
           E+    P +   F  + ++F+ PS G    +++   W +   LEL      I++W S + 
Sbjct: 83  ELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKYWNSNLS 142

Query: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA-GVTGPVG 234
              ++S F++L+  +N F    Y E EF    +KV+ +  F++  + ++ G  G +GP+G
Sbjct: 143 PSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNSGPIG 202

Query: 235 FRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAA--NPRKSV 292
           F+Y + PG       A N N   F     +L+NAAF+  G E + ++A E    N  KS+
Sbjct: 203 FQYLKTPG-------AFNTNYNVFKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSI 255

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPH 351
            RA ++V  R+  FY+ S+  +GLLVPY+ P L  S       SP++ +I   G  I+PH
Sbjct: 256 RRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIALHGVRIVPH 315

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
           I NAVIL  ++S ANS +Y  SR +  L++   APR  +  NK+G P   ++ + + G +
Sbjct: 316 IINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVGLI 375

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           +++      EA F WLL+I+G++  F+W  I I+H+RF  AL+ +G S D L +++    
Sbjct: 376 SFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNTGV 435

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFRCR 526
             +Y A     ++II+Q + S  P       D + F   Y++  + + +++  +L+    
Sbjct: 436 IGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLYTNDW 495

Query: 527 LIW-KIEDVDIDTDR 540
             W +   VDI+TDR
Sbjct: 496 TPWIRTHCVDINTDR 510

>Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C
           (ALP1) - Basic amino acid permease [contig 55] FULL
          Length = 544

 Score =  251 bits (640), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 178/533 (33%), Positives = 280/533 (52%), Gaps = 32/533 (6%)

Query: 18  SYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQ----IREAEVKRELKQRHXXXXXX 73
           SY  +D      ++S+H               + GQ    +RE  + R L  RH      
Sbjct: 2   SYNKND------SSSIHVLKVARTSSSDVQYDSEGQEADHVRE-HLNRSLTPRHINMISI 54

Query: 74  XXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQ 133
                          L   GP   +I Y  +G +VY     LGEM+TF+P++ SF  +++
Sbjct: 55  AGVIGTGLYLGTGKALAKGGPASLVINYSIIGLVVYLTMLCLGEMSTFMPISGSFCSYAK 114

Query: 134 RFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA---VPIVAWISIFWVLLVAM 190
           +F S S        YWF+ A++ A +L+ +  I+ FW ++    P  A   IFW +L+ +
Sbjct: 115 KFGSGSLAFTLMCNYWFNDAVSVASDLTALQLILDFWKTSDAHFPYWAASLIFWFVLLLL 174

Query: 191 NMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP-VGFRYWR-NPGPMGPGI 248
           N+  VR YGE E+W+A +KV+AI+ F I  + +  G       +GF+ W     P   G 
Sbjct: 175 NVVHVRVYGEAEYWLAMLKVIAIIIFFIISIVVNAGHNQDHSYIGFKNWSVGEAPFVNG- 233

Query: 249 IAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYI 308
                    F G+ S  ++++F Y GTE + +TAGEA NP ++ P+ IK V +RIL FY+
Sbjct: 234 ---------FKGFASLFVSSSFAYGGTESITLTAGEAKNPIRNTPKIIKTVFWRILIFYV 284

Query: 309 GSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSN 368
            + FFIG+ VPYN PKL+     V  SPF I  Q  GT       NAVIL+++ISA N  
Sbjct: 285 FTTFFIGMNVPYNYPKLSEKS--VMTSPFTIVFQMVGTKAAASFMNAVILTSVISAGNHA 342

Query: 369 VYVGSRIMFGLS-KSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWL 427
           ++ GSR++F L  +    P I+++TN+  +P+V+V+ T   G L +  +  G    + WL
Sbjct: 343 LFAGSRVLFNLGLEGYFFPSIITKTNRYQIPYVAVLITWAAGGLCFGSSFVGAGTLWTWL 402

Query: 428 LNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIII 487
            NI GV+   +WL ISI  +RF + L  +G +  +L F     P   Y+ + F++ II++
Sbjct: 403 QNIVGVSNQIAWLCISIVSIRFRRGLAKQGKTH-ELQFSNWTYPYGPYFLVLFVSFIILV 461

Query: 488 QGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDR 540
           QG++SF P ++  DF + YI   +F+A+++ + LW R   + + ED+D  TD+
Sbjct: 462 QGWSSFAP-WNVTDFFSYYIELIVFVALYVFWWLWKRDAFV-RSEDMDFVTDK 512

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  252 bits (644), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 146/498 (29%), Positives = 263/498 (52%), Gaps = 21/498 (4%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
              ++K+ +K  H                     +++AG  G L+ Y  +G+++    QS
Sbjct: 66  ENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCCMQS 125

Query: 115 LGEMATFIP-VTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
           +GE+    P +   F  + +RF+ PSFG    +++   W I   LEL      I++W ++
Sbjct: 126 VGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYWNNS 185

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA-GVTGP 232
           +    +++IF+ L++ ++ F  R Y + EF     KVL I GF+I  + +  GA G +G 
Sbjct: 186 LNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGTSGY 245

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAA--NPRK 290
           +G +Y + PG               F    S+L+NA F+  G E + ++A E A  N  K
Sbjct: 246 IGIKYLKTPGAFN--------TRNTFKSICSTLVNACFSCGGVEFLALSAAEQARGNISK 297

Query: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPIL 349
           S+ RA  +V+ R+  FYI S+F IGLLVPYN P+L  S    + +SP++I++ + G  ++
Sbjct: 298 SIKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVKVV 357

Query: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409
           PH+ NAVIL  ++S ANS +Y  SR +  L++   AP   ++ +  G P+  ++ +G+FG
Sbjct: 358 PHLINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFG 417

Query: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469
            L+++      E+ F WLL+I+G++  F+W  I ++H+RF  A++ +  S ++L  +A  
Sbjct: 418 LLSFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRAWS 477

Query: 470 MPGLAYYAIFFMTLIIIIQGFTSFCPSFDG------IDFLAAYISCFLFIAIWIVFQLWF 523
               +YY I   +L +++Q + S  P  DG      ++F   Y++    + +++  +++ 
Sbjct: 478 GIYGSYYVIAINSLTLVVQFWVSLFP-LDGDGRPDFVNFFQNYMAVPFALCLYVGHKIYT 536

Query: 524 RC-RLIWKIEDVDIDTDR 540
           R  + I   + +D+DT R
Sbjct: 537 RSWQFIIPADKIDVDTSR 554

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  252 bits (643), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 148/494 (29%), Positives = 262/494 (53%), Gaps = 13/494 (2%)

Query: 55  REAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQS 114
            +A +++ ++ RH                     L  AGP G +I Y  MGT +Y + Q+
Sbjct: 123 EDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182

Query: 115 LGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173
            GEMA ++  +  +F  +    +   FG A  ++Y   W     LEL      I +WT+ 
Sbjct: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242

Query: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGAGVTGP 232
           V    ++ IF+VL++ +N+F  + Y E +F+  + KVL I GF I  + +   GAG +G 
Sbjct: 243 VNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGY 302

Query: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292
           +G +YW +PG         + +  +F   +++   AAF +  +E + I A E +NPR+++
Sbjct: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAI 357

Query: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPILPH 351
           P A K +++RILF ++ S+  +G LVPY+  +L    S    ASP++++I + G  ++PH
Sbjct: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
             NAVIL  ++S +NS  Y   RI+F LS+   AP+  +  ++ G P  ++I + LFG +
Sbjct: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           A+   S+  E  F WLL I+G++  F+W+ I +SH+RF +A+  +G S  +L F+++   
Sbjct: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
             + YA   + L +I + + S  P      D   F   Y++  + I  +  ++++ R  +
Sbjct: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597

Query: 527 LIWKIEDVDIDTDR 540
           L  + +++D+ T R
Sbjct: 598 LFIRAKNIDLITHR 611

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  250 bits (639), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 163/515 (31%), Positives = 268/515 (52%), Gaps = 27/515 (5%)

Query: 50  ANGQIREAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVY 109
           ANG    + +KR LK RH                     L N GP+  ++ +   G+ + 
Sbjct: 67  ANGSFHTSNLKRSLKSRHLIMIAIGGSIGTGLFIGSGQALANGGPLALVLGWSIAGSQIV 126

Query: 110 SVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQF 169
                LGE+    PV  +F  +  RFL PS       +Y   W     LE+      +Q+
Sbjct: 127 GTIHGLGEITVRFPVVGAFANYQTRFLDPSLSFVISTIYVLQWFFVLPLEILSSAITVQY 186

Query: 170 WTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGV 229
           W   +  V +++IF+  +V++N+F VR +GE EF  ++IKV+ + GF+I C+ ++CG G 
Sbjct: 187 WNDTIDPVVFVAIFYCAIVSINLFGVRGFGEAEFVFSTIKVITVTGFIILCIILICGGGP 246

Query: 230 TGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANP 288
           T   +G +YW +PG +  G          F G++S LI A+++  GTE+  + +GE  +P
Sbjct: 247 THEFIGAKYWHDPGCLANG----------FRGFLSVLITASYSLGGTEMTCLASGE-TDP 295

Query: 289 RKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPI 348
            K +P AIK+V +RILFF++ SL  +G LVPY +  L    S V  SPF+I+I+     +
Sbjct: 296 -KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKLHNIKV 353

Query: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLF 408
           LP I NAVIL +I+S  NS ++  SR +  ++   L P      ++ G P   ++   LF
Sbjct: 354 LPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLTGIVINSLF 413

Query: 409 GALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAK 468
           G LA++  S+     F+WL+ I G+A    WL I+I H+RF  A++ +  + D+L F + 
Sbjct: 414 GLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINICHIRFRLAMKAQNKTIDELEFVSA 473

Query: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGID-------FLAAYISCFLFIAIWIVFQL 521
                + Y+    +LI+I+Q + S  P     D       F   Y+   + +  +I  +L
Sbjct: 474 VGVWGSVYSAIINSLILIVQFYVSLWPIGGWTDSKDRAGKFFQNYLCAIVSLIFFICHKL 533

Query: 522 WFRCRLI--WKI---EDVDIDTDRRDIE-EVVWED 550
           +FR +    W+I   +D+D+DT R++I+ ++V E+
Sbjct: 534 YFRYKTKKWWEIIPLKDIDLDTGRKNIDIDIVKEE 568

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  250 bits (639), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 155/553 (28%), Positives = 270/553 (48%), Gaps = 32/553 (5%)

Query: 2   DKKQEEPLKNGKIKSSSYELDDYPLHRRTNSVHXXXXXXXXXXXXXXXANGQIREAE--- 58
           +K+ EEP + G    S  + D  P  R                      N ++   E   
Sbjct: 38  EKQNEEPEQQG----SPQKTDRKPKLRN----EFRKFFDSFKRQLPSDQNSELESQEKNN 89

Query: 59  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118
           +++ +K RH                     L  AGP G ++ Y     ++Y + Q+ GE+
Sbjct: 90  LRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGEL 149

Query: 119 A-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV 177
              +  +T ++T +S   + PS G A   +Y   W     L+L      +++WT+ V   
Sbjct: 150 GLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTN-VNAD 208

Query: 178 AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVGFR 236
            ++++ ++ ++ +N+F  R Y E EF     K+L + GF+I  + + CG AG    +G  
Sbjct: 209 IFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRRYIGTE 268

Query: 237 YWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 296
           YW NPGP   G          F G  +    AAF+Y G E++ ++A E  NP +S+P A 
Sbjct: 269 YWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTESIPNAC 318

Query: 297 KKVVFRILFFYIGSLFFIGLLVPYNDPKL--TSDDSYVAASPFIISIQNSGTPILPHIFN 354
           KKVV+RIL  Y+ +   IG LVPYN  +L  +   S   ASPF+I++ + G  ++PH  N
Sbjct: 319 KKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHGVKVVPHFIN 378

Query: 355 AVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYM 414
           AVIL ++IS ANS++Y G R++  L++  + P+ L+  ++NG P +  + +  FG + ++
Sbjct: 379 AVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAFGCIGFV 438

Query: 415 ETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLA 474
            TS   E  F WLL I+ ++  F W+ + +SH+RF  A+  +G S D++ +KA+     +
Sbjct: 439 ATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGS 498

Query: 475 YYAIFFMTLIIIIQGFTSFCP-----SFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIW 529
           + A+      ++ Q + +  P       D   F   Y++  + +  +   +++F+    W
Sbjct: 499 WIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHKMYFKSWRFW 558

Query: 530 -KIEDVDIDTDRR 541
              E +D+D+ R 
Sbjct: 559 IPAEKIDLDSHRN 571

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  250 bits (639), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 145/494 (29%), Positives = 260/494 (52%), Gaps = 14/494 (2%)

Query: 56  EAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIAYLFMGTLVYSVTQSL 115
           +A +++ ++ RH                     L+ AGP   +I Y  MG+ +Y + Q+ 
Sbjct: 116 DAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQAC 175

Query: 116 GEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174
           GEMA  +  +  +F  +    +         ++Y   W     LEL      I +WT+ V
Sbjct: 176 GEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKV 235

Query: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCM-VCGAGVTGPV 233
               ++ IF+VL+  +N F  + Y E EF+  S KVL + GF I  + +   GAG  G +
Sbjct: 236 NSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYI 295

Query: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293
           G +YW NPG        K+++  +F   +S+   AAF +  +E + I A E +NPR+++P
Sbjct: 296 GAKYWHNPGAFRGD---KSID--RFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIP 350

Query: 294 RAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL--TSDDSYVAASPFIISIQNSGTPILPH 351
            A K +++RILF ++ S+  +G LVPY+  +L  +   +   ASP++I++ + G  ++PH
Sbjct: 351 SAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPH 410

Query: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411
             NAVIL +++S ANS  Y   RI++ L++   AP+     ++ G P  +++ T +FG +
Sbjct: 411 FINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVI 470

Query: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471
           A+   S   E  F WLL+I G++  F+W  I +SH+RF +A++ +G S D++ FK++   
Sbjct: 471 AFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGV 530

Query: 472 GLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526
             + YA   M L +I + + S  P      D  +F   Y++  + I ++  ++++ +  +
Sbjct: 531 WGSGYAAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWK 590

Query: 527 LIWKIEDVDIDTDR 540
           L  + +D+D+ + R
Sbjct: 591 LFIRAKDIDLISHR 604

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.141    0.452 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,318,996
Number of extensions: 2168426
Number of successful extensions: 8064
Number of sequences better than 10.0: 388
Number of HSP's gapped: 6713
Number of HSP's successfully gapped: 406
Length of query: 565
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 450
Effective length of database: 40,294,809
Effective search space: 18132664050
Effective search space used: 18132664050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)