Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A001901.10ON1711718611e-119
ZYRO0F18370g1.10ON2201594182e-51
TDEL0C069301.10ON1841603622e-43
NCAS0B090601.10ON1671573585e-43
KNAG0C002701.10ON1741583385e-40
SAKL0C00572g1.10ON3381573253e-36
KAFR0D001901.10ON1851672892e-32
TPHA0E039601.10ON1771572612e-28
KLTH0F00572g1.10ON1951572466e-26
Kwal_33.130231.10ON1931552404e-25
KLLA0C00594g1.10ON1941622311e-23
TBLA0A049701.10ON181541682e-14
Kpol_2002.131.10ON1641571462e-11
Ecym_10121.10ON1771401411e-10
TDEL0B059101.415ON51662672.4
Kpol_1062.15.63ON806171672.8
NOTE: 4 genes in the same pillar as NDAI0A00190 were not hit in these BLAST results
LIST: Skud_3.8 Smik_3.19 YCL056C Suva_3.157

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A00190
         (171 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...   336   e-119
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...   165   2e-51
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....   144   2e-43
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....   142   5e-43
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...   134   5e-40
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...   129   3e-36
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...   115   2e-32
TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...   105   2e-28
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...    99   6e-26
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...    97   4e-25
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...    94   1e-23
TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...    69   2e-14
Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON...    61   2e-11
Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON} si...    59   1e-10
TDEL0B05910 Chr2 complement(1045851..1047401) [1551 bp, 516 aa] ...    30   2.4  
Kpol_1062.1 s1062 complement(1522..3942) [2421 bp, 806 aa] {ON} ...    30   2.8  

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
           Anc_1.10 YCL056C
          Length = 171

 Score =  336 bits (861), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 171/171 (100%), Positives = 171/171 (100%)

Query: 1   MRRTMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTT 60
           MRRTMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTT
Sbjct: 1   MRRTMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTT 60

Query: 61  RKLVHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLEL 120
           RKLVHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLEL
Sbjct: 61  RKLVHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLEL 120

Query: 121 FQTLVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMFSAKSNGEVLAI 171
           FQTLVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMFSAKSNGEVLAI
Sbjct: 121 FQTLVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMFSAKSNGEVLAI 171

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score =  165 bits (418), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 115/159 (72%), Gaps = 1/159 (0%)

Query: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKL 63
           T ED++I GLE IC +FDNVYLLK+LGIISE+NLLYR LNKG +GSK+WFVTL+L+ RK 
Sbjct: 56  TFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKS 115

Query: 64  VHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQT 123
             +L++ +KA+ +L KE     R   +E+LV  VL  K    +KKCS +I D++LEL QT
Sbjct: 116 FSRLLKIMKAKSKL-KEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQT 174

Query: 124 LVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMFSA 162
           L YL +V I +FK+  S K++ +LE LS+ + +IR+F+ 
Sbjct: 175 LAYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIRIFTT 213

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score =  144 bits (362), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 109/160 (68%), Gaps = 2/160 (1%)

Query: 2   RRTMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTR 61
           + + ED++I GLE +C+ FDNVY  KSLGII ENN LYR LNKG +GSK+WFVTL+L+ R
Sbjct: 19  KTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVR 78

Query: 62  KLVHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELF 121
           K + Q+ + V+ RIRL  E K   +    + L++ VL EK+ + ++K ++M+ + LL+L 
Sbjct: 79  KCLRQIFQIVRNRIRLKTEIKGMDK--NGKGLMNDVLKEKILLMLQKSNAMMRETLLDLL 136

Query: 122 QTLVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMFS 161
           Q  VYL +V I++FKL    +   +LE LSN + ++R F+
Sbjct: 137 QNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFT 176

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score =  142 bits (358), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 120/157 (76%), Gaps = 1/157 (0%)

Query: 5   MEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKLV 64
           +ED+++  LE ICNIFDNVY  KS+G++SE N+LYR LNKG+FGSK+WF+TL+L+++KL+
Sbjct: 4   LEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSKKLI 63

Query: 65  HQLIRAVKARIRLVKE-RKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQT 123
            +L +++K R ++ KE  ++ K    +++LV+S+L EKL++ + KC  +I + +LEL QT
Sbjct: 64  TRLTKSLKIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELLQT 123

Query: 124 LVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMF 160
           ++YL +  IN+FK+K   K  ++LE LSN++ +IR+F
Sbjct: 124 MMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVF 160

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score =  134 bits (338), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 110/158 (69%), Gaps = 2/158 (1%)

Query: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKL 63
           + ED ++G LE IC+IFDN+YLLKSLGIIS+ N LYR LNKGN GSK+WF+TLIL+ RK 
Sbjct: 8   SWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKN 67

Query: 64  VHQLIRAVKARIRLVKERKNSKRITR-NENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQ 122
           + +L+R V+ R +LV E +   R  + +++LV++V+  KL   ++KC  MI+D  L+L Q
Sbjct: 68  LKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFLDLAQ 127

Query: 123 TLVYLFLVSINIFKLKFS-DKMVYVLEHLSNLLVLIRM 159
            L+YLF+VS + F +     K    L  +SN++ ++RM
Sbjct: 128 LLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRM 165

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score =  129 bits (325), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 101/157 (64%), Gaps = 2/157 (1%)

Query: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKL 63
           + ED +IGGLE + N+FD+VYLLK+ GII E N +YR+LNKG  GSK+W  TL+L+ RK 
Sbjct: 175 SFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKS 234

Query: 64  VHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQT 123
           + QL R  +AR  L KER+++    +     + ++ +K    I +    I D+LL++ Q 
Sbjct: 235 LGQLFRLARARHMLQKERRSTPH--KCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQN 292

Query: 124 LVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMF 160
           L YL +V++++FKLK   +   +LE +S+L+ + R F
Sbjct: 293 LAYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFF 329

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score =  115 bits (289), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 109/167 (65%), Gaps = 6/167 (3%)

Query: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKL 63
           T+ED +I  LE IC +FDN+Y LK+LG+I E+N +Y+ LNKGN GSKIW V+LIL+ R+ 
Sbjct: 18  TLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRC 77

Query: 64  VHQLIRAVKARIRLVKERK--NSKRITRNEN-LVSSVLHEKLDIGIKKCSSMIMDLLLEL 120
              L    + R + V E    + KR   +EN LV+ +L +KL   ++KC+S+I DLLLE 
Sbjct: 78  FKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDLLLEF 137

Query: 121 FQTLVYLFLVSINIFKLKFSDKMVYV---LEHLSNLLVLIRMFSAKS 164
            Q L+YL +V I +FK+K  ++ V     LE LSNL+ + R+ +A S
Sbjct: 138 LQVLLYLIIVIIEVFKVKSLERYVKGIRNLEILSNLITVTRIITATS 184

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
           YCL056C
          Length = 177

 Score =  105 bits (261), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 96/157 (61%), Gaps = 3/157 (1%)

Query: 5   MEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKLV 64
            E +++  LE I NIFD V+ L+S G+I ENN  YRNLN+ N GSKIWFVTLIL+ RKL 
Sbjct: 17  FESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWFVTLILSIRKLY 76

Query: 65  HQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQTL 124
             ++++ K    L  E     +I +N +L S ++ +K+          I + ++EL Q  
Sbjct: 77  KNILKSTKLLSLLKTEL---TKIEKNNDLTSDIILQKIQNNNTILKKKIKNFIIELIQDF 133

Query: 125 VYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMFS 161
           +YL +VS+ IFK+  S K+ + LE LSN + +++ F+
Sbjct: 134 IYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFFT 170

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
           conserved hypothetical protein
          Length = 195

 Score = 99.4 bits (246), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 93/157 (59%), Gaps = 2/157 (1%)

Query: 3   RTMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRK 62
           + +E +++ GLE I  IFD++ LL+S G+I ENN+ Y+ LNK  F SK W V+L L++R+
Sbjct: 31  KNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLSSRR 90

Query: 63  LVHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQ 122
               +I    +R RL +E+    R  R  N V  VL+ K+   I++ +  ++ + LEL Q
Sbjct: 91  NASDIINLAISRSRLKREQAEFMR--RPVNPVRKVLNAKVTARIQEINQKLILVALELIQ 148

Query: 123 TLVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRM 159
            + YL LV+ ++     ++K   +LE +S++  + R+
Sbjct: 149 NIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARL 185

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
           [contig 123] FULL
          Length = 193

 Score = 97.1 bits (240), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 94/155 (60%), Gaps = 2/155 (1%)

Query: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKL 63
            +E+  I G+E +  +FD+++LLKS GIISE+N +YR LNK  F SK+W ++L+L+TRK 
Sbjct: 32  AIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTRKC 91

Query: 64  VHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQT 123
           +  L     +R RL KE  +      + N +   L +K+ + IK  +  ++ + LE+ Q 
Sbjct: 92  IRDLNNLWMSRSRLRKEEVHF--TMHSSNSLRRALSDKIALKIKDVNRRLILVALEIMQN 149

Query: 124 LVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIR 158
           + YL +V+ ++F L   ++   +LE  S+LL +++
Sbjct: 150 IAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLK 184

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score = 93.6 bits (231), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 98/162 (60%), Gaps = 8/162 (4%)

Query: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKL 63
           ++ED +I  L  + + FD++YLL+S GIIS+ N LY+ LNKG+ GSK+W V+L+L+ R+ 
Sbjct: 32  SLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWLVSLLLSIRRS 91

Query: 64  VHQLIRAVKARIRLVKERKN--SKRITRNENLV-SSVLHEKLDIGIKKCSSMIMDLLLEL 120
           + +L   ++ +++L KE  N  S      + LV   +L E   + +K     I  L ++L
Sbjct: 92  LTRLYTLIRLKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLK-----IRSLCMDL 146

Query: 121 FQTLVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMFSA 162
            Q L+Y+ +VSI+IFK+  S K    LE +S+   +++  S+
Sbjct: 147 LQDLLYMIIVSIDIFKINLSLKFKRALELISSAATVLKFVSS 188

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa]
          {ON} Anc_1.10 YCL056C
          Length = 181

 Score = 69.3 bits (168), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 41/54 (75%)

Query: 8  SIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTR 61
           I+ GLE IC++FDN+Y L+S+G+IS+ NL YR LN+   GSKIW +TL+L  R
Sbjct: 12 DILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIR 65

>Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON}
           complement(23954..24448) [495 nt, 165 aa]
          Length = 164

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 97/157 (61%), Gaps = 5/157 (3%)

Query: 6   EDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKLVH 65
           ED ++ GLE IC++FD++Y +K+LGII++ + LYR + + NF  K+W  TL+L  +KLV 
Sbjct: 7   EDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNFSLKLWLATLLLIIKKLVV 66

Query: 66  QLIRAVKA----RIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELF 121
           +L +  K     +I L K+  N+       N ++S+L EKL+  I +  + I   LL+L 
Sbjct: 67  KLFQNYKILRFLKIEL-KQHINNNNNNNKNNHINSILLEKLNKKINQHYNFIKLNLLDLI 125

Query: 122 QTLVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIR 158
           Q L+Y  +V I + KLK S K  ++LE L+N + +++
Sbjct: 126 QNLLYCAIVIIELLKLKISKKSKFILELLANSITIVK 162

>Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON}
           similar to XP_452220 - K. lactis - KLLA0C00594g
          Length = 177

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 73/140 (52%), Gaps = 16/140 (11%)

Query: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKG--NFGSKIWFVTLILTTR 61
           T ED +   L      +D +YL +S+GII ++N++Y+ L  G  N GS++ F  L+L  R
Sbjct: 32  TFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLF--LLLVAR 89

Query: 62  KLVHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELF 121
           K   +L+R V    RL    KN         L  + + +K +    +    I+ L ++L 
Sbjct: 90  KTFLKLLRLV----RLWYALKNV--------LPPASIKKKYNETKSRVKRSILRLSVDLL 137

Query: 122 QTLVYLFLVSINIFKLKFSD 141
            TLVYL +V I++FK K SD
Sbjct: 138 DTLVYLIVVLIDLFKFKVSD 157

>TDEL0B05910 Chr2 complement(1045851..1047401) [1551 bp, 516 aa]
           {ON} Anc_1.415 YCL004W
          Length = 516

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 64  VHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQT 123
           +HQLI  +  ++RL    +       N+NL    +H+K+   IK  S+++   LL+  Q 
Sbjct: 222 LHQLISGLSYKVRLATNEQKFSIFWPNQNLAVEPVHDKVKF-IKNASTVLRKFLLKEPQP 280

Query: 124 LV 125
           ++
Sbjct: 281 II 282

>Kpol_1062.1 s1062 complement(1522..3942) [2421 bp, 806 aa] {ON}
           complement(1522..3942) [2421 nt, 807 aa]
          Length = 806

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 76/171 (44%), Gaps = 25/171 (14%)

Query: 7   DSIIGGLEYICNIFDNVYLLKSLGIIS------ENNLLYRNLNKGNFGSKIWFVTLILTT 60
           D++   L+Y   I+D  Y+++  G++       E+ LLY+                +L T
Sbjct: 308 DNVASSLKYDDRIWDTQYVVRKDGLLDVFSTSEESALLYK----------------VLMT 351

Query: 61  RKLVHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLEL 120
            KL++ +I+     +RL  E       +  E + S+ L   +D    + + + +D+ L  
Sbjct: 352 GKLLN-IIKKSYGIVRLPTEELADDVPSFVELMESTNLELYIDKWYNRANQLCLDMYLRD 410

Query: 121 FQTLVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMFSAKSNGEVLAI 171
           +  + +L L+  + F    ++ +   L+   N++ L R +   SN +VL +
Sbjct: 411 YDLIKFLKLLQKHFFSYHNANNLYKFLQ--KNMIELTRHYKGTSNNQVLKL 459

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.142    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,718,585
Number of extensions: 666650
Number of successful extensions: 3116
Number of sequences better than 10.0: 39
Number of HSP's gapped: 3153
Number of HSP's successfully gapped: 39
Length of query: 171
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 69
Effective length of database: 41,785,467
Effective search space: 2883197223
Effective search space used: 2883197223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)