Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A001801.9ON74074034860.0
NCAS0B090701.9ON73068024900.0
Kpol_2002.121.9ON73968323940.0
ZYRO0F18392g1.9ON72568023870.0
KNAG0C002601.9ON74468323820.0
TBLA0A075601.9ON74168123630.0
SAKL0C00550g1.9ON73267923320.0
TPHA0E039701.9ON74769023220.0
KAFR0D001801.9ON72368323130.0
KLLA0C00572g1.9ON71268322100.0
Suva_3.1561.9ON71268221850.0
Skud_3.71.9ON71268021750.0
YCL057W (PRD1)1.9ON71268021690.0
Smik_3.181.9ON71268021570.0
CAGL0B00418g1.9ON74368221190.0
Ecym_1011na 1ON71667320400.0
AGR406C1.9ON68368016890.0
AGR405Cna 1ON71768116870.0
ABR185WsingletonON4574319921e-126
NDAI0E020102.432ON7786414682e-48
Kpol_297.82.432ON7875854471e-45
KNAG0A062002.432ON7895404345e-44
SAKL0E03938g2.432ON7675134328e-44
Suva_11.912.432ON7755114283e-43
Skud_11.932.432ON7724804241e-42
KAFR0D029502.432ON7776264212e-42
YKL134C (OCT1)2.432ON7724804186e-42
CAGL0D02112g2.432ON7615734161e-41
AFR198W2.432ON7764954132e-41
Smik_11.1022.432ON7724794133e-41
Ecym_60992.432ON7735324043e-40
Kwal_26.76162.432ON7705923911e-38
TDEL0A020802.432ON7875143893e-38
TPHA0G023902.432ON7955623884e-38
ZYRO0G20130g2.432ON7865003787e-37
KLTH0D04730g2.432ON7725873724e-36
NCAS0A042802.432ON7735913714e-36
TBLA0I007102.432ON7734723681e-35
KLLA0B12397g2.432ON7795183521e-33
KLTH0D13244g4.203ON311138810.37
Kwal_33.141251.236ON31442733.0
KLTH0F06182g1.236ON32042733.4
Smik_15.613.101ON707121709.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A00180
         (740 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9       1347   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...   963   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....   926   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...   924   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   922   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   914   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   902   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   899   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   895   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   855   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   846   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    842   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   840   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   835   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   820   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   790   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   655   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   654   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   386   e-126
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   184   2e-48
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   176   1e-45
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   171   5e-44
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   171   8e-44
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   169   3e-43
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   167   1e-42
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   166   2e-42
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   165   6e-42
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   164   1e-41
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   163   2e-41
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   163   3e-41
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   160   3e-40
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   155   1e-38
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   154   3e-38
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   154   4e-38
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   150   7e-37
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   147   4e-36
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   147   4e-36
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   146   1e-35
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   140   1e-33
KLTH0D13244g Chr4 (1082204..1083139) [936 bp, 311 aa] {ON} some ...    36   0.37 
Kwal_33.14125 s33 (539186..540130) [945 bp, 314 aa] {ON} YKR046C...    33   3.0  
KLTH0F06182g Chr6 (544018..544980) [963 bp, 320 aa] {ON} similar...    33   3.4  
Smik_15.61 Chr15 complement(102345..104468) [2124 bp, 707 aa] {O...    32   9.8  

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score = 1347 bits (3486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/740 (90%), Positives = 666/740 (90%)

Query: 1   MIWSTGLTKSLFNQISSRKKLXXXXXXXXXXXXXXXXXXQSKRTYSPXXXXXXXXXXXXK 60
           MIWSTGLTKSLFNQISSRKKL                  QSKRTYSP            K
Sbjct: 1   MIWSTGLTKSLFNQISSRKKLIVSSIVVPVVSVSLINIIQSKRTYSPNNIIMTNNTVNNK 60

Query: 61  HGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKM 120
           HGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYY                 YMNYENKM
Sbjct: 61  HGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIESPSIENLIIPYMNYENKM 120

Query: 121 GLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDF 180
           GLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDF
Sbjct: 121 GLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDF 180

Query: 181 LKNHQFETYKFIEKIHKDSLRNGLKSERNYQLKYIKGKISADALTFSSNLGEQNEYVSFT 240
           LKNHQFETYKFIEKIHKDSLRNGLKSERNYQLKYIKGKISADALTFSSNLGEQNEYVSFT
Sbjct: 181 LKNHQFETYKFIEKIHKDSLRNGLKSERNYQLKYIKGKISADALTFSSNLGEQNEYVSFT 240

Query: 241 KEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNK 300
           KEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNK
Sbjct: 241 KEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNK 300

Query: 301 VPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXX 360
           VPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLND           
Sbjct: 301 VPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDLKEKLKPLAEK 360

Query: 361 XXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDG 420
                           GIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDG
Sbjct: 361 EIKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDG 420

Query: 421 MLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKY 480
           MLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKY
Sbjct: 421 MLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKY 480

Query: 481 GHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDL 540
           GHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDL
Sbjct: 481 GHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDL 540

Query: 541 VGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIS 600
           VGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIS
Sbjct: 541 VGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIS 600

Query: 601 TKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGYNS 660
           TKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGYNS
Sbjct: 601 TKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGYNS 660

Query: 661 FGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDN 720
           FGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDN
Sbjct: 661 FGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDN 720

Query: 721 LLEFLGREPSNKPFLKELGL 740
           LLEFLGREPSNKPFLKELGL
Sbjct: 721 LLEFLGREPSNKPFLKELGL 740

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score =  963 bits (2490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/680 (68%), Positives = 546/680 (80%), Gaps = 3/680 (0%)

Query: 63  FIAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMGL 122
            +AP  T P W W+P+ IL +TK  I+     Y                 YM+YEN  GL
Sbjct: 50  LVAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGL 109

Query: 123 LINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLK 182
           ++NQLTFLQHVSADK IRDAS+EAT LL+D  I  S+R ++++QF+K+W  V++DDD LK
Sbjct: 110 IVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDD-LK 168

Query: 183 NHQFETYKFIEKIHKDSLRNGLK--SERNYQLKYIKGKISADALTFSSNLGEQNEYVSFT 240
           +  FETYKFIEK+HKD +RNGL    E+  Q+K IK KI++++L +S NLGEQ EYVSFT
Sbjct: 169 SKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFT 228

Query: 241 KEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNK 300
           KE+L GVSE+VM+QFEKF+DPKTNE+KYKVTFKYPDIFPVLKTA+ PKTRK+A++ DQNK
Sbjct: 229 KEQLKGVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNK 288

Query: 301 VPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXX 360
           VP+NE L    LKLR +LA  LGYSTYANYNLDIKMAKNQETV  F+N+           
Sbjct: 289 VPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQK 348

Query: 361 XXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDG 420
                           G+ YD HYYIWDHRYYDNK+LKDN+NVD+E+ISEYYPLESTI G
Sbjct: 349 EIETLKTLKKKDCEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKG 408

Query: 421 MLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKY 480
           ML IYET+L LKF++ET+P  K+VWH DVKQL+VW MDD  NP F+GWIYFDL+PRDGKY
Sbjct: 409 MLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKY 468

Query: 481 GHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDL 540
            HAANFGI+SSYIT++  RS+PVTALVCNFSK T  KP+LLKH+EITTFFHELGHGIHDL
Sbjct: 469 SHAANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDL 528

Query: 541 VGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIS 600
           VG+NK ARFNGPG+ PWDFVEAPSQMLEFWTWNKNELLSLS HY+TGEKI EDLLDSLI+
Sbjct: 529 VGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIA 588

Query: 601 TKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGYNS 660
           TKHVNGALFALRQLHFGLFDMTVHTTK++E+L+LLKLWNE RE+ICLVENG   TKGY+S
Sbjct: 589 TKHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDS 648

Query: 661 FGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDN 720
           FGHI+SDSYSAGYYGYMWAEVFAADMY+TKFA +PL+   G++YRD++LA GGLYEI D 
Sbjct: 649 FGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADK 708

Query: 721 LLEFLGREPSNKPFLKELGL 740
           L EFLGREP+N  FLKELGL
Sbjct: 709 LKEFLGREPTNDAFLKELGL 728

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/683 (63%), Positives = 538/683 (78%), Gaps = 6/683 (0%)

Query: 63  FIAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMGL 122
            IAP    P W WTP+ I+ + +S I+ +N+ +                 YMN+ENK+  
Sbjct: 57  LIAP-QPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSP 115

Query: 123 LINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLK 182
           LINQLTFLQHVSADK IRD+S++AT L+++ +I  SLR +++ QF+K+W  V+++ +F +
Sbjct: 116 LINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNE 175

Query: 183 ---NHQFETYKFIEKIHKDSLRNGL--KSERNYQLKYIKGKISADALTFSSNLGEQNEYV 237
              +  +E+Y+FIEK HKD +R+GL    E+   +K I+ KI++++L FS NLGEQ E++
Sbjct: 176 KSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFI 235

Query: 238 SFTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGD 297
           +FTKEELDGVS+ VM+QFEKF D KT E+K+KVTFKYPDI PVLK+AKNP TRK+AF  D
Sbjct: 236 AFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNAD 295

Query: 298 QNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXX 357
           QNKVPENE L  + LKLR +L+  L YS YANYNL++KMAKN+ETV  FL+D        
Sbjct: 296 QNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPL 355

Query: 358 XXXXXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLEST 417
                               +PYD HYYIWDHRYYDNKYLKDNFNVD+EKISEYYP+ES+
Sbjct: 356 GLKEIEILKQLKEKDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESS 415

Query: 418 IDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRD 477
           IDGMLKIYETV+ LKF+EETDP  +NVWH DVKQLSVW MD+   P F+GWIYFDL+PRD
Sbjct: 416 IDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRD 475

Query: 478 GKYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGI 537
           GKYGHAANFGI+SSY+ E +KRSYPVTALVCNFSKPT +KP+LLKH+E+TTFFHELGHGI
Sbjct: 476 GKYGHAANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGI 535

Query: 538 HDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDS 597
           HDLVG N+ +R NGPGSVPWDFVEAPSQMLEFWTWNKNEL+SLSKHYKTGEKIPE L++S
Sbjct: 536 HDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIES 595

Query: 598 LISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKG 657
           L+STKHVNGALFALRQLHF  FDM VHT +D+  L+LL+LWN  RE+ICLVENG+  +KG
Sbjct: 596 LVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKG 655

Query: 658 YNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEI 717
           Y+SFGHI+S +YSAGYYGYMWAEVFA DMY+TKFA +PL+   G++YRD+IL++GG+YE+
Sbjct: 656 YDSFGHIMSGAYSAGYYGYMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEV 715

Query: 718 NDNLLEFLGREPSNKPFLKELGL 740
           NDNL EFLGREP+N  FLKE+GL
Sbjct: 716 NDNLEEFLGREPNNSAFLKEMGL 738

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/680 (64%), Positives = 537/680 (78%), Gaps = 4/680 (0%)

Query: 63  FIAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMGL 122
           FIAP  + P W +TP+ +LDET   IE + ++Y                 YM++EN +GL
Sbjct: 47  FIAP-QSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGL 105

Query: 123 LINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLK 182
           + +QLTF Q VSADK+IRDAS++AT  L++  I  SLR +++ QF+K+W  +++      
Sbjct: 106 IESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQG 165

Query: 183 NHQFETYKFIEKIHKDSLRNGLK--SERNYQLKYIKGKISADALTFSSNLGEQNEYVSFT 240
           + ++E YK++EKIH+D  R+GL+   ++  ++K +K KI+A++L FS NLGEQ E+V+FT
Sbjct: 166 SQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFT 225

Query: 241 KEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNK 300
           KEELDGVSE+VMDQFE+F D +    KYKVTFKYPDIFPVLKTAKNPKTRK+AF  DQ+K
Sbjct: 226 KEELDGVSESVMDQFEQFKD-ENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDK 284

Query: 301 VPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXX 360
           VP+NEKL    L+LR ELA+ LGYSTYANYNL++KMAKNQ+ V KFLN+           
Sbjct: 285 VPQNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLK 344

Query: 361 XXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDG 420
                           G+PYDGHYY+WDHRYYDNKYLKDN+NVD+EKISEYYP+ESTI G
Sbjct: 345 EAENLKQIKQKECESLGLPYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPIESTISG 404

Query: 421 MLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKY 480
           ML IYET+L LKF+EETDP  ++VWH DVKQL+VW MD+ + P FVGWIYFDL+PRDGKY
Sbjct: 405 MLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKY 464

Query: 481 GHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDL 540
           GHAANFGI++SY+ E+  RSYPVTALVCNFSKP+  KP+LLKH+EI+TFFHELGHGIHDL
Sbjct: 465 GHAANFGISASYVKEDGTRSYPVTALVCNFSKPSAKKPSLLKHNEISTFFHELGHGIHDL 524

Query: 541 VGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIS 600
           VG+N+   FNGPG+VPWDFVEAPSQMLEFWTWN+ EL  LS HY++GEKIP+DLL SLIS
Sbjct: 525 VGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLIS 584

Query: 601 TKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGYNS 660
           TKHV+GALFALRQLHFGLFDM VHT+K++  LDLLKLWNE REE+ LVENG+ FTKGY+S
Sbjct: 585 TKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDS 644

Query: 661 FGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDN 720
           FGHI+SDSYSAGYYGYMWAEVFAADMYHT+FA +PLD   G++YRD++L +GGLYE NDN
Sbjct: 645 FGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDN 704

Query: 721 LLEFLGREPSNKPFLKELGL 740
           L EFLGREPS + FLKELGL
Sbjct: 705 LREFLGREPSEEAFLKELGL 724

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/683 (65%), Positives = 532/683 (77%), Gaps = 6/683 (0%)

Query: 63  FIAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMGL 122
            + PA  +P W +   +I +E    IE TNK+Y                 YMN+EN +GL
Sbjct: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGL 120

Query: 123 LINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQ-NDDDFL 181
           ++NQL FLQHVS+DK+IR+AS +AT LL++ +I TSLR +++ QF+K+W+ ++   ++F 
Sbjct: 121 MVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180

Query: 182 KNH-QFETYKFIEKIHKDSLRNGL---KSERNYQLKYIKGKISADALTFSSNLGEQNEYV 237
            +  QFE YKF+EK HKD +R GL   + +RN ++K IK KI++++L FS NLGEQ E++
Sbjct: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRN-KVKDIKIKIASNSLEFSKNLGEQKEFL 239

Query: 238 SFTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGD 297
            F+KE+LDGVS+TVM+QFE+  D  TNE  YKVTFKYPDIFPVLK AKN +TRK AF GD
Sbjct: 240 LFSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGD 299

Query: 298 QNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXX 357
           QNKVP+NE+L    LKLR ELA  LGY TYANYNL+IKMAK Q TV KFLND        
Sbjct: 300 QNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLKPL 359

Query: 358 XXXXXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLEST 417
                              G+P+DG YYIWDHRYYD KYLKDNFNVD E I+EYYP++ST
Sbjct: 360 GEKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDST 419

Query: 418 IDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRD 477
           I+GMLKIYETV  LKF+EE D   KNVW+ DVKQ++VW MD+   P FVGWIYFDL+PRD
Sbjct: 420 IEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRD 479

Query: 478 GKYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGI 537
           GKYGHAANFGIASSYI E+  RSYPVTALVCNFSK +  KP+LLKH+EITTFFHELGHGI
Sbjct: 480 GKYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGI 539

Query: 538 HDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDS 597
           HDLVG+N+AARFNGPG+ PWDFVEAPSQMLEF+TW+KN L SLSKHYKTGE+IPE LLDS
Sbjct: 540 HDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDS 599

Query: 598 LISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKG 657
           LI+TKHVNGALFALRQLHFGLFDMTVHT+KD+ +LDLLKLW + R+EI LVENG  +TKG
Sbjct: 600 LIATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKG 659

Query: 658 YNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEI 717
           Y+SFGHI+SDSYSAGYYGYMWAEVFA DMY TKFAPNPLD SVG+KYRD++LA GGLYEI
Sbjct: 660 YDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEI 719

Query: 718 NDNLLEFLGREPSNKPFLKELGL 740
           +DNL EFLGREPS   FLKELGL
Sbjct: 720 DDNLKEFLGREPSKDAFLKELGL 742

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/681 (65%), Positives = 537/681 (78%), Gaps = 6/681 (0%)

Query: 65  APANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMGLLI 124
           AP    P W WTP Q++ + +  I+++N +Y                 YMNYENK+G LI
Sbjct: 61  AP-QAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLI 119

Query: 125 NQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLKN- 183
           NQLTFLQHVS++K IRDAS +AT LL++ +I TSLR+ ++ QF+K+W  +++  D  +  
Sbjct: 120 NQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKD 179

Query: 184 -HQFETYKFIEKIHKDSLRNGLKSERNYQLKYIKG--KISADALTFSSNLGEQNEYVSFT 240
               E Y+F+ K+H+D +R GL  + + + K  +    I+ ++L F++NLGEQ E+V+FT
Sbjct: 180 PKDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVAFT 239

Query: 241 KEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNK 300
           KEELDGVS++VM+QFEKF D KT ++ YKVTFKYPDIFPVLKTA+NP+TRK AF GDQNK
Sbjct: 240 KEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNK 299

Query: 301 VPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXX 360
           V EN  L  N LKLR +LA+ LGYSTYANYNL++KMAK Q++V KFL D           
Sbjct: 300 VSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGSK 359

Query: 361 XXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDG 420
                            +P+D HYY+WDHRYYDNKYLKDN+NVD+EKISEYYPL+STI+G
Sbjct: 360 EIEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTIEG 419

Query: 421 MLKIYETVLNLKFIEETDPLA-KNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGK 479
           ML IYET+LNLKFIEE D    KNVWH +VKQL+VW MD+  NP FVGWIYFDL+PRDGK
Sbjct: 420 MLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGK 479

Query: 480 YGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHD 539
           YGHAANFGI+SSYI   N+RSYPVTALVCNFSK T +KPALLKH+EITTFFHELGHGIHD
Sbjct: 480 YGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHD 539

Query: 540 LVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLI 599
           LVG+N  +RFNGPG+VPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIP +LL+SL+
Sbjct: 540 LVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLV 599

Query: 600 STKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGYN 659
           +TKHVNGALFALRQLHFGLFDM VHT+KD+ENLD LKLWNE REE+ LVENG+ FTKGY+
Sbjct: 600 ATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYD 659

Query: 660 SFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEIND 719
           SFGHI+SDSYSAGYYGYMWAEVFA DMY+TKFA NPL+  VG++YRD +LA+GGLYEI D
Sbjct: 660 SFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIED 719

Query: 720 NLLEFLGREPSNKPFLKELGL 740
           NL++FLGR+PSN+ FLKELGL
Sbjct: 720 NLIQFLGRKPSNEAFLKELGL 740

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/679 (64%), Positives = 518/679 (76%), Gaps = 5/679 (0%)

Query: 64  IAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMGLL 123
           + P    P W ++P+ IL  T   I  T+  +                 ++ +EN    L
Sbjct: 56  LVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPL 115

Query: 124 INQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLKN 183
           INQLTFLQHVSADK++RDAS +AT LL+D +I  SLR +++ QF+KVW+  ++D  F K 
Sbjct: 116 INQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKE 175

Query: 184 HQFETYKFIEKIHKDSLRNGLK--SERNYQLKYIKGKISADALTFSSNLGEQNEYVSFTK 241
           H FE YKF+EK HKD +R GL    E+  ++K ++ KIS ++L FS NLGEQ E+V+FT 
Sbjct: 176 H-FELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTT 234

Query: 242 EELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNKV 301
           EELDGVS +VMDQFEKF D    EK +KV+FKYPDI PVLKTAKNP+TRK AF GDQNKV
Sbjct: 235 EELDGVSASVMDQFEKFTDTDGVEK-HKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKV 293

Query: 302 PENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXXX 361
           P+NE L    L+LR ELA  LGYSTYANYNLDIKMAK QETVL FL D            
Sbjct: 294 PQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKE 353

Query: 362 XXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDGM 421
                           IP+D HYYIWD+RYYDNKYLK+N+NVD EKISEY+PLE TI GM
Sbjct: 354 IEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGM 413

Query: 422 LKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYG 481
           LKIYETVL LKF+EETD   K VWH DVKQL+VW +D   +P FVGWIYFDL+PRDGKYG
Sbjct: 414 LKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYG 473

Query: 482 HAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDLV 541
           HAANFGIASSY+  +  RS+PVTALVCNFSKP+  KPALLKHSEITTFFHELGHGIHDLV
Sbjct: 474 HAANFGIASSYV-RDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLV 532

Query: 542 GQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIST 601
           G N   RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL +LS+HY+TGEKIPE LLDSLI+T
Sbjct: 533 GGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIAT 592

Query: 602 KHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGYNSF 661
           KHVNGALFALRQL FGLFDMTVHT KD+E+LD+  LWN+ R+E+ LVENG+  TKG+NSF
Sbjct: 593 KHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSF 652

Query: 662 GHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDNL 721
           GHI+S +YSAGYYGYMWAEVFAADMYHTKFA +PL+  VG++YRD++L++GGLYEI+DNL
Sbjct: 653 GHIMSGAYSAGYYGYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNL 712

Query: 722 LEFLGREPSNKPFLKELGL 740
            EFLGREP+N+ FLKELGL
Sbjct: 713 REFLGREPNNEAFLKELGL 731

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/690 (64%), Positives = 527/690 (76%), Gaps = 12/690 (1%)

Query: 62  GFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMG 121
            FIAP    P W ++P++IL + K  I+ +N +Y                  +N+EN+  
Sbjct: 58  AFIAP-QLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENS 116

Query: 122 LLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQ-----N 176
           L INQLTFLQHVS DK IRDASLEAT L+ + DI  SLR+++++QF+K++  ++     N
Sbjct: 117 LAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYN 176

Query: 177 DDDFLKNHQFETYKFIEKIHKDSLRNGL--KSERNYQLKYIKGKISADALTFSSNLGEQN 234
           D        +E +K++EK HKD +R+GL    E+  ++K IK +I+ ++L FS NLGEQN
Sbjct: 177 DLKTATPKDYEIFKYVEKCHKDYVRSGLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQN 236

Query: 235 EYVSFTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAF 294
           E+V+FTKEEL+GVS+ VM QFE + D +T E+K+KVTFKYPDIFPVLKTAKNP TRKIAF
Sbjct: 237 EFVAFTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAF 296

Query: 295 LGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXX 354
             DQNKVPENEKL  + LKLR +L   LGY TYANYNLDIKMAKNQETV++FL D     
Sbjct: 297 NADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKL 356

Query: 355 XXXXXXXXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPL 414
                                  + YD HYYIWDHRYYDNKYLKD FNVD+EKISEYYP+
Sbjct: 357 KPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPV 416

Query: 415 ESTIDGMLKIYETVLNLKFIEETDPLAKNVWH-PDVKQLSVWNMDDRANPAFVGWIYFDL 473
           ESTI GMLKIYETV+NLKFIEETD   K+ W   DVKQL+VW MDD + P FVGWIYFDL
Sbjct: 417 ESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDL 476

Query: 474 YPRDGKYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHEL 533
           +PR+GKYGHAANFG+A SYI +++KR YPVTALVCNFS  T +KPALLKH+EITTFFHEL
Sbjct: 477 HPREGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHEL 536

Query: 534 GHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPED 593
           GHGIHDLVG N   RFNGPG+VPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPE 
Sbjct: 537 GHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPES 596

Query: 594 LLDSLISTKHVNGALFALRQLHFGLFDMTVHTTKD---IENLDLLKLWNESREEICLVEN 650
           LL+SLI+TKHVNGALFALRQLHFGLFDM VHTT D   I+N+DL++LWN  REEI LVEN
Sbjct: 597 LLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVEN 656

Query: 651 GENFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILA 710
           G+   KGY+SFGHI+SDSYSAGYYGYMWAEVFA DMY++KFA +PL+   GI+YRD+ILA
Sbjct: 657 GDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILA 716

Query: 711 KGGLYEINDNLLEFLGREPSNKPFLKELGL 740
           +GG+ E NDNL EFLGREPS + FLKELGL
Sbjct: 717 RGGIRETNDNLKEFLGREPSKEAFLKELGL 746

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/683 (65%), Positives = 524/683 (76%), Gaps = 7/683 (1%)

Query: 62  GFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMG 121
            FIAP    P W W P ++L + +  I+ +N+ Y                 YM +ENK+ 
Sbjct: 41  AFIAP-QAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKIS 99

Query: 122 LLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETV-QNDDDF 180
            LIN+L FLQHVS D KIR+ASL+AT LL+  +I  SLR +++ QF+K+W+ + +  DDF
Sbjct: 100 PLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDF 159

Query: 181 LKNHQFETYKFIEKIHKDSLRNGLK--SERNYQLKYIKGKISADALTFSSNLGEQNEYVS 238
           +K + FET+KFIEK+HKD +R+GL    ++  ++K IK KI  ++L +S NLGEQ E ++
Sbjct: 160 VKEYDFETWKFIEKVHKDYVRSGLNLPEDKREKIKEIKIKIGNNSLQYSKNLGEQKELIA 219

Query: 239 FTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQ 298
           FT+EELDGVS+ V +QFEKFID +T E+K+KVTFKYPDIFPVLKTAKNP+TR+ AFL DQ
Sbjct: 220 FTREELDGVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQ 279

Query: 299 NKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXX 358
           NKVP+NE L    LKLR ELA TL YSTYANYNL+ KMAK QETVL FLND         
Sbjct: 280 NKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLA 339

Query: 359 XXXXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTI 418
                                YD HYYI+DHRYYDNKYLKDNFNVD+E ISEYYPLE TI
Sbjct: 340 MKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTI 399

Query: 419 DGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDG 478
           +GMLKIYE +  LKF EET    K+VWH DVKQL+VW MD+   P FVGWIYFDL+PRDG
Sbjct: 400 NGMLKIYEELFKLKFNEETK--NKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDG 457

Query: 479 KYGHAANFGIASSYI-TEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGI 537
           KYGHAANFGI+SSY+  E  KRSYPVTALVCNFSK T  +P+LLKH+EITTFFHELGHGI
Sbjct: 458 KYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGI 517

Query: 538 HDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDS 597
           HDLVG+NK +RFNGPG+ PWDFVEAPSQMLEFWTWN NEL SLS HY++ EKIP+DLL S
Sbjct: 518 HDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTS 577

Query: 598 LISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKG 657
           LI TKHVNGALFALRQLHFGLFDMTVHTT ++E+L+LLKLWNE REEICLVE G   +KG
Sbjct: 578 LIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKG 637

Query: 658 YNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEI 717
           Y+SFGHI+SDSYSAGYYGYMWAEVFAADMYHTKF+PNPLD  VG++YRD++LA GGLYEI
Sbjct: 638 YDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEI 697

Query: 718 NDNLLEFLGREPSNKPFLKELGL 740
            DNL +FLGREPS   FLKELGL
Sbjct: 698 ADNLRDFLGREPSKNAFLKELGL 720

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  855 bits (2210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/683 (61%), Positives = 513/683 (75%), Gaps = 10/683 (1%)

Query: 60  KHGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENK 119
           K  F+ P    P W +T +++L +T   I+ +N+                   Y+++EN 
Sbjct: 38  KTDFVVP-QAAPSWNYTTEELLKQTHEAIDSSNELLDSLESISNPSVENFVTPYLHHENT 96

Query: 120 MGLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDD 179
           +  L NQLTFLQHVS+DK++RD S + T L+E+  I +SLR++++ QF+ VW  +++D  
Sbjct: 97  ISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQ 156

Query: 180 FLKNHQFETYKFIEKIHKDSLRNGLK--SERNYQLKYIKGKISADALTFSSNLGEQNEYV 237
           F K+H FE YKF+EK HKD LR+GL    E+  ++K IK KIS ++L FS NLGEQNE++
Sbjct: 157 FKKDH-FEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFI 215

Query: 238 SFTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGD 297
           +FTKEEL GVSE VM QFE   +      KYKVTFKYPDIFPVLK+AKN +TRK AF+GD
Sbjct: 216 TFTKEELIGVSENVMKQFETVDEDGIT--KYKVTFKYPDIFPVLKSAKNAETRKRAFIGD 273

Query: 298 QNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXX 357
           QNKVP+NE L    L+LR +LA  L Y +YA+YNLDIKMAK +E VL FLND        
Sbjct: 274 QNKVPQNEALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPL 333

Query: 358 XXXXXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLEST 417
                                PYD  YYIWD+RYYDN+YLK NF +D EKI+EY+PLEST
Sbjct: 334 GEKELTKLKNLKEEECKELNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLEST 393

Query: 418 IDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRD 477
           I GML+IYETVL LKFIEE +    + WHPDVK+LSVW MDD   P+FVGWIYFDL+PR+
Sbjct: 394 IKGMLQIYETVLKLKFIEEDN---GDTWHPDVKKLSVWKMDDNF-PSFVGWIYFDLHPRE 449

Query: 478 GKYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGI 537
           GKYGHAANFGI+SS++  +  RSYPVTALVCNFSKPTK+KPALLKHSE+TTFFHELGHGI
Sbjct: 450 GKYGHAANFGISSSFLKSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGI 509

Query: 538 HDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDS 597
           HDLVG N   RFNGP + PWDFVEAPSQMLEFWTWNK EL SLSKHY+T EKIP+ LLDS
Sbjct: 510 HDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDS 569

Query: 598 LISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKG 657
           L+ TKH+NGALFALRQLHFGLFDM VHTTKDI  L++ +LWN  REEICL++NG+  TKG
Sbjct: 570 LVRTKHINGALFALRQLHFGLFDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKG 629

Query: 658 YNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEI 717
           +NSFGHI+SDSYSAGYYGYMWA+VFA+DMY+TKF  +PL+  VG++YRD+ILA+GGLYEI
Sbjct: 630 FNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEI 689

Query: 718 NDNLLEFLGREPSNKPFLKELGL 740
            DNL EFLGR+P+NK FLKELGL
Sbjct: 690 EDNLTEFLGRKPNNKAFLKELGL 712

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/682 (60%), Positives = 511/682 (74%), Gaps = 6/682 (0%)

Query: 62  GFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMG 121
            F     T P W++TP  I   TK  IEK+NK+Y                 +M +EN++G
Sbjct: 32  SFPTAPQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELG 91

Query: 122 LLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFL 181
            +INQLTFLQHVS+DK+IRDAS++++  L++ +I  SLR +++ QF +VW+  Q+  D +
Sbjct: 92  PIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQSQADSI 151

Query: 182 KNHQFETYKFIEKIHKDSLRNGLKSERNYQLKY--IKGKISADALTFSSNLGEQNEYVSF 239
           +    ET+++IEK +KD + +GL+ +   +LK   IK KIS +++ FS NLGEQ E+++F
Sbjct: 152 ER---ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITF 208

Query: 240 TKEELDGVSETVMDQFEKFIDPK-TNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQ 298
           TKE+L+GV ++++ QFE     K +NE  YKVTFKYPDIFPV+K A + +TRK AFL DQ
Sbjct: 209 TKEQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQ 268

Query: 299 NKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXX 358
           NKV ENE +L + LKLR E+A+ LGY TYANYNL  KMAK+  TV+ FLND         
Sbjct: 269 NKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLG 328

Query: 359 XXXXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTI 418
                                 D +YYIWDHRYYDNKYL +NFNVD+EKISE++PLE+TI
Sbjct: 329 EKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETTI 388

Query: 419 DGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDG 478
            GML+IYET+ NLKFIE  +P  K+VWH DVKQL+VWNMDD  +P F+GWIYFDL+PRDG
Sbjct: 389 TGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDG 448

Query: 479 KYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIH 538
           KYGHAANFG++SS++  +  RSYPVTALVCNFSK TK+KP+LLKH+EI TFFHELGHGIH
Sbjct: 449 KYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIH 508

Query: 539 DLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSL 598
           DLVGQNK +RFNGPGSVPWDFVEAPSQMLEFWTWNKNEL+ LS HYKTGEKIPE L+DSL
Sbjct: 509 DLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSL 568

Query: 599 ISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGY 658
           I TKHVNGALF LRQLHFGLFDM VH+ KD++NL +   WN+ R++I L+ NG   +KGY
Sbjct: 569 IKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNGGTLSKGY 628

Query: 659 NSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEIN 718
            SFGHI+SDSYSAGYYGY+WAEVFA DMYHTKFA +PL+   GI+YRD++LA+GGL +IN
Sbjct: 629 ASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDIN 688

Query: 719 DNLLEFLGREPSNKPFLKELGL 740
           D+L EFLGREPS   FLKELGL
Sbjct: 689 DSLKEFLGREPSKDAFLKELGL 710

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/680 (61%), Positives = 514/680 (75%), Gaps = 7/680 (1%)

Query: 64  IAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMGLL 123
           IAP    P W++TP  I  +T   I+K+NK+Y                 +M +EN++G +
Sbjct: 35  IAP-QAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFMKFENELGPI 93

Query: 124 INQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLKN 183
           IN+LTFLQHVS+DK+IRDAS++++  L++ +I  SLR +I+ QF +VW+  Q   D LK 
Sbjct: 94  INRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDAQPKADSLKK 153

Query: 184 HQFETYKFIEKIHKDSLRNGLKSERNYQLKYIKGKI--SADALTFSSNLGEQNEYVSFTK 241
              ET+K+IEK +KD + +GL+ +   +LK  + K   S +++ FS NLGEQ EY++FTK
Sbjct: 154 ---ETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQKEYITFTK 210

Query: 242 EELDGVSETVMDQFEKFIDPKTNEKK-YKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNK 300
           E+L+GV ++++ QFE     K  E   YKVTFKYPDIFPV+K A + +TRK AFL DQNK
Sbjct: 211 EQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNK 270

Query: 301 VPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXX 360
           VPENE +L + LKLR ELA+ LGY+TYA+YNL  KMAK+  TV+ FLND           
Sbjct: 271 VPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKK 330

Query: 361 XXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDG 420
                               D +YYIWDHRYYDNK+L +NFNVD+EKISEY+PLE+TI G
Sbjct: 331 ELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYFPLETTITG 390

Query: 421 MLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKY 480
           ML+IYET+ NLKFIE  +P  K+VWH DVKQL+VWNMDD  +P F+GWIYFDL+PRDGKY
Sbjct: 391 MLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKY 450

Query: 481 GHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDL 540
           GHAANFG++SS++  ++KRSYPVTALVCNFSK TK+KP+LLKH+EI TFFHELGHGIHDL
Sbjct: 451 GHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDL 510

Query: 541 VGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIS 600
           VGQNK +RFNGPGSVPWDFVEAPSQMLEFWTWNKNEL+SLS HYKTGE+IPE L+DSLI 
Sbjct: 511 VGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIK 570

Query: 601 TKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGYNS 660
           TKHVNGALF LRQLHFGLFDM VHT KD+ENL +   WN+ R+EI L+ NG   +KGY+S
Sbjct: 571 TKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDS 630

Query: 661 FGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDN 720
           FGHI+SDSYSAGYYGY+WAEVFA DMYHTKFA +PL+   G++YRD++LA+GGLY+INDN
Sbjct: 631 FGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYDINDN 690

Query: 721 LLEFLGREPSNKPFLKELGL 740
           L EFLGREPS   FLKELGL
Sbjct: 691 LKEFLGREPSKDAFLKELGL 710

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/680 (60%), Positives = 512/680 (75%), Gaps = 7/680 (1%)

Query: 64  IAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMGLL 123
           IAP    P+W++TP  I  +T   I  +N +Y                 +M +EN++G +
Sbjct: 35  IAP-QAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFENELGPI 93

Query: 124 INQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLKN 183
           INQLTFLQHVS+DK+IRDAS+ ++  L++ +I  SLR +I+ QF +VW+ VQ+  D ++ 
Sbjct: 94  INQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDVQSKADSVER 153

Query: 184 HQFETYKFIEKIHKDSLRNGLKSERNYQLKYIKGKI--SADALTFSSNLGEQNEYVSFTK 241
              ET+K++EK +KD + +GL+ +   +LK  + K   S +++ FS NLGEQ EY++FTK
Sbjct: 154 ---ETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYITFTK 210

Query: 242 EELDGVSETVMDQFEKF-IDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNK 300
           E+L+GV ++++ QFE    D  +NE  YKVTFKYPDIFPV+K A + +TRK AFL DQNK
Sbjct: 211 EQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNK 270

Query: 301 VPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXX 360
           VPENE +L + LKLR ELA+ LGY TYANYNL  KMA++  TV+ FLND           
Sbjct: 271 VPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRK 330

Query: 361 XXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDG 420
                               D +YYIWDHRYYDNKYL +NFNVD+EKISEY+PLE+TI G
Sbjct: 331 ELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLEATITG 390

Query: 421 MLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKY 480
           ML+IYET+ NLKFIE  D   K+VWH DVKQ++VWNMDD  +P FVGWIYFDL+PRDGKY
Sbjct: 391 MLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGKY 450

Query: 481 GHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDL 540
           GHAANFG++SS++ ++  RSYPVTALVCNFSK TK+KP+LLKH+EI TFFHELGHGIHDL
Sbjct: 451 GHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDL 510

Query: 541 VGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIS 600
           VGQNK +RFNGPGSVPWDFVEAPSQMLEFWTWNKNEL++LS HYKTGEKIPE L++SLI 
Sbjct: 511 VGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLIK 570

Query: 601 TKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGYNS 660
           TKHVNGALF LRQLHFGLFDM VHT KD++NL +   WN+ R++I L+ NG   +KGY+S
Sbjct: 571 TKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYDS 630

Query: 661 FGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDN 720
           FGHI+SDSYSAGYYGY+WAEVFA DMYHTKFA +PL+   GI+YRD++LA+GGLY+INDN
Sbjct: 631 FGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDINDN 690

Query: 721 LLEFLGREPSNKPFLKELGL 740
           L EFLGREPS   FLKELGL
Sbjct: 691 LKEFLGREPSKDAFLKELGL 710

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/680 (60%), Positives = 513/680 (75%), Gaps = 7/680 (1%)

Query: 64  IAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMGLL 123
           IAP    P+WT+TP  I  +TK  I+K+N +Y                 +M +EN++G +
Sbjct: 35  IAP-QAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFMKFENELGPI 93

Query: 124 INQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLKN 183
           INQLTFLQHVS+DK+IRDAS+ ++  L++ +I  SLR +I+ QF +VW+  Q+  D ++ 
Sbjct: 94  INQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDAQSKSDSIER 153

Query: 184 HQFETYKFIEKIHKDSLRNGLKSERNYQLKYIKGKI--SADALTFSSNLGEQNEYVSFTK 241
              ET+K+IEK +KD + +GL+ + + +LK    K   S +++ FS NLGEQ EY++FTK
Sbjct: 154 ---ETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKEYITFTK 210

Query: 242 EELDGVSETVMDQFEKF-IDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNK 300
           E+L+GV ++V+ QFE    D   NE  YKVTFKYPDIFPV+K A + +TRK AFL DQNK
Sbjct: 211 EQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNK 270

Query: 301 VPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXX 360
           VPENE +L + L+LR +LA+ LGY TYANYNL  KMAK+  TV+ FLND           
Sbjct: 271 VPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKK 330

Query: 361 XXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDG 420
                               D +YYIWDHRYYDNKYL +NFNVD+EKISEY+PLE+TI G
Sbjct: 331 ELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLETTITG 390

Query: 421 MLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKY 480
           ML+IYET+ NLKFIE  D  +K+VWH DVKQL+VWNMDD  +P FVGWIYFDL+PRDGKY
Sbjct: 391 MLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKY 450

Query: 481 GHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDL 540
           GHAANFG++SS++T ++ RSYPVTALVCNFSK TK+KP+LLKH+EI TFFHELGHGIHDL
Sbjct: 451 GHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDL 510

Query: 541 VGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIS 600
           VGQNK +RFNGPGSVPWDFVEAPSQMLEFWTWNKNEL+ LS HY+TGEKIPE L+DSLI 
Sbjct: 511 VGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLIK 570

Query: 601 TKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGYNS 660
           TKHVNGALF LRQLHFGLFDM VHT KD++NL + + WN+ R++I L+ NG   +KGY+S
Sbjct: 571 TKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISLISNGGTLSKGYDS 630

Query: 661 FGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDN 720
           FGHI+SDSYSAGYYGY+WAEVFA DMYHTKFA +PL+   GI+YRD++LA+GGL +I D+
Sbjct: 631 FGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGDD 690

Query: 721 LLEFLGREPSNKPFLKELGL 740
           L +FLGREPS   FLKELGL
Sbjct: 691 LKKFLGREPSKDAFLKELGL 710

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/682 (60%), Positives = 508/682 (74%), Gaps = 10/682 (1%)

Query: 64  IAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMGLL 123
           + P    P W + P+ IL +TK +I  T  +Y                 Y+N+EN+  LL
Sbjct: 66  LTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHENENELL 125

Query: 124 INQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLKN 183
           INQLTFLQHVS DK IRDAS+EAT LL+D +I +  R ++++QF+ +W  +++  D  ++
Sbjct: 126 INQLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKDEFED 185

Query: 184 HQFETYKFIEKIHKDSLRNGLK--SERNYQLKYIKGKISADALTFSSNLGEQNEYVSFTK 241
             FE ++F+EK HKD +R GL   +++  ++K IK KI+ + L FS NLGEQ EY+ FT 
Sbjct: 186 --FEIWRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEYILFTA 243

Query: 242 EELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNKV 301
           EEL GV E+V++QFEK ++ +   +K KVT+KYPDIFPVLK A+NP+TR  AF+GDQNKV
Sbjct: 244 EELKGVPESVIEQFEK-VNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKV 302

Query: 302 PENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXX-XXXX 360
           PENE L  + LKLR ELA  LGY TYANYNLDIKMAKN +TVL F+ND            
Sbjct: 303 PENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKE 362

Query: 361 XXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDG 420
                            + YDG YYIWDHRYYDNKYLK+NFNVD EKI+EYYPLESTIDG
Sbjct: 363 LDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDG 422

Query: 421 MLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKY 480
           MLKIYET+L LKF+E  +   K  WH DVKQL+VW +D   NP FVGWI+FDL+PRDGKY
Sbjct: 423 MLKIYETLLKLKFVEVKE--NKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKY 480

Query: 481 GHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDL 540
           GHAANFG++SSYI+    RSYP+TALVCNFSK TK+KP+LLKHSEITTFFHELGHGIHDL
Sbjct: 481 GHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDL 540

Query: 541 VGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIS 600
           VG N+  RFNGPG+VPWDFVEAPSQMLEFWTWN  ELLSLS++YK   KI   LL+SLI 
Sbjct: 541 VGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIK 600

Query: 601 TKHVNGALFALRQLHFGLFDMTVH--TTKDIENLDLLKLWNESREEICLVENGENFTKGY 658
           TKHVNGALFALRQLHFGLFDM VH  + ++++ LD+ KLWN+ RE+ICL+ NG+  T GY
Sbjct: 601 TKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGY 660

Query: 659 NSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEIN 718
           NSFGHI+S SYSAGYYGYMWAEVFA DMY+TKF  +PL+  VG+KYRD++LA+GGLYEI+
Sbjct: 661 NSFGHIMSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEID 720

Query: 719 DNLLEFLGREPSNKPFLKELGL 740
           DNL EFLGR+P+   FL+ELGL
Sbjct: 721 DNLEEFLGRKPAKDAFLEELGL 742

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/673 (56%), Positives = 495/673 (73%), Gaps = 7/673 (1%)

Query: 70  VPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMGLLINQLTF 129
            P W +   +I+   +  I++  K+Y                  +++E++    ++QLTF
Sbjct: 49  APSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTF 108

Query: 130 LQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLKNHQFETY 189
           LQHVSADK++RDAS+EAT+L+++  I TS R++++ QF KVWE  ++D++  KN   E Y
Sbjct: 109 LQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKKNDP-ELY 167

Query: 190 KFIEKIHKDSLRNG--LKSERNYQLKYIKGKISADALTFSSNLGEQNEYVSFTKEELDGV 247
            ++E ++KD +  G  L  E   ++K IK K++ ++L FS+NLGEQN+Y++FTK+EL GV
Sbjct: 168 WYMENVNKDYIHAGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIAFTKDELVGV 227

Query: 248 SETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNKVPENEKL 307
           SET + QFEK I+     +KYK+TFKYPDI PVL TAKNP+TRK A++GDQNKVP+NE++
Sbjct: 228 SETTLGQFEKVIEDGV--EKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQI 285

Query: 308 LCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXXXXXXXXX 367
           L   LKLR ELA   G+ TYA+Y L++KMAK QETV  FL D                  
Sbjct: 286 LIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGKKDLENLKS 345

Query: 368 XXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDGMLKIYET 427
                    G+PY+G +  WD+RYYD+KYLK+NF+VD E++++Y+PL+ TIDGML IY+ 
Sbjct: 346 LKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQK 405

Query: 428 VLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFG 487
           + NLKF+EET    KNVWH DVKQ +VW++D + NP FVGWIYFDL+PR+GKYGHAANFG
Sbjct: 406 LFNLKFVEETRECGKNVWHEDVKQFAVWDLD-KCNPEFVGWIYFDLHPREGKYGHAANFG 464

Query: 488 IASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDLVGQNKAA 547
           + S Y+TEE  R YPVT LVCNFSKP+  +PALLKH E+ TFFHELGHGIH LVG+++  
Sbjct: 465 LYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIG 524

Query: 548 RFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGA 607
             NGP S+PWDFVEAPSQMLEFW WNK+++L LSKHY+TGE+IP++L+DSLI TKHVN  
Sbjct: 525 HLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAG 584

Query: 608 LFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGYNSFGHIISD 667
           L  LRQLHF LFDMTVHT K+++ LD+  LWN  REE+ L+ NG+  TKGY+SF HI+S 
Sbjct: 585 LSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMS- 643

Query: 668 SYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDNLLEFLGR 727
            YSAGYYGYMW+EVFAADMYHT FAPNPLD SVG +YRD+ILAKGGL +I D+L EFLGR
Sbjct: 644 GYSAGYYGYMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGR 703

Query: 728 EPSNKPFLKELGL 740
           EP+NK FLKELGL
Sbjct: 704 EPNNKAFLKELGL 716

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/680 (49%), Positives = 457/680 (67%), Gaps = 9/680 (1%)

Query: 64  IAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNYENKMGLL 123
           + P    P W ++ + ++  +   I +T   Y                  + +E +  LL
Sbjct: 7   LVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLL 66

Query: 124 INQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLKN 183
            NQL FL++VS D +IR+AS  AT +L+D  I  + ++++++ F++VW   ++D+ F K 
Sbjct: 67  WNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYKDDEKF-KK 125

Query: 184 HQFETYKFIEKIHKDSLRNGLKS--ERNYQLKYIKGKISADALTFSSNLGEQNEYVSFTK 241
             FE Y+++EK      R+G+K   E   +L  +K KI+A  L FSSNLGE+ EY++FTK
Sbjct: 126 ENFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTK 185

Query: 242 EELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNKV 301
           EEL+GV +TV++QFEK I+     +K+KVTFKYPDI PVL+ A NP+TR+ A + D+N+V
Sbjct: 186 EELEGVPDTVLNQFEKIIEGGV--EKFKVTFKYPDIGPVLRLASNPETRRRASMADENRV 243

Query: 302 PENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXXX 361
             NE LL   L+LR+ELA+ LG+  +A YNLD KMAKN+ETVLKFLND            
Sbjct: 244 AANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKND 303

Query: 362 XXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDGM 421
                           + +DG +Y WD  YY NK L++ +NV+ + +++Y+P+ES I+GM
Sbjct: 304 LEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGM 363

Query: 422 LKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYG 481
           L IY T+  LKF+E TD   K+VWH DVKQ +VWN+DD  NP F GW+YFDL+PRDGKYG
Sbjct: 364 LNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYG 423

Query: 482 HAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDLV 541
           HAANFG+ S+Y   +  +SYPVT LV NFSKPT  +PALLK  E+TTFFHELGHGIHDLV
Sbjct: 424 HAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLV 483

Query: 542 GQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIST 601
           G N     NGPGSVPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP+ LLD+  S 
Sbjct: 484 GSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSV 543

Query: 602 KHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTK-GYNS 660
             +N  L  L QL  GLFDM VH T+D +  ++ KLWN+   EI L+ N +N+T  GY+S
Sbjct: 544 GGLNSGLANLGQLKLGLFDMYVH-TRDYKGAEVRKLWNDLTREIGLM-NLKNYTSTGYDS 601

Query: 661 FGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDN 720
           FGHI++   +  YYGY+W++VFAADMY TKF PNP + +VG++YRD ILA GGLY++ DN
Sbjct: 602 FGHIMAGYAAG-YYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDN 660

Query: 721 LLEFLGREPSNKPFLKELGL 740
           L +FLGR+P+NK FL+ LGL
Sbjct: 661 LRKFLGRDPNNKAFLRGLGL 680

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/681 (48%), Positives = 446/681 (65%), Gaps = 9/681 (1%)

Query: 64  IAPANTVPDWTWTPKQILDETKSYIEKTNKYYXXXXXXXXXXXXXXXXXYMNY-ENKMGL 122
           + P    P W +T  +++D      +K++  Y                  + Y + +  L
Sbjct: 12  LVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDL 71

Query: 123 LINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLK 182
           L NQL FL++VS D K+R+ASL   ++L+      S +++++  FE +W   ++D++F K
Sbjct: 72  LWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEF-K 130

Query: 183 NHQFETYKFIEKIHKDSLRN--GLKSERNYQLKYIKGKISADALTFSSNLGEQNEYVSFT 240
              +E YK++EK      RN   L +  + +L  +  KIS D L FS NLGE+ EY++FT
Sbjct: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFT 190

Query: 241 KEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNK 300
           +EEL+GVS  V+DQFE+ I+     KK KVTFKYPDI PVL+TA NP+TR+ A++ DQN+
Sbjct: 191 EEELEGVSPLVLDQFERIIEGGV--KKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNR 248

Query: 301 VPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXX 360
           V  NE+LL   L LR+ +A   GY  YA YNL  KMAKN+ETV+ FL D           
Sbjct: 249 VAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEK 308

Query: 361 XXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDG 420
                            + +DG  Y WD+ YY+NK L++ + +D E +++Y+P+ES I+G
Sbjct: 309 DREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEG 368

Query: 421 MLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKY 480
           ML  Y+T+  LKF+E TDP  KNVWH DVKQ +VWN+DD   P F GWIYFDLYPRDGKY
Sbjct: 369 MLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKY 428

Query: 481 GHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDL 540
            HAANFG+AS++  ++  +SYPVT LVCN +KPT  + A+L+  EITT FHELGHGIH L
Sbjct: 429 SHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHL 488

Query: 541 VGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIS 600
           V  NK A  N  GSVPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP  LLD+  +
Sbjct: 489 VANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFN 548

Query: 601 TKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTK-GYN 659
           +  +   L+ L QL  GLFDM VH T++   L++ KLWN+ R EI L+ N +N+T  GYN
Sbjct: 549 SSGLGSGLYYLGQLRLGLFDMYVH-TREYHGLEVRKLWNDMRREISLI-NSQNYTSTGYN 606

Query: 660 SFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEIND 719
           +FGHI++ SYSAGYYGY+W++VFAADMY TKF  NP + +VG +YRD ILA GGLY++ND
Sbjct: 607 TFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMND 666

Query: 720 NLLEFLGREPSNKPFLKELGL 740
           NL +FLGREP+N+ FL+ LG 
Sbjct: 667 NLRKFLGREPNNRAFLRGLGF 687

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  386 bits (992), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 208/431 (48%), Positives = 268/431 (62%), Gaps = 10/431 (2%)

Query: 313 KLRKELANT-LGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXXXXXXXXXXXXX 371
           ++  ELAN  L     A Y L++K AKN + V  FLND                      
Sbjct: 33  RMFAELANVKLPTVETAAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQ 92

Query: 372 XXXXXGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDGMLKIYETVLNL 431
                G  YDG  Y  D  YY+ K L+DNF+VD E+ ++Y+PLE TI  ML  Y T+   
Sbjct: 93  ECKELGNFYDGELYSQDLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRH 152

Query: 432 KFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASS 491
            F+EET+P  +NVWH D KQ SVW MDD   P F GW+YFDL+PRDGK+GH A F    +
Sbjct: 153 NFVEETEPATRNVWHEDDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYT 212

Query: 492 YITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDLVGQNKAARFNG 551
            ++EE  R YPVT+LVCNFS P+K KPALLKH E+  FFHELGHG H L+    A     
Sbjct: 213 DMSEEGSRVYPVTSLVCNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLC---APELCC 269

Query: 552 PGS-VPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFA 610
             S VP DF+EAPSQMLE+W W K+ +  LSKH +TGE+IPE L+D ++ +K  N A+  
Sbjct: 270 SSSWVPRDFIEAPSQMLEYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDN 328

Query: 611 LRQLHFGLFDMTVHT-TKDIENLDLLKLWNESREEICLVENGENFTKGYNSFGHIISDSY 669
           L Q+   L DM VH      E LDL  LWN   E++ L++N E  T+ Y SF HI+ + Y
Sbjct: 329 LIQV-LALLDMAVHKHVGSYETLDLNALWNNLCEDVILIKNPEP-TRAYCSFSHIV-EGY 385

Query: 670 SAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDNLLEFLGREP 729
           +AGYYGY W++VFAADMY ++F    LD ++G  Y D I+A+GGLYE+ DNL EFL REP
Sbjct: 386 AAGYYGYQWSKVFAADMYFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREP 445

Query: 730 SNKPFLKELGL 740
           +N+ +L++ GL
Sbjct: 446 NNEAYLRDQGL 456

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  184 bits (468), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 167/641 (26%), Positives = 289/641 (45%), Gaps = 79/641 (12%)

Query: 123 LINQLTFLQHVSADKKIRDASLEA-TRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFL 181
           +I+   F++    ++   +A+ +   +L E  ++L + R    E  E + ET+Q D+  L
Sbjct: 139 VIDLCEFIRSAHPEEGFIEAAQDCHEKLFEFMNVLNTDR----ELCELLNETLQ-DEQVL 193

Query: 182 KNHQFETYKFIEKIHKDSLRNG--LKSERNYQLKYIKGKISADALTFSSNLGE-QNEYVS 238
                E  K    + +D +++G  + S +  Q   +   IS     + +N+ +    ++ 
Sbjct: 194 SKLSEEEKKVGYILLQDFIKSGIYMDSGKKDQFITLSQDISVIGQEYINNINQLARNHIK 253

Query: 239 FTKEELD--GVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLG 296
             + ELD  G+   V  Q  K I      K YK+       F +LK   +P+ RK  ++ 
Sbjct: 254 VKRSELDNAGIEFDVACQLGKDI----TGKYYKIPTYGHLPFLILKACTDPEIRKKIWVA 309

Query: 297 DQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETV------------- 343
             +   +  + L N++K+R  LA+T+G   YA Y +D KMAKN + V             
Sbjct: 310 MHDCSKQQIERLTNLVKIRAFLAHTMGRECYAAYAIDGKMAKNPKDVDEFLKSLMDFLKP 369

Query: 344 -----LKFLNDXXXXXXXXXXXXXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLK 398
                LKF++D                             P+D  YY   HR      L 
Sbjct: 370 KAAKELKFISDLIHNEKGEKPSDDVDEILTAVR-------PWDREYYTAIHRNKQKHLLL 422

Query: 399 DNFNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMD 458
           D++ +D+     YYPL + I G+  I+E++  ++F E         W  DV++L+V +  
Sbjct: 423 DDYALDV-----YYPLGNVIQGLSDIFESIYGIRF-EPAVAGKGETWSSDVRRLNVVS-- 474

Query: 459 DRANPAFVGWIYFDLYPRDGKYGHAANFGIASS---YITEEN-------------KRSYP 502
                  +G IY DL+ R GK  +AA+F I  S   Y  E++             K   P
Sbjct: 475 --EKEGLIGIIYCDLFRRQGKTNNAAHFTICCSRQIYPHEDDFSTIQLGTNVDGTKFQLP 532

Query: 503 VTALVCNFSKPTKNKP---ALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDF 559
           + +L+CNF+    N      LL  +EI T FHE+GH IH ++G+ +    +G      DF
Sbjct: 533 IISLLCNFNTRCLNSGETICLLALNEIETLFHEMGHAIHSMLGRTRLQNVSGT-RCSTDF 591

Query: 560 VEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLF 619
           VE PS ++E +  +   L  +  HYKTG+++P  LL+  +             Q    + 
Sbjct: 592 VELPSVLMEHFARDTRVLKRIGHHYKTGDRVPATLLNRYLEKARFLKDCETFSQAKMAML 651

Query: 620 DMTVH---TTKDIENLDLLKLWNESREEI-CLVENGENFTKGYNSFGHIISDSYSAGYYG 675
           D  ++     ++I+++D++K+++E  +E+  LV++  N+      FGH+    Y A YY 
Sbjct: 652 DQRLYDKNIVQNIDSVDVVKIYHELEKELEVLVDDESNWCA---KFGHLF--GYGATYYC 706

Query: 676 YMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYE 716
           Y++    A+ ++   F  +P   S G K+++ +L  GGL E
Sbjct: 707 YLFDRAIASKVWKKLFEKDPYSRSGGEKFKNDVLKWGGLRE 747

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  176 bits (447), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 155/585 (26%), Positives = 263/585 (44%), Gaps = 71/585 (12%)

Query: 180 FLKNHQFETYKFIEKIHKDSLRNG-------------LKSERNYQLKYIKGKISADALTF 226
           F   H  E  +   K+ ++ LR G             +K E   Q   +   IS     F
Sbjct: 189 FTLKHVLENKEIASKLSEEELRVGRILLEDFEKSGIYMKPEVREQFITLSQSISVIGQEF 248

Query: 227 SSN---LGEQNEYVSFTKEELDGVSETVMDQFEKFIDPKTNEKKYKV-TFKYPDIFPVLK 282
            SN   + + N  VS  + +  G+   ++ Q EK I  K     YK+ T+ Y   F +LK
Sbjct: 249 ISNTDFVKDNNVVVSCNQLDSLGIDPELLSQIEKDIAGKN----YKIPTYGYIP-FALLK 303

Query: 283 TAKNPKTRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQET 342
           +  + + R+  ++   N   E  K L +++KLR  L+  LG  +YA Y L+ KMAKN + 
Sbjct: 304 SCPSEEIREKIWVAVHNCSNEQIKRLTDLVKLRAVLSQLLGKKSYAEYQLEGKMAKNPKE 363

Query: 343 VLKF---LNDXXXXXXXXXXXXXXXXXXXXXXXXXXXGI--------PYDGHYYIWDHRY 391
           V++F   L D                            +        P+D  YY    R 
Sbjct: 364 VIEFIKTLMDFTKPMAAKELDGIAEKKLTIKSNGSNLSVCDILKTVRPWDRDYYSAIER- 422

Query: 392 YDNKYLKDNFNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQ 451
            +    K+ +    E++ +Y+ L + + G+  +++ +  +K +E   P     W P+V++
Sbjct: 423 -EQTSAKNLYGS--EEVLKYFTLGNVMQGLSNLFQKIYGIK-LELDVPKIGETWSPEVRK 478

Query: 452 LSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASS-----YITEEN--------- 497
           ++V + D+      +G IY DL+ R GK  +AA+F I  S     Y TE++         
Sbjct: 479 INVISEDE----GLIGIIYCDLFERSGKTSNAAHFTICCSRDISPYETEDSTTQIAIDSK 534

Query: 498 --KRSYPVTALVCNFSKPT---KNKPALLKHSEITTFFHELGHGIHDLVGQNKAARFNGP 552
             +   P+ +LVCNFSK      +    L   E+ T FHE+GH +H ++G+ K    +G 
Sbjct: 535 GTRFQLPIISLVCNFSKTMISETDSVCFLHLPEVETLFHEMGHAMHSMLGRTKLQNISGT 594

Query: 553 GSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALR 612
                DFVE PS ++E++  +   L ++ KHY T E +  ++L+  +             
Sbjct: 595 -RCATDFVELPSILMEYFARDPRVLETIGKHYLTKETVKREMLEPHLQDLKYLQHCETYS 653

Query: 613 QLHFGLFDMTVH---TTKDIENLDLLKLWNE-SREEICLVENGENFTKGYNSFGHIISDS 668
           Q    + D T+H    +  +++LD++KL+ +  R+   LV++  N+      FGH+    
Sbjct: 654 QAKMAMLDQTLHGETISSHLDHLDVVKLYQDLERQLGVLVDDKSNWC---GKFGHLFG-- 708

Query: 669 YSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGG 713
           YSA YY Y++    A+ ++   F  NP   + G KYR+ +L  GG
Sbjct: 709 YSAVYYSYLFDRAIASKIWGALFERNPFSRASGDKYRNSVLQWGG 753

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  171 bits (434), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 143/540 (26%), Positives = 246/540 (45%), Gaps = 60/540 (11%)

Query: 233 QNEYVSFTKEELD--GVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTR 290
           ++E++    EELD  GVS  ++ Q    +        YKV       + +L++ KN   R
Sbjct: 260 RSEFIEIASEELDNSGVSPILLRQLTTTV----RGTHYKVPAYGTAPYIILRSCKNENAR 315

Query: 291 KIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDX 350
           K  +    +   +    L +++K+R  L+N +G   +A Y L  KMAK+ E VL F+   
Sbjct: 316 KAVWTALHSCPDKQINRLTHMVKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFIT-- 373

Query: 351 XXXXXXXXXXXXXXXXXXXXXXXXXXGIPYDGH-------YYIWDHRYYDNKYLKD---- 399
                                     G+P              WD  YY  K  +     
Sbjct: 374 -RLMEHTKPMAAEELKLLANMKLNDLGLPEANSEKEILETVRPWDRDYYVAKSQQTRKAK 432

Query: 400 NFNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDD 459
           N   + E I+ Y+ L S ++G+  +++++  +  +E    +    W  +V++++V     
Sbjct: 433 NQLTNHEPINAYFTLGSVLEGLSNLFKSIYGIS-LEVVASIPGETWSSEVRRVNV----K 487

Query: 460 RANPAFVGWIYFDLYPRDGKYGHAANFGIASS--YITEEN--------------KRSYPV 503
             N   +G +Y DL+ R  K    A+F +  S     EEN              K   P+
Sbjct: 488 TENNNIIGVVYCDLFERKAKTSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLPI 547

Query: 504 TALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAP 563
            +LVCNF++ + N+  LL+ SEI T FHE+GH +H ++GQ K    +G      DFVE P
Sbjct: 548 ISLVCNFARTSDNELCLLQLSEIETLFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVELP 606

Query: 564 SQMLEFWTWNKNELLSLSKHYKTGEKIPEDLL-DSLISTKHV-NGALFALRQLHFGLFDM 621
           S ++E +  +   L  + +HY T EK+PEDLL + L ST+++ N   FA  Q    + D 
Sbjct: 607 SIIMEHFARDPRVLKGIGRHYITKEKVPEDLLAEELNSTRYLQNCETFA--QAKMAMLDQ 664

Query: 622 TVHTTK---DIENLDLLKLWNE-SREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYM 677
            ++       + +LD+++L+++  R    LV++  N+      FGH+    Y A YY Y+
Sbjct: 665 RLYDNNIIFHVRDLDVVELYHDLERNLEVLVDDQTNWC---GKFGHLF--GYGATYYSYL 719

Query: 678 WAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDNLLEFLGREPSNKPFLKE 737
                AA ++   F  +P   + G  +++ +L  GGL +  + + + L     ++P LK+
Sbjct: 720 LDRAIAAKIWDCLFVNDPFSRTGGENFKNAVLKWGGLRDPWECIADVL-----DQPMLKK 774

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  171 bits (432), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 139/513 (27%), Positives = 236/513 (46%), Gaps = 48/513 (9%)

Query: 233 QNEYVSFTKEELD--GVSETVMDQFEKFIDPKTNEKKYKV-TFKYPDIFPVLKTAKNPKT 289
           ++ Y+    EEL+  G+++ V++Q  K I      + YK+ TF Y   + +L++  +   
Sbjct: 237 RSNYIKVEVEELNKSGINKIVLNQLSKDI----KGRHYKIPTFGYIP-YSILRSCPDDNI 291

Query: 290 RKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLND 349
           R   +    +   +    L  ++KLR  LAN +G  ++A+Y L+ KMAK  E V  F+  
Sbjct: 292 RMKVWSALHSCSEKQIARLDQLIKLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQS 351

Query: 350 XXXXXXXXXXXXXXXXXXXXXXXXXXXGIPYDGHYYI-----WDHRYYDNKY-LKDNFNV 403
                                            H  +     WD  +Y + + L+     
Sbjct: 352 LIDATKPKAAEELKFIADLKAKHVPGNKPAESMHEILEMVKPWDRDFYGSVHALQQRRPF 411

Query: 404 DIEKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANP 463
           + E+IS Y+ L   I G+  +++ +  + ++E   P     W P+V++++V +  +    
Sbjct: 412 NNEQISSYFSLGVVIQGLSNLFKQIYGI-YLEPVVPKTGETWSPEVRRINVVSEKE---- 466

Query: 464 AFVGWIYFDLYPRDGKYGHAANFGIASS---YITE---------ENKRS----YPVTALV 507
             +G +Y DL+ R GK  + A+F +  S   Y  E         +N +      PV +LV
Sbjct: 467 GVIGVVYCDLFERQGKTANPAHFTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLV 526

Query: 508 CNFSKPTKNKP---ALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPS 564
           CNFS  T ++     LL+ SEI T FHE+GH +H ++G+ K    +G      DFVE PS
Sbjct: 527 CNFSPTTISQEQSICLLQLSEIETLFHEMGHAMHSMLGRTKLQNISGT-RCATDFVELPS 585

Query: 565 QMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVH 624
            ++E +  +   L  ++ HY TGE IPE LL S  S         A  Q    + D  +H
Sbjct: 586 ILMEHFARDHRVLQRMASHYSTGESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELH 645

Query: 625 ---TTKDIENLDLLKLW-NESREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAE 680
                K+++ LD++KL+ N  R+   L ++  N+      FGH+    Y A YY Y++  
Sbjct: 646 GESIMKEMQYLDIVKLYHNLERQLEVLSDDKSNWC---GRFGHLF--GYGATYYSYLFDR 700

Query: 681 VFAADMYHTKFAPNPLDVSVGIKYRDLILAKGG 713
             A+ ++   FA +P     G K+++ +L  GG
Sbjct: 701 AIASKIWQHLFANDPFCRRSGEKFKNSVLKWGG 733

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  169 bits (428), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 141/511 (27%), Positives = 235/511 (45%), Gaps = 50/511 (9%)

Query: 237 VSFTKEELDG--VSETVMDQFEKFIDPKTNEKKYKV-TFKYPDIFPVLKTAKNPKTRKIA 293
           V  +  ELD   VS  ++ Q  K +  +     YKV TF Y   + +LK+ +  + RK  
Sbjct: 249 VKISCRELDNSNVSAFLLKQLNKDVKGQN----YKVPTFGYA-AYALLKSCEKEQVRKKI 303

Query: 294 FLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKN----QETVLKFLND 349
           +    +   +  K L +++KLR  LA+ +   +YA Y L+ KMAKN    Q+ +L  +ND
Sbjct: 304 WTALHSCSDKQIKRLNHLIKLRANLADLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMND 363

Query: 350 XXXXXXXXXXXXXXXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDNKYLKDNFN--VDIEK 407
                                                WD  YY  KYL+ N +     ++
Sbjct: 364 TIDKTATELKFIAELKAKDLKKPLATKTDEILKLVRPWDRDYYTGKYLQLNPSNAPSAKE 423

Query: 408 ISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVG 467
           IS Y+ L + I G+  +++ +  +K +E         W PDV++L+V + ++      +G
Sbjct: 424 ISSYFTLGNVIQGLSDLFQHIYGIK-LEPAIADEGETWSPDVRRLNVISEEE----GIIG 478

Query: 468 WIYFDLYPRDGKYGHAANFGIASSYITEENKRSY----------------PVTALVCNFS 511
            IY DL+ R GK  + A+F +  S     N+  +                PV +LVCNF+
Sbjct: 479 IIYCDLFERSGKTSNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFFQLPVISLVCNFA 538

Query: 512 K-PTKNKPAL--LKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLE 568
             P  +K +L  L+ SE+ T FHE+GH +H ++G+      +G      DFVE PS ++E
Sbjct: 539 PIPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGT-RCATDFVELPSILME 597

Query: 569 FWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVH---T 625
            +  +   L  + KHY+TGE +  D+L S + T +         Q    + D + H    
Sbjct: 598 HFAKDIRILTRIGKHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEV 657

Query: 626 TKDIENLDLLKLWN--ESREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAEVFA 683
             +I+N D++K +   E R ++ LV++  N+      FGH+    Y A YY Y++    A
Sbjct: 658 ISNIDNYDVVKNYQALERRLKV-LVDDQSNWC---GRFGHLF--GYGATYYSYLFDRTIA 711

Query: 684 ADMYHTKFAPNPLDVSVGIKYRDLILAKGGL 714
           + +++  F  +P     G K++  +L  GGL
Sbjct: 712 SKIWYALFEDDPYSRKNGDKFKKHLLKWGGL 742

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  167 bits (424), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 135/480 (28%), Positives = 225/480 (46%), Gaps = 44/480 (9%)

Query: 266 KKYKV-TFKYPDIFPVLKTAKNPKTRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGY 324
           + YK+ TF Y   + +LK+ +  + RK  +    +   +  K L +++KLR  LAN +  
Sbjct: 273 QNYKIPTFGYA-AYALLKSCEKEEVRKKLWTALHSCSDKQIKRLSHLIKLRAILANLMNK 331

Query: 325 STYANYNLDIKMAKN----QETVLKFLNDXXXXXXXXXXXXXXXXXXXXXXXXXXXGIPY 380
            +YA Y L+ KMAKN    Q+ +L  +N                                
Sbjct: 332 ESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANELKFIAELKTKDLKKPLATKTDDI 391

Query: 381 DGHYYIWDHRYYDNKYLKDNFN--VDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETD 438
                 WD  YY  KYL+ N +   + ++IS Y+ L + I+G+  +++ +  ++   E  
Sbjct: 392 LRLVRPWDRDYYTGKYLQLNPSDAPNAKEISYYFTLGNVIEGLSDLFQHIYGIRLEPEIA 451

Query: 439 PLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASS------- 491
              +  W PDV++L+V + ++      +G IY DL+ R+GK  + A+F +  S       
Sbjct: 452 DEGE-TWSPDVRRLNVISEEE----GIIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPNE 506

Query: 492 ------YITEENKRSY---PVTALVCNFSK-PTKNKPAL--LKHSEITTFFHELGHGIHD 539
                  + E    SY   PV +LVCNF+  P  +K  L  L+ SE+ T FHE+GH +H 
Sbjct: 507 TDFSTIQVGENPDGSYFQLPVISLVCNFAPIPIASKKTLCFLQLSEVETLFHEMGHAMHS 566

Query: 540 LVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLI 599
           ++G+      +G      DFVE PS ++E +  +   L  +SKHY+TGE I   +L S +
Sbjct: 567 MLGRTHMQNISGT-RCATDFVELPSILMEHFAKDIRILTKISKHYETGETIQAGMLQSFM 625

Query: 600 STKHVNGALFALRQLHFGLFDMTVH---TTKDIENLDLLKLWN--ESREEICLVENGENF 654
            T +         Q    + D + H      DI+N D++K +   E R ++ LV++  N+
Sbjct: 626 RTTNFLQNCETYSQAKMAMLDQSFHDEEIISDIDNFDIVKNYQALERRLKV-LVDDQSNW 684

Query: 655 TKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGL 714
                 FGH+    Y A YY Y++    A+ +++  F  +P     G K++  +L  GGL
Sbjct: 685 C---GRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGL 739

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  166 bits (421), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 159/626 (25%), Positives = 276/626 (44%), Gaps = 54/626 (8%)

Query: 123 LINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLK 182
           +I+   F++ V  DK+   A+ +     E  + + +L  ++ E  +K+ +T+ +D++ L 
Sbjct: 137 VIDLCEFIRSVHPDKEFLSAAQQCHE--EMFEFMNTLNTDV-ELCDKL-KTLLHDNEILS 192

Query: 183 NHQFETYKFIEKIHKDSLRNGLKSERNYQLKYIK--GKISADALTFSSNLGE-QNEYVSF 239
               E  K    + +D  ++G+      + ++I+   +IS     F +N  + +  Y+  
Sbjct: 193 KLSEEEIKVGRILLEDFEKSGIYMNPRIREQFIELSQEISLIGQDFINNANQPKTNYIKV 252

Query: 240 TKEELD--GVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGD 297
              +L+  G++  +++  +K        + YK+    P  + VLK  KN + R   +   
Sbjct: 253 NASKLESAGLNRLLLNSLKK----DAIRENYKIPTYGPTPYAVLKDCKNEEVRADIWTAL 308

Query: 298 QNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXX 357
            +   E    L +++KLR  LAN +G  +++ Y L  K+AK  + V  F+          
Sbjct: 309 HSCSSEQILRLSHLVKLRAMLANLMGAESFSQYQLKGKLAKAPKDVKNFIETLIKYVRPN 368

Query: 358 XXXXXXXXXXXXXXXXXXXGI-PYDGHYYI---WDHRYYDNKYLKDNFNVD---IEKISE 410
                                   DG       WD  YY + Y K     +    E +S 
Sbjct: 369 TEKELKFIADLKREDQGKINCGEMDGVLSTVRPWDRDYYSSIYFKGKEKTEHEFTEPLSS 428

Query: 411 YYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIY 470
           Y+ L    +G+  +   +  +K +E   P++   W  DV++++V + ++      +G IY
Sbjct: 429 YFTLGGVFEGLSDLLTQIYGIK-LEPAIPVSGETWFNDVRKINVISEEE----GIIGIIY 483

Query: 471 FDLYPRDGKYGHAANFGIASS--YITEENKRS--------------YPVTALVCNFSKPT 514
           FDL+ R GK  + A+F +  S     EEN  S               P+ +LVCNFS+ T
Sbjct: 484 FDLFERYGKTSNPAHFTVCCSREMYPEENADSIIQLGSKKDGTIFQLPIISLVCNFSRRT 543

Query: 515 ---KNKPALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWT 571
                   LL  SEI T FHE+GH IH ++G+      +G      DFVE PS ++E + 
Sbjct: 544 FQSDKTICLLTLSEIETLFHEMGHAIHSMLGRTTLQNVSGT-RCATDFVELPSILMEHFA 602

Query: 572 WNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVHTTKDIEN 631
            +   L  +S HY+TGEKI E  L   +       +     Q    + D  +H+ K I N
Sbjct: 603 SDTRVLKKMSCHYETGEKIAEKKLQFHLKEGEFLRSCETFSQAKMAMLDQELHSDKIIHN 662

Query: 632 LDLLKL----WNESREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMY 687
           LD L +     N  R    LV++  N+      FGH+    Y A YY Y++    A  ++
Sbjct: 663 LDNLNVVEIYQNLERRLQVLVDDRSNWC---GKFGHLF--GYGATYYSYLFDRAIARKVW 717

Query: 688 HTKFAPNPLDVSVGIKYRDLILAKGG 713
           +  FA +P + + G K+++ +L  GG
Sbjct: 718 NHLFANDPFNKTNGEKFKESLLKWGG 743

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  165 bits (418), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 132/480 (27%), Positives = 222/480 (46%), Gaps = 44/480 (9%)

Query: 266 KKYKV-TFKYPDIFPVLKTAKNPKTRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGY 324
           + YKV TF Y   + +LK+ +N   RK  +    +   +  K L +++KLR  LAN +  
Sbjct: 273 QNYKVPTFGYA-AYALLKSCENEMVRKKLWTALHSCSDKQVKRLSHLIKLRAILANLMHK 331

Query: 325 STYANYNLDIKMAKN----QETVLKFLNDXXXXXXXXXXXXXXXXXXXXXXXXXXXGIPY 380
           ++YA Y L+ KMAKN    Q+ +L  +N+                               
Sbjct: 332 TSYAEYQLEGKMAKNPKDVQDFILTLMNNTIEKTANELKFIAELKAKDLKKPLTTNTDEI 391

Query: 381 DGHYYIWDHRYYDNKYLKDN--FNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETD 438
                 WD  YY  KY + N   + + ++IS Y+ L + I G+  +++ +  ++ +E   
Sbjct: 392 LKLVRPWDRDYYTGKYFQLNPSNSPNAKEISYYFTLGNVIQGLSDLFQQIYGIR-LEPAI 450

Query: 439 PLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASS------- 491
                 W PDV++L+V + ++      +G IY DL+ R+GK  + A+F +  S       
Sbjct: 451 TDEGETWSPDVRRLNVISEEE----GIIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPSE 506

Query: 492 ------YITEENKRSY---PVTALVCNFSK---PTKNKPALLKHSEITTFFHELGHGIHD 539
                  + E    +Y   PV +LVCNFS     +K     L+ SE+ T FHE+GH +H 
Sbjct: 507 TDFSTIQVGENPDGTYFQLPVISLVCNFSPILIASKKSLCFLQLSEVETLFHEMGHAMHS 566

Query: 540 LVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLI 599
           ++G+      +G      DFVE PS ++E +  +   L  + KHY TGE I  D+L   +
Sbjct: 567 MLGRTHMQNISGT-RCATDFVELPSILMEHFAKDIRILTKIGKHYGTGETIQADMLQRFM 625

Query: 600 STKHVNGALFALRQLHFGLFDMTVHTTK---DIENLDLLKLWN--ESREEICLVENGENF 654
            + +         Q    + D + H  K   DI+N D+++ +   E R ++ LV++  N+
Sbjct: 626 KSTNFLQNCETYSQAKMAMLDQSFHDEKIISDIDNFDVVENYQALERRLKV-LVDDQSNW 684

Query: 655 TKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGL 714
                 FGH+    Y A YY Y++    A+ +++  F  +P     G K++  +L  GGL
Sbjct: 685 C---GRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGL 739

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  164 bits (416), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 141/573 (24%), Positives = 254/573 (44%), Gaps = 46/573 (8%)

Query: 174 VQNDDDFLKNHQFETYKFIEKIHKDSLRNGLKSERNYQLKYIK--GKISADALTFSSNLG 231
           V  D + LK    E  K  E +  D  ++G+  +   + ++I+   +IS     F +N  
Sbjct: 170 VLEDPEILKVLSEEERKVGEILLDDFEKSGIYMKAGIREQFIELSQQISVIGQEFINNTD 229

Query: 232 -EQNEYVSFTKEELD--GVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPK 288
               E++   ++E+D  G+S  +  +  + +      K YK+         +LK+  +  
Sbjct: 230 YVAKEFIKVKRDEMDKSGISPLLTARLNRDL----TGKYYKIPTYGQIPLQILKSCPDED 285

Query: 289 TRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLN 348
            RK  +    N      + L  +++LR  L+N LG  +Y++Y LD KMA + E V  F+ 
Sbjct: 286 IRKEVWAALHNCPKAQIQRLNQLVRLRVILSNLLGKQSYSDYQLDNKMAGSPENVKGFIK 345

Query: 349 DXXXXXXXXXXXXXXXXXXXXXXXXXXXGIPYDGHYYI---WDHRYYDNKYLKDNFNVDI 405
                                        +  +    I   WD  Y+ +KY  DN    I
Sbjct: 346 TLMNVTKPLAARELEFIARDKLNAPDSRHMSDNEILSIVKPWDKNYFSSKYDSDNEMAMI 405

Query: 406 --EKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANP 463
             E++  Y+ L + I+G+ ++++ +  +  ++ +       W PDV++L V + ++    
Sbjct: 406 RDEQLRYYFSLGNVINGLSELFKRIYGIT-LQPSRTENGETWSPDVRRLDVISEEE---- 460

Query: 464 AFVGWIYFDLYPRDGKYGHAANFGIASSYITEENKRSY----------------PVTALV 507
             VG IY DL+ R GK  + A+F +  S     ++  +                PV +LV
Sbjct: 461 GLVGVIYCDLFERVGKISNPAHFTVCCSRQVYPDENDFTTIQTGQNSDGTVFQLPVISLV 520

Query: 508 CNFSK---PTKNKPALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPS 564
           CNFS    P  N+   L  +EI T FHE+GH +H ++G+ +    +G      DFVE PS
Sbjct: 521 CNFSTVALPNGNRTCFLHMNEIETLFHEMGHAMHSMLGRTRLQNISGT-RCATDFVELPS 579

Query: 565 QMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVH 624
            ++E +  +   L ++  HY+T E  PE LL+  +             Q    + D  +H
Sbjct: 580 ILMEHFARDIRVLRTIGSHYETSEPAPEALLNDYLDKTQFLQHCETYSQAKMAMLDQKLH 639

Query: 625 ---TTKDIENLDLLKLWNESREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAEV 681
              +  DIE +D  K++ +    + ++ + E+   G   FGH+    Y A YY Y++   
Sbjct: 640 GSFSLSDIERIDSAKIYQKLETRLQVLADDESNWCG--RFGHLF--GYGATYYSYLFDRA 695

Query: 682 FAADMYHTKFAPNPLDVSVGIKYRDLILAKGGL 714
            A+ ++ + F  +P + + G K+++ +L  GGL
Sbjct: 696 IASKVWDSLFKDDPFNRTGGEKFKERVLKWGGL 728

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  163 bits (413), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 134/495 (27%), Positives = 220/495 (44%), Gaps = 41/495 (8%)

Query: 243 ELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNKVP 302
           E  G S  V+ Q  K  D   N  K   +   P  + +L    +   R+  +    +   
Sbjct: 265 ESSGTSHLVLRQLTK--DTMGNNYKIPTSGYAP--YTLLNACPSEAIRRQVWTAMFSCSE 320

Query: 303 ENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXXXX 362
           +  K L ++L+LR++LAN +G + Y +Y L+ KMAK+ E V  FLN              
Sbjct: 321 KQVKRLKSLLQLRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDHTKPLAAGEL 380

Query: 363 XXXXXXXXXXXXXXGIPYDGHYYIWDHRYYDN---KYLKDNFNVD-IEKISEYYPLESTI 418
                                   WD  YY +    + + N  VD    I+ Y+ L   +
Sbjct: 381 EELAKLKRNVENLSETNTLKLMRPWDRDYYSSLSPNFTRPNHRVDGFTSINTYFSLGVVM 440

Query: 419 DGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDG 478
            G+  ++  +  +  ++     A   W PDV++L V +  +      +G IY DL  R G
Sbjct: 441 QGISDLFRDIYGIS-LKPVVAQAGETWAPDVRKLQVISETE----GIIGLIYCDLLERPG 495

Query: 479 KYGHAANFGIASS--YITEENKRS--------------YPVTALVCNF--SKPTKNKP-A 519
           K    ++F +  S     EEN  S               PV +L+CNF  ++  KNK   
Sbjct: 496 KTTSPSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRATRHGKNKSLC 555

Query: 520 LLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLS 579
           LL+ S++ T FHE+GH +H ++G+ +    +G   V  DFVE PS ++E +  ++  LL 
Sbjct: 556 LLELSDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILMEHFAKDRRVLLR 614

Query: 580 LSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWN 639
           +S +Y TGE IPE+LL +     +         Q+   + D  +H+  D +  D++ +++
Sbjct: 615 ISSNYATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSITDQD--DIIAVYH 672

Query: 640 E-SREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDV 698
              RE   LV++  N+      FGH+    Y A YY Y+     AA ++   F  +P   
Sbjct: 673 GLEREMEVLVDDQTNWC---GRFGHLF--GYGASYYSYLMDRAIAAKIWDHLFKKDPFSR 727

Query: 699 SVGIKYRDLILAKGG 713
           S G K+++ +L  GG
Sbjct: 728 SSGEKFKEGVLKWGG 742

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  163 bits (413), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 137/479 (28%), Positives = 221/479 (46%), Gaps = 42/479 (8%)

Query: 266 KKYKV-TFKYPDIFPVLKTAKNPKTRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGY 324
           + YKV TF Y   F +LK+ +    RK  +    +   +  K L  ++KLR  LAN +  
Sbjct: 273 QNYKVPTFGYA-AFALLKSCEIEVVRKKIWTALHSCSDKQIKRLDRLIKLRAVLANLMHK 331

Query: 325 STYANYNLDIKMAKN----QETVLKFLNDXXXXXXXXXXXXXXXXXXXXXXXXXXXGIPY 380
            +YA Y L+ KMAKN    Q+ +L  +N+                               
Sbjct: 332 GSYAEYQLEGKMAKNPKDVQDFILTLMNNTIDKTANELKFIADLKAKDLKKPLTTNTDEI 391

Query: 381 DGHYYIWDHRYYDNKYLKDN-FNVDIEK-ISEYYPLESTIDGMLKIYETVLNLKFIEETD 438
                 WD  YY  KY++ N  NV   K IS Y+ L + I G+  +++ +  ++ +E   
Sbjct: 392 LKLVRPWDRDYYTGKYIQLNPSNVPSAKEISYYFTLGNVIQGLSDLFQQIYGIR-LEPAI 450

Query: 439 PLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASS------- 491
                 W PDV++L+V + ++      +G IY DL+ R+GK  + A+F +  S       
Sbjct: 451 ADEGETWSPDVRRLNVISEEE----GIIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPHE 506

Query: 492 ------YITEENKRSY---PVTALVCNFSK-PTKNKPAL--LKHSEITTFFHELGHGIHD 539
                  + E    SY   PV +LVCNFS  P  +K +L  L+ SE+ T FHE+GH +H 
Sbjct: 507 TDFSTIQVGENPNGSYFQLPVISLVCNFSPVPIASKKSLCFLQLSEVETLFHEMGHAMHS 566

Query: 540 LVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLI 599
           ++G+      +G      DFVE PS ++E +  +   L  + KHY+TGE I + +L   +
Sbjct: 567 MLGRTHMQNISGT-RCATDFVELPSILMEHFAKDIRVLTRIGKHYETGETIQKGMLQCFM 625

Query: 600 STKHVNGALFALRQLHFGLFDMTVHTTK---DIENLDLLKLWNE-SREEICLVENGENFT 655
            T +         Q    + D + H  K   DI+N +++  +    R    LV++  N+ 
Sbjct: 626 KTTNFLQNCETYSQAKMAMLDQSFHDEKIMSDIDNFNVVDNYQALERHLKVLVDDQSNWC 685

Query: 656 KGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGL 714
                FGH+    Y A YY Y++    A+ +++T F  +P   + G K++  +L  GGL
Sbjct: 686 ---GRFGHLF--GYGATYYSYLFDRTIASKIWYTLFDDDPYSRNNGDKFKKHLLKWGGL 739

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  160 bits (404), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 131/532 (24%), Positives = 239/532 (44%), Gaps = 43/532 (8%)

Query: 207 ERNYQLKYIKGKISADALTFSSNLGEQNEYVSFTKEELDGVSETVMDQFEKFIDPKTNEK 266
           ER  +L  +   +  + +T +  +G     +     E  GVS+ V+ Q  K +  K    
Sbjct: 226 ERFIELSQVISIVGQEFITNTEYVGTSFVEIETDVLEASGVSQMVLQQLSKDLSGKF--- 282

Query: 267 KYKV-TFKYPDIFPVLKTAKNPKTRKIAFLGDQNKVPENE-KLLCNVLKLRKELANTLGY 324
            YK+ T+ Y   + +++T  +   RK  +       PE + K L  +++LR++LA+ +G 
Sbjct: 283 -YKIPTYGYLP-YSIIRTCPSEYIRKKVWTA-MYSCPEKQIKRLKKLVRLRQQLAHIMGK 339

Query: 325 STYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXXXXXXXXXXXXXXXXXXGIPYDGHY 384
             YA Y L+ KMAK+ + V  F+N                                    
Sbjct: 340 PDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEELKPLADMKHDNHCKDASEILSSV 399

Query: 385 YIWDHRYYDNKYL----KDNFNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETDPL 440
             WD  Y+ +  L    +    +  + ++ Y+ L   I G+  +++++  ++ +E     
Sbjct: 400 RPWDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGVVIQGLSDLFQSIYGIR-LEPVVAK 458

Query: 441 AKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASSYITEENKRS 500
               W P+V+++ V +    AN   +G IY DL+ R GK  + A+F +  S     N+  
Sbjct: 459 TGETWDPEVRKIQVIS---EAN-GVIGVIYCDLFERQGKTPNPAHFTVCCSRQIYPNETD 514

Query: 501 Y----------------PVTALVCNFS--KPTKNKPALLKHSEITTFFHELGHGIHDLVG 542
           Y                PV +LVCNFS  +   +   LL+ SE+ T FHE+GH +H ++G
Sbjct: 515 YSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSICLLQLSEVETLFHEMGHAMHSMLG 574

Query: 543 QNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTK 602
           + +    +G      DFVE PS ++E +  +   L  +S HY TGE++P+++L +     
Sbjct: 575 RTQLQNISGTRCAT-DFVELPSILMEHFAKDLRVLSRISSHYATGERVPKEMLVNYQQEN 633

Query: 603 HVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEI-CLVENGENFTKGYNSF 661
                     Q+   + D  +H+  D  + D++ +++   +E+  LV++  N+      F
Sbjct: 634 RFLEHTETFSQIKMAMLDQRLHSLTD-NSEDIVTVYHGLEKELQVLVDDRSNWC---GRF 689

Query: 662 GHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGG 713
           GH+    Y A YY Y+     AA +++  F  +P   + G K+++ +L  GG
Sbjct: 690 GHLF--GYGASYYSYLMDRAIAAKVWNHLFQHDPFSRAGGEKFKNSVLKWGG 739

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  155 bits (391), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 138/592 (23%), Positives = 258/592 (43%), Gaps = 61/592 (10%)

Query: 166 QFEKVWETVQNDDDFLKNHQFETYKFIEKIHKDSLRNG-------------LKSERNYQL 212
           +F  V  T +   + LK H   T   ++++  + +R G             ++ +   Q 
Sbjct: 162 EFMNVLNTDKTLCEVLK-HVLRTESIVQELSDEEIRVGNILLEDFEKSGIDMEPKVGEQF 220

Query: 213 KYIKGKISADALTFSSNLG-EQNEYVSFTKEELD--GVSETVMDQFEKFIDPKTNEKKYK 269
             I  +IS     F +N    +++YV    +ELD  GVS  +++Q  + +      + YK
Sbjct: 221 INISQQISIVGQEFINNTDFPRSDYVKIPCKELDSSGVSTLLLNQLSRDL----KNQNYK 276

Query: 270 VTFKYPDIFPVLKTAKNPKTRKIAFLGDQNKVPENE-KLLCNVLKLRKELANTLGYSTYA 328
           V       F +L++  N   R +      +  PE +   L  ++ LR  LA+ +G  +YA
Sbjct: 277 VPAYGYAAFSILRSCPNENVR-MKIWTAMHSCPEKQISRLKQLVMLRGLLASIMGKKSYA 335

Query: 329 NYNLDIKMAKNQETVLKFLNDXXXXXXXXXXXXXXXXXXXXXXXXXXXGIPYDGHYYI-- 386
            Y L  KMAK+   V  F+                                 D       
Sbjct: 336 EYQLSGKMAKSPVYVRGFVQSLVDVTKPLAAEELRVLAKLKSGHLGVNVPQSDADVLRFV 395

Query: 387 --WDHRYYD--NKYLKDNFNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAK 442
             WD  +Y   N   +    ++ E IS Y+ L + + G+ +++E +  ++ +E     A 
Sbjct: 396 RPWDRDFYSTLNALQQQRKTLENEHISSYFSLGTVMQGLSRLFEDIYGIR-LEPVVAKAG 454

Query: 443 NVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASS----------- 491
             W P+V++++V +  +      +G +Y DL+ R GK  + A+F +  S           
Sbjct: 455 ETWSPEVRRINVVSEKE----GIIGVVYCDLFERQGKTSNPAHFTVCCSRTIYPGETDLS 510

Query: 492 -----YITEENKRSYPVTALVCNFSK--PTKNKPALLKHSEITTFFHELGHGIHDLVGQN 544
                 +    K   PV +LVC+F++   ++    LL+ S++ T FHE+GH +H ++G+ 
Sbjct: 511 TIQVGQLPSGEKFQLPVISLVCSFAQNSASRQGVCLLQLSDVDTLFHEMGHAMHSMLGRT 570

Query: 545 KAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHV 604
                +G      DFVE PS ++E +  +   L  + +HY T + IP +LL    +  + 
Sbjct: 571 SLQNISGT-RCATDFVELPSILMEHFARDSRVLSRIGRHYATDQPIPTELLKLNQTEMNY 629

Query: 605 NGALFALRQLHFGLFDMTVHTTKDIEN--LDLLKLWNESREEI-CLVENGENFTKGYNSF 661
                   Q    + D  +H++K + +  LD++KL++   +++  L ++  N+      F
Sbjct: 630 LQHTETFSQAKMAMLDQELHSSKALTDGKLDVVKLYHGVEKDMEVLADDQSNWC---GRF 686

Query: 662 GHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGG 713
           GH++   Y A YY Y++    A+ ++   FA +P +   G K+++ +L  GG
Sbjct: 687 GHLL--GYGASYYSYLFDRAIASKIWQHLFAEDPFNRENGEKFKESVLKWGG 736

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  154 bits (389), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 124/514 (24%), Positives = 227/514 (44%), Gaps = 48/514 (9%)

Query: 233 QNEYVSFTKEELD--GVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTR 290
           ++ Y+    EE+D  G+++ ++ Q  K +      K YK+       + +L++  + + R
Sbjct: 255 RSNYIKIKCEEVDNSGINKLLISQLPKDV----RGKYYKIPTHGYIAYSILRSCPDEEIR 310

Query: 291 KIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDX 350
              +        +    L  +L+LR  LA  +G  ++A Y L+ KMA+  + V  F+   
Sbjct: 311 MNLWTAMHRCSDKQINRLDQLLRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTL 370

Query: 351 XXXXXXXXXXXXXXXXXXXXXXXXXXGIPYDGHYYI------WDHRYYDNKY-LKDNFN- 402
                                       P      I      WD  YY + Y L+   + 
Sbjct: 371 VNYMRPKTIEELKFIYELKSKQEKREIQPSPSEQDIASMVRPWDREYYTSMYSLQQRRDA 430

Query: 403 VDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRAN 462
           +D E+IS Y+ L + I G+  ++E++  ++ +E   P     + P+V++L+V    +   
Sbjct: 431 IDDEQISSYFTLGNVIQGLSDLFESIYGIR-LEPVVPKTGETFSPEVRRLNVVCEQE--- 486

Query: 463 PAFVGWIYFDLYPRDGKYGHAANFGIASS----------------YITEENKRSYPVTAL 506
              +G +Y DL+ R GK  + ++F +  S                + +E      PV AL
Sbjct: 487 -GVIGVVYCDLFERAGKTSNPSHFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIAL 545

Query: 507 VCNFSKPTKNKP---ALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAP 563
           VCNFS  T ++     LL+ +E+ T FHE+GH +H ++G+ +    +G      DFVE P
Sbjct: 546 VCNFSSSTDSEGKSICLLQLNEVETLFHEMGHAMHSMLGRTRLQNISGT-RCATDFVELP 604

Query: 564 SQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTV 623
           S ++E +  +   L  + KH++TG  I E LL + +             Q    + D  +
Sbjct: 605 SILMEHFARDVRVLERIGKHHRTGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDL 664

Query: 624 H---TTKDIENLDLLKLWNE-SREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWA 679
           H     KD ++ D+   + +  R+   LV++  N+      FGH+    Y A YY Y++ 
Sbjct: 665 HGEKVIKDFDHFDVTAAYQQLERDMKVLVDDKSNWC---GKFGHLF--GYGATYYSYLFD 719

Query: 680 EVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGG 713
              A+ ++ + F+ +P     G K+++ +L  GG
Sbjct: 720 RAIASKVWDSLFSSDPYSRVNGEKFKECVLKWGG 753

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  154 bits (388), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 141/562 (25%), Positives = 254/562 (45%), Gaps = 52/562 (9%)

Query: 187 ETYKFIEKIHKDSLRNGLKSERNYQLKYIK--GKISADALTFSSNLGEQNEYVSFTKEEL 244
           E YK  + + +D  ++G+  E N + K+I+   +IS     F SN     +YV+     +
Sbjct: 214 EEYKVGKILLEDFEKSGIYMEPNTREKFIELSQEISLVGQEFISN----TDYVTKNNILI 269

Query: 245 DGVSETVMD---QFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNKV 301
           D  S  + +    F   +      K YK+    P  + +L    N   RK  +    +  
Sbjct: 270 DRESLNLSELELPFTYQLKTDITGKHYKIPTTGPIPYSILTNCSNETIRKKIWTELHSCS 329

Query: 302 PENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXXX 361
            E  + L  ++ LR +LA  L   ++A Y L  KMAKN E V KF++             
Sbjct: 330 QEQIERLKKMVTLRYKLAKLLKKKSFAEYQLQGKMAKNPEEVKKFIS---TLLDFTKPLA 386

Query: 362 XXXXXXXXXXXXXXXGIPY--DGHYYI-----WDHRYYD--NKYLKDNFNVDIEKISEYY 412
                          G+ +  D ++ +     WD  YY   N+Y       D+ ++  Y+
Sbjct: 387 IKELTSLAEVKAADLGLAFKNDSNFIVNLIRPWDRNYYSKINRYENKQTMEDLNELPYYF 446

Query: 413 PLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFD 472
            L + I G+  ++  +  ++F E   P  +  W P+V++L+V +     +   +G +Y D
Sbjct: 447 SLGNVIAGLSNLFHNIYGIRF-ELAVPKLEETWLPEVRKLNVIS----ESEGLIGIVYCD 501

Query: 473 LYPRDGKYGHAANFGIASS---------------YITEENKRSYPVTALVCNFSKP---T 514
           L+ R  K  +AA+F I  S                 ++ N    P+ +L+CNFSK     
Sbjct: 502 LFERPSKKTNAAHFTICCSREIGKGEDISTMQVGMNSKGNMFQLPIISLICNFSKSHLFE 561

Query: 515 KNKPALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNK 574
           +N P  L+  EI T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  + 
Sbjct: 562 ENGPCFLQLHEIETLFHEMGHAMHSVLGRTRLQNTSGTRCAT-DFVELPSILMEHFAKDV 620

Query: 575 NELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVHTTK---DIEN 631
             + S+S HY + E    +LL + + +      L    Q    + D  +H+ +   D ++
Sbjct: 621 RVMESISSHYISQEPASPELLQTWLHSTDNLQNLELYTQAKMSMLDQILHSNEIFEDQKD 680

Query: 632 LDLLKLWNESREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKF 691
           ++++K +N+  +++ L  + ++   G   FGH+    Y A YY Y++    A+ ++ + F
Sbjct: 681 INVVKSYNDLEKKLELFSDDQSNWCG--KFGHLFG--YGASYYSYLFDRAIASKVWESLF 736

Query: 692 APNPLDVSVGIKYRDLILAKGG 713
             NP   + G+K++D +L  GG
Sbjct: 737 KQNPFSRTSGLKFKDSVLRWGG 758

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  150 bits (378), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 121/500 (24%), Positives = 215/500 (43%), Gaps = 48/500 (9%)

Query: 246 GVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNKVPENE 305
           G+++ ++ Q  K I      K YK+       + VL+   +   RK  +    +  P+ +
Sbjct: 269 GINQLILSQLSKDI----KGKHYKIPTHGYIAYSVLRACPDEIVRKKLWTA-MHSCPDKQ 323

Query: 306 KL-LCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDXXXXXXXXXXXXXXX 364
            + L  +++LR  LA  +G  +YA Y L+ KMAK+ E V  F++                
Sbjct: 324 IVRLDQLVRLRAVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGF 383

Query: 365 XXXXXXXX-----XXXXGIPYDGHYYIWDHRYYDNKY---LKDNFNVDIEKISEYYPLES 416
                             +        WD  +Y   Y    +    +D ++IS Y+ L +
Sbjct: 384 ISDLKRKHMDLPPSETSNLDTLDIVRPWDRDFYHTIYSIQQRRQSPIDDQQISMYFTLGN 443

Query: 417 TIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPR 476
            + G+  ++  +  ++ +E         W P+V++L+V + ++      +G +Y DL+ R
Sbjct: 444 VMQGLSDLFHQIYGIR-LEPVIAQKGETWSPEVRRLNVVSDEE----GVIGVVYCDLFER 498

Query: 477 DGKYGHAANFGIASS---YITEEN-------------KRSYPVTALVCNFSKPT---KNK 517
           DGK  + ++F +  S   Y  E +             K   P+ +LVCNF+         
Sbjct: 499 DGKTSNPSHFTVCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQS 558

Query: 518 PALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNEL 577
             LL  SEI T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L
Sbjct: 559 LCLLHISEIETLFHEMGHAMHSMLGRTRLQNLSGT-RCATDFVELPSILMEHFARDTRVL 617

Query: 578 LSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKL 637
             + KH  TGE +PE LL + +             Q    + D  +H  + I  +D L +
Sbjct: 618 RQIGKHCNTGEPVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLDV 677

Query: 638 ----WNESREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAP 693
                N  RE   LV++   +      FGH+    Y A YY Y++    A+ ++ + F  
Sbjct: 678 VALYQNLERELRVLVDDQSTWC---GRFGHLF--GYGATYYSYLFDRAIASKVWESLFQE 732

Query: 694 NPLDVSVGIKYRDLILAKGG 713
           +P   + G ++++ +L  GG
Sbjct: 733 DPFSRAGGQRFKEYVLKWGG 752

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  147 bits (372), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 139/587 (23%), Positives = 262/587 (44%), Gaps = 66/587 (11%)

Query: 169 KVWETVQNDDDFLKNHQFETYKFIEKIHKDSLRNG--LKSERNYQLKYIKGKISADALTF 226
           ++ + V +DD        E  K  + + +D  ++G  +  E   Q   +  +IS     F
Sbjct: 176 EILKRVLSDDLIASKLSEEELKVGKILLEDFEKSGIDMAPEVGEQFINLSQQISIVGQEF 235

Query: 227 SSNLG-EQNEYVSFTKEELD--GVSETVMDQFEKFIDPKTNEKKYKV-TFKYPDIFPVLK 282
            SN    ++EYV  +  EL+  G+S  +++   +     T  + YKV T+ Y   F +L+
Sbjct: 236 ISNTDFPKSEYVKVSCNELETSGISPLLLNHLSR----DTKGQNYKVPTYGYI-AFSILR 290

Query: 283 TAKNPKTRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQET 342
           +  +   R   +    +   +    L +++KLR  LA  +G ++Y++Y L+ KMAK+   
Sbjct: 291 SCPSENIRMKVWTAVHSCPEKQITRLKHLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPVY 350

Query: 343 VLKFLNDXXXXXXXXXXXXXXXXXXXXXXXXXXXGIPYDGHYYI-----WDHRYYDN--K 395
           V  F+ +                            IP      +     WD  +Y     
Sbjct: 351 VRGFV-ESLAEAIKPLAMRELRALANLKSSHLDLPIPKTDEEVLKFVRPWDRDFYSTLIS 409

Query: 396 YLKDNFNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVW 455
             +    ++ E+I+ Y+ L + + G+  + E +  ++ +E         W P+V++++V 
Sbjct: 410 LQQQRKTLENEQINSYFSLGTVMQGLSSLLEDIYGIR-LEPAVAKVGETWSPEVRRINVV 468

Query: 456 NMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASS--YITEENKRS------------- 500
           +  +      +G +Y DL+ R GK  + A+F +  S     EE   S             
Sbjct: 469 SDQE----GVIGVVYCDLFERQGKTSNPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQI 524

Query: 501 --YPVTALVCNFSKPTKNKP--ALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVP 556
              PV +LVC+FS+ + +K    LL+ SE+ T FHE+GH IH ++G+      +G     
Sbjct: 525 FQLPVISLVCSFSQNSGSKKDVCLLQLSEVDTLFHEMGHAIHSMLGRTSLQNISGT-RCA 583

Query: 557 WDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALF------- 609
            DFVE PS ++E +  +   L  + KHY T E +P++LL       H+N           
Sbjct: 584 TDFVELPSILMEHFAHDSRVLSRIGKHYITNEPVPDELL-------HLNQNELKYLQNTE 636

Query: 610 ALRQLHFGLFDMTVHTTKDIEN--LDLLKLWNESREEI-CLVENGENFTKGYNSFGHIIS 666
              Q    + D  +H+ + + +  +D++++++E  +++  L ++  N+      FGH++ 
Sbjct: 637 TFSQAKMAMLDQEMHSPRMLTDGPVDVVEIYHEVEKQMGVLTDDKSNWC---GRFGHLL- 692

Query: 667 DSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGG 713
             Y A YY Y++    A+ ++   FA +P     G K+++ +L  GG
Sbjct: 693 -GYGASYYSYLFDRAIASKVWQHLFANDPFSRKSGEKFKNSVLRWGG 738

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  147 bits (371), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 140/591 (23%), Positives = 263/591 (44%), Gaps = 73/591 (12%)

Query: 170 VWETVQNDDDFLKNHQFETYKFIEKIHKDSLRNGLKSERNYQLKYIK--GKISADALTFS 227
           + + V ND +       E  K  + + +D  ++G+  + N + ++I    +IS     F 
Sbjct: 177 ILKHVLNDPNINSKLTPEEIKVGKLLLEDFEKSGIYMDPNIRKQFISLSQEISLTGQDFI 236

Query: 228 SNLGE-QNEYVSFTKEELD--GVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTA 284
           +N+   ++ +V     EL+  GV+  ++ Q  K I      K YK+         ++++ 
Sbjct: 237 NNIDLIKSNHVKIKCSELNKSGVNSLLLKQLPKDI----TGKYYKIPTSGYIPISLIRSC 292

Query: 285 KNPKTRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETV- 343
            +   R   +    +   +  + L +++KLR  LA+ L   ++A Y L+ KMAK  + V 
Sbjct: 293 PDATIRAKVWASLHSCPNDQIRRLTHLVKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVR 352

Query: 344 -----------------LKFLNDXXXXXXXXXXXXXXXXXXXXXXXXXXXGIPYDGHYYI 386
                            LKF+ D                             P+D  YY 
Sbjct: 353 DFIKTLMDYMRPKAAQELKFMADLKCKELNIPTSDSTTAILDLIS-------PWDREYYT 405

Query: 387 WDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWH 446
             H    +  L +N  +++     Y+ + + + G+  I++ +  ++ +E   P     W 
Sbjct: 406 TIHSKAKDVNLYENHPINM-----YFTMGNIMKGLSHIFQRIYGIR-LEAVVPEEGETWS 459

Query: 447 PDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASS--YITEENKRS---- 500
           P+V++L+V +  +      +G +Y DL+ R GK  + A+F +  S     +EN  S    
Sbjct: 460 PEVRRLNVISETE----GLIGVVYCDLFERAGKTSNPAHFTVCCSRQIYPDENDLSTIQI 515

Query: 501 ----------YPVTALVCNFSKP-TKNKP--ALLKHSEITTFFHELGHGIHDLVGQNKAA 547
                      PV +LVCNFS   T N     LL+ +EI T FHE+GH +H ++G+++  
Sbjct: 516 GTNPDGTAFQLPVISLVCNFSSTLTSNDKMICLLQLNEIETLFHEMGHAMHSMLGRSRLQ 575

Query: 548 RFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGA 607
             +G      DFVE PS ++E +  +K  L  +  HY+T E++ E ++++ +        
Sbjct: 576 NVSG-TRCATDFVELPSILMEHFARDKRVLHEIGFHYETNERVSEYVIEAHLKKMKFLQD 634

Query: 608 LFALRQLHFGLFDMTVHT---TKDIENLDLLKLWNESREEI-CLVENGENFTKGYNSFGH 663
                Q    + D  +++    KD++++D++K++    E++  LV+N  N+      FGH
Sbjct: 635 CETFSQGKMAMLDQELYSENIIKDLDHVDVVKIYQTLEEDLKVLVDNKSNWC---GKFGH 691

Query: 664 IISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGL 714
           +    Y A YY Y++    A+ ++   FA +P     G K+++ +L  GGL
Sbjct: 692 LF--GYGASYYSYLFDRAIASKVWDQLFAKDPFSREGGEKFKNCVLKWGGL 740

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  146 bits (368), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 124/472 (26%), Positives = 211/472 (44%), Gaps = 57/472 (12%)

Query: 278 FPVLKTAKNPKTRK---IAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDI 334
           +  L   K+ + RK   +AF    NK  E    L  ++K R ELA  L  S+Y+ Y L+ 
Sbjct: 289 YTALLKCKDEELRKKLWVAFHSCSNKQIER---LTKIIKHRIELAKLLSKSSYSEYTLEG 345

Query: 335 KMAKNQETVLKFLNDXXXXXXXXXXXXXXXXXXXXXXXXXXXGIPYD-------GHYYIW 387
           KMAK  + V  FLN                            G   +        +   W
Sbjct: 346 KMAKGPKEVNNFLN---ALLKSILPEVTKELEPISNKKCLSEGFSLETSEQSILNNIKPW 402

Query: 388 DHRYYDNKYLKDNFNVDIEKISEYYPLESTIDGMLKIYETVLNLKF----IEETDPLAKN 443
           D  YY N     +       I EY+ L + I G+  ++ ++  ++F    IE+ +     
Sbjct: 403 DRDYY-NPIQATSEGAYQMLIMEYFTLGNIIHGLSNLFNSIYGIRFEPGKIEDGE----- 456

Query: 444 VWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASS--YITEENKRS- 500
            W  DV++L+V + D+      +G IY DL+ R+GK    +++ I  S    +EE+  S 
Sbjct: 457 TWSKDVRKLNVISEDE----GLIGVIYCDLFEREGKSESPSHYTICCSREIYSEEHDLST 512

Query: 501 --------------YPVTALVCNF---SKPTKNKPALLKHSEITTFFHELGHGIHDLVGQ 543
                          P+ +LVCNF   +     +   L+H EI T FHE+GH +H ++G+
Sbjct: 513 IQTGVNNKTGKNFQLPIVSLVCNFQVTNAKESRRICFLQHHEIETLFHEMGHAMHSMLGR 572

Query: 544 NKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKH 603
            +    +G   V  DFVE PS ++EF+  N   L+ +S+HY +GE I  ++L+  +    
Sbjct: 573 TRFQTISGTRCVS-DFVEIPSILMEFFANNPKVLIDISRHYDSGESIDIEVLNKYLENTK 631

Query: 604 VNGALFALRQLHFGLFDMTVHT--TKDIENLDLLKLWNESREEICLVENGENFTKGYNSF 661
              A     Q    L D  +H      ++N+D++++++   +E+ ++ + E+   G   F
Sbjct: 632 QFKACETYSQGKMALLDQRLHAENANSLDNIDVVEIYHNLEKELSVLPDTESNWCG--RF 689

Query: 662 GHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGG 713
           GH+    Y A YY Y++    A  ++ + F  +P     G  +++ +L  GG
Sbjct: 690 GHLY--GYGALYYCYLFDRAIATKIWESLFQNDPFSRKGGNIFKEQLLKWGG 739

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  140 bits (352), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 129/518 (24%), Positives = 225/518 (43%), Gaps = 54/518 (10%)

Query: 233 QNEYVSFTKEELDG-VSETVMDQFEKFIDPKTNEKKYKV-TFKYPDIFPVLKTAKNPKTR 290
           ++ Y+  + E +D  V++ V  Q +K I   T E  YKV T+ Y     +L+T  +   R
Sbjct: 244 RSNYIKISCELMDAHVNKMVCSQMKKDI---TGEY-YKVPTYGYIP-HTLLRTCSDEVIR 298

Query: 291 KIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDX 350
              +    +      + L  ++ LR ELA  LG   +A Y L  KMAK  E V  FL + 
Sbjct: 299 MKIWTEMHSCSDAQIERLTKLISLRVELAKLLGSQNFAQYQLHGKMAKTPENVSGFL-ES 357

Query: 351 XXXXXXXXXXXXXXXXXXXXXXXXXXGIPYDGHYYI-----WDHRYYDN-KYLKDNFNVD 404
                                       P+     +     WD  YY + + L    +  
Sbjct: 358 LVHSTRIKAASELKPLAVLKSELTGTQTPHTSEEVLELMKPWDRDYYGSIQALAQRRSSS 417

Query: 405 I---EKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRA 461
           +   E IS  + L   + G+  ++E +  +K +  T P     W PDV+++ V +  D  
Sbjct: 418 LDNGESISSSFSLGVVMQGLSDLFEKIYGIKLVPAT-PKTGETWSPDVRRIDVVDEHD-- 474

Query: 462 NPAFVGWIYFDLYPRDGKYGHAANFGIASS---YITEEN-------------KRSYPVTA 505
               +G +Y DL+ R+GK  + A+F +  S   Y+ E +             K   PV +
Sbjct: 475 --GLIGVMYCDLFEREGKTPNPAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVIS 532

Query: 506 LVCNF-------SKPTKNKPALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWD 558
           LVC+F             +  LL+ +EI T FHE+GH +H ++G+ +    +G      D
Sbjct: 533 LVCDFRWVEVNMGDGKHQQMCLLQLNEIETLFHEMGHAMHSMLGRTQLQNVSGT-RCATD 591

Query: 559 FVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGL 618
           FVE PS ++E +  +   L S+S HYKTG+ +  ++L +               Q+    
Sbjct: 592 FVELPSILMEHFARDTRVLSSISSHYKTGKSLDVEVLKNHQLENQFLQNCETFSQIKMSF 651

Query: 619 FDMTVHT---TKDIENLDLLKLWNESREEICLVENGENFTKGYNSFGHIISDSYSAGYYG 675
            D  +H    T D  ++D++ +++     + ++ + ++   G   FGH+    Y A YY 
Sbjct: 652 LDQELHNLDHTTD-GSIDVIAIYHRLERRLAVLPDDQSNWCG--KFGHLF--GYGASYYS 706

Query: 676 YMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGG 713
           Y++    A+ ++   F  +P + + G K+++ +L  GG
Sbjct: 707 YLFDRAIASKIWDHLFEQDPFNRTNGTKFKEGLLQWGG 744

>KLTH0D13244g Chr4 (1082204..1083139) [936 bp, 311 aa] {ON} some
           similarities with uniprot|P53238 Saccharomyces
           cerevisiae YGR058W Hypothetical ORF
          Length = 311

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 58/138 (42%), Gaps = 27/138 (19%)

Query: 146 ATRLLEDHDILTSLRWEIWEQFEKVWETVQNDD---------DFLKN----HQFETYKFI 192
           AT+L ++HD+    R    E    +   +QNDD         D L N     +F T    
Sbjct: 138 ATQLFQNHDVKQRGRLTAAE----LQNLLQNDDNSHFCISSVDALINLFGASRFGTVSLT 193

Query: 193 EKIHKDSLRNGLKSERN-YQLKYIKGKISADALTFSSNLGEQNEYVSFTKEELDGVSETV 251
           E I   SL   +K  R  Y    I G  +  A  F ++L E    V F       VSE +
Sbjct: 194 EFI---SLYRRVKKWRKVYVDNDINGSFTISASEFHNSLQELGYLVPFD------VSENL 244

Query: 252 MDQFEKFIDPKTNEKKYK 269
            DQ+ +FIDP  N K+ K
Sbjct: 245 FDQYAEFIDPGKNGKELK 262

>Kwal_33.14125 s33 (539186..540130) [945 bp, 314 aa] {ON} YKR046C -
           Hypothetical ORF [contig 105] FULL
          Length = 314

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 233 QNEYVSFTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKY 274
           Q EY+  TK++++G  E + +++ +FI PK N     V+ KY
Sbjct: 206 QQEYIEPTKDKINGTREFMTEKYGEFIKPKYNAAYQTVSEKY 247

>KLTH0F06182g Chr6 (544018..544980) [963 bp, 320 aa] {ON} similar to
           uniprot|P36139 Saccharomyces cerevisiae YKR046C PET10
           Protein of unknown function that co-purifies with lipid
           particles expression pattern suggests a role in
           respiratory growth computational analysis of large-scale
           protein-protein interaction data suggests a role in
           ATP/ADP exchange
          Length = 320

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 233 QNEYVSFTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKY 274
           Q EY+  TK++++G  E + +++ +FI PK N     V+ KY
Sbjct: 212 QQEYIEPTKDKINGTREFMTEKYGEFIKPKYNAAYQTVSEKY 253

>Smik_15.61 Chr15 complement(102345..104468) [2124 bp, 707 aa] {ON}
           YOL095C (REAL)
          Length = 707

 Score = 31.6 bits (70), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 49/121 (40%), Gaps = 14/121 (11%)

Query: 184 HQFETYKFIEKIHKDSLRNGLKSERNYQLKYIKGKISADALTFSSNLGEQNEYVSFTKEE 243
           H F +YK +EK+ KD   NG +       K +K   +   +T    +    +Y+     +
Sbjct: 131 HHFRSYKELEKVVKDYKLNGGRKNNPVIAKLVKLMDNCKVMTNDDLIIRAKKYLELDHSQ 190

Query: 244 LDGVSETVMDQFEKFIDPKTNEKKYKVTF--KYPDIFPVLKTAKN--PKTRKIAFLGDQN 299
            D  S    D           +KKYKV    ++ D++P L        K +++   GD N
Sbjct: 191 SDTSSSFTQDL----------QKKYKVVLIDEFQDLYPSLAPLITIICKGKQLIMFGDTN 240

Query: 300 K 300
           +
Sbjct: 241 Q 241

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,470,974
Number of extensions: 3653828
Number of successful extensions: 11646
Number of sequences better than 10.0: 95
Number of HSP's gapped: 11828
Number of HSP's successfully gapped: 116
Length of query: 740
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 623
Effective length of database: 40,065,477
Effective search space: 24960792171
Effective search space used: 24960792171
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)