Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A001701.8ON96964131e-53
NCAS0B090801.8ON93892639e-31
TBLA0A049601.8ON96962578e-30
KNAG0C002501.8ON94972524e-29
KAFR0D001701.8ON90892514e-29
SAKL0C00528g1.8ON110932535e-29
CAGL0B00396g1.8ON88832472e-28
TDEL0C069401.8ON86782436e-28
Ecym_10101.8ON82782367e-27
AFR743W1.8ON82772368e-27
TPHA0E039801.8ON86962332e-26
YCL057C-A (MOS1)1.8ON97992342e-26
KLTH0F00550g1.8ON82782323e-26
ZYRO0F18414g1.8ON87692323e-26
Skud_3.61.8ON97972325e-26
Smik_3.171.8ON97982317e-26
Kpol_2002.111.8ON86962307e-26
Kwal_33.130161.8ON82782298e-26
Suva_3.1551.8ON97962273e-25
KLLA0C00550g1.8ON82952244e-25
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A00170
         (96 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...   163   1e-53
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   105   9e-31
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   103   8e-30
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...   101   4e-29
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...   101   4e-29
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   102   5e-29
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   100   2e-28
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...    98   6e-28
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...    96   7e-27
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...    96   8e-27
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...    94   2e-26
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...    95   2e-26
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...    94   3e-26
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...    94   3e-26
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...    94   5e-26
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...    94   7e-26
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...    93   7e-26
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...    93   8e-26
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...    92   3e-25
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...    91   4e-25

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score =  163 bits (413), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 81/96 (84%)

Query: 1  MSEQVNKTEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFK 60
          MSEQVNKTEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTL               IFFK
Sbjct: 1  MSEQVNKTEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFK 60

Query: 61 RRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96
          RRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV
Sbjct: 61 RRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  105 bits (263), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 54/89 (60%), Positives = 58/89 (65%), Gaps = 6/89 (6%)

Query: 8  TEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFKRRTFPVW 67
          T    AV P      TID+SILNDKWD+VLSN L               IFFKRRTFPVW
Sbjct: 11 TPTSTAVTP------TIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVW 64

Query: 68 LGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96
          LGIGFG GRGYAEGDAIFRS AG+R+  V
Sbjct: 65 LGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  103 bits (257), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 59/96 (61%)

Query: 1  MSEQVNKTEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFK 60
          MSEQ+ +               T ++SILNDKWDIV+SN L               IFFK
Sbjct: 1  MSEQIAQQTTTPTTTESASTAVTSNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFK 60

Query: 61 RRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96
          RR FPVWLG+GFG GRGY+EGDAIFRS+AG+RS  V
Sbjct: 61 RRAFPVWLGVGFGLGRGYSEGDAIFRSTAGLRSFQV 96

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score =  101 bits (252), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 53/97 (54%), Positives = 62/97 (63%), Gaps = 4/97 (4%)

Query: 1  MSEQVNKTEHQNAVAPPQQQLAT-IDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFF 59
          MSE    T    A      QLAT ID+S+LNDKWD+VLSN L               + F
Sbjct: 1  MSET---TATDGATQNNNGQLATKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLF 57

Query: 60 KRRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96
          +RR FPVWLGIGFG GRGY+EGDAIFRS++GIR+V V
Sbjct: 58 RRRAFPVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score =  101 bits (251), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 58/89 (65%)

Query: 8  TEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFKRRTFPVW 67
          +E      P +    +ID+SILNDKWD+VLSN L               IFFKRR FPVW
Sbjct: 2  SEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPVW 61

Query: 68 LGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96
          LGIG+G GR Y+EGDAIFRS+AG+RSV +
Sbjct: 62 LGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  102 bits (253), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 48/93 (51%), Positives = 59/93 (63%)

Query: 3   EQVNKTEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFKRR 62
            Q  + +        Q Q++  +KSILNDKWD+VLSN +               + FKRR
Sbjct: 17  HQEQRNQFSRYTMSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRR 76

Query: 63  TFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVN 95
            FPVWLG+GFG GRGYAEGDAIFRSSAG+R+VN
Sbjct: 77  AFPVWLGVGFGLGRGYAEGDAIFRSSAGLRTVN 109

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score = 99.8 bits (247), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 47/83 (56%), Positives = 59/83 (71%), Gaps = 4/83 (4%)

Query: 18 QQQLATID----KSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFKRRTFPVWLGIGFG 73
          + +  T+D    +SILNDKWD+VLSN +               +FFKRR+FPVWLG+GFG
Sbjct: 6  ETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFG 65

Query: 74 AGRGYAEGDAIFRSSAGIRSVNV 96
          AGRGY+EGDAIFRS+AG+RSV V
Sbjct: 66 AGRGYSEGDAIFRSTAGLRSVKV 88

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score = 98.2 bits (243), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 49/78 (62%), Positives = 55/78 (70%)

Query: 18 QQQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFKRRTFPVWLGIGFGAGRG 77
          Q Q+A   +SILNDKWD+VLSN L               +FFKRR FPVWLGIGFG GRG
Sbjct: 8  QLQVAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGIGFGLGRG 67

Query: 78 YAEGDAIFRSSAGIRSVN 95
          YAEGDAIFRS+AG+RSV 
Sbjct: 68 YAEGDAIFRSAAGLRSVK 85

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score = 95.5 bits (236), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%)

Query: 18 QQQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFKRRTFPVWLGIGFGAGRG 77
          + ++A   +SILNDKWD+VLSN +               +FFKRR FPVWLGIGFG GRG
Sbjct: 4  KLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRG 63

Query: 78 YAEGDAIFRSSAGIRSVN 95
          YAEGDAIFRS AG+R++ 
Sbjct: 64 YAEGDAIFRSHAGLRTMK 81

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score = 95.5 bits (236), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%)

Query: 18 QQQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFKRRTFPVWLGIGFGAGRG 77
          Q +++   +SILNDKWD+VLSN +               +FFKRR FPVWLG+GFG GRG
Sbjct: 4  QLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLGRG 63

Query: 78 YAEGDAIFRSSAGIRSV 94
          YAEGDAIFRS AG+R+V
Sbjct: 64 YAEGDAIFRSHAGLRAV 80

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score = 94.4 bits (233), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 57/96 (59%), Gaps = 10/96 (10%)

Query: 1  MSEQVNKTEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFK 60
          MSEQ N    +           T  KSILNDKWD+VLSN L               + FK
Sbjct: 1  MSEQKNNNNLE----------LTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFK 50

Query: 61 RRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96
          RR FPVWLGIGFG GRGY++GDAIFRS+AG+RS  +
Sbjct: 51 RRAFPVWLGIGFGVGRGYSDGDAIFRSAAGLRSTRI 86

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score = 94.7 bits (234), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 52/99 (52%), Positives = 60/99 (60%), Gaps = 5/99 (5%)

Query: 1  MSEQVNKTEHQNAVAPPQQ---QLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXI 57
          MSEQ      Q A + P +   +  +   +IL+ KWDIVLSN L               +
Sbjct: 1  MSEQAQ--TQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVL 58

Query: 58 FFKRRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96
          FFKRR FPVWLGIGFG GRGYAEGDAIFRSSAG+RS  V
Sbjct: 59 FFKRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score = 94.0 bits (232), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 42/78 (53%), Positives = 54/78 (69%)

Query: 18 QQQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFKRRTFPVWLGIGFGAGRG 77
          Q +++   +S+LNDKWD+VLSN +               + FKRR FPVW+G+GFG GRG
Sbjct: 4  QLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRG 63

Query: 78 YAEGDAIFRSSAGIRSVN 95
          YAEGDAIFRSSAG+R+V 
Sbjct: 64 YAEGDAIFRSSAGLRTVK 81

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score = 94.0 bits (232), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 44/69 (63%), Positives = 50/69 (72%)

Query: 25 DKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFKRRTFPVWLGIGFGAGRGYAEGDAI 84
          +KSILNDKWD+VLSN L               + FKRR FPVWLGIGFG GRGYAEGDAI
Sbjct: 16 NKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAI 75

Query: 85 FRSSAGIRS 93
          FRS+AG+R+
Sbjct: 76 FRSAAGLRT 84

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score = 94.0 bits (232), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 58/97 (59%), Gaps = 1/97 (1%)

Query: 1  MSEQVNKTEHQNAVAPPQQ-QLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFF 59
          MSEQ    E   + +     +  +   +IL+ KWDIV+SN L               +FF
Sbjct: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60

Query: 60 KRRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96
          KRR FPVWLGIGFG GRGYAEGDAIFRSSAG+RS  V
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score = 93.6 bits (231), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 60/98 (61%), Gaps = 3/98 (3%)

Query: 1  MSEQVNKTEHQNAVAPPQ--QQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIF 58
          MSEQ  + +    V P +   +  +   ++L+ KWDIVLSN L               +F
Sbjct: 1  MSEQA-QAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLF 59

Query: 59 FKRRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96
          FKRR FPVWLGIGFG GRGYAEGDAIFRSSAG+RS  V
Sbjct: 60 FKRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score = 93.2 bits (230), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 57/96 (59%), Gaps = 10/96 (10%)

Query: 1  MSEQVNKTEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFK 60
          MS+Q    E Q   AP         +SILNDKWD+VLSN L               I FK
Sbjct: 1  MSQQ--SQELQITSAPT--------RSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFK 50

Query: 61 RRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96
          RR FPVWLGIGFG GRGY+EGDAIFRS+AG+R   V
Sbjct: 51 RRAFPVWLGIGFGIGRGYSEGDAIFRSAAGLRKSTV 86

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score = 92.8 bits (229), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 41/78 (52%), Positives = 54/78 (69%)

Query: 18 QQQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFKRRTFPVWLGIGFGAGRG 77
          Q ++A + +S+LNDKWD+VLSN +               + FKRR  PVW+G+GFG GRG
Sbjct: 4  QAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRG 63

Query: 78 YAEGDAIFRSSAGIRSVN 95
          Y+EGDAIFRSSAG+R+V 
Sbjct: 64 YSEGDAIFRSSAGLRTVK 81

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score = 92.0 bits (227), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 56/96 (58%), Gaps = 7/96 (7%)

Query: 8  TEHQNAVAPPQQQLATID-------KSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFK 60
          +E   A AP +   +T          ++L+ KWDIVLSN L               +FFK
Sbjct: 2  SEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFK 61

Query: 61 RRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96
          RR FP WLGIGFG GRGYAEGDAIFRSSAG+RS  V
Sbjct: 62 RRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score = 90.9 bits (224), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 58/95 (61%), Gaps = 14/95 (14%)

Query: 1  MSEQVNKTEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLXXXXXXXXXXXXXXXIFFK 60
          MSEQV  T+     A P         SIL+ +WD+VLSN +               +FFK
Sbjct: 1  MSEQVQTTK-----AVP---------SILDKRWDVVLSNVVAKTALGAGVGIVASVLFFK 46

Query: 61 RRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVN 95
          RR FPVW+G+GFG GRGYAEGDAIFR++AG+R VN
Sbjct: 47 RRAFPVWVGVGFGLGRGYAEGDAIFRTNAGLRKVN 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,845,087
Number of extensions: 199803
Number of successful extensions: 480
Number of sequences better than 10.0: 20
Number of HSP's gapped: 480
Number of HSP's successfully gapped: 20
Length of query: 96
Length of database: 53,481,399
Length adjustment: 67
Effective length of query: 29
Effective length of database: 45,798,777
Effective search space: 1328164533
Effective search space used: 1328164533
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)