Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A001601.7ON1231236272e-85
Skud_3.51.7ON113921582e-14
KAFR0D001601.7ON1111111558e-14
NCAS0B090901.7ON1191231532e-13
YCL058W-A (ADF1)1.7ON1131111488e-13
Smik_3.161.7ON1131221471e-12
SAKL0C00506g1.7ON1051101419e-12
Kpol_2002.101.7ON1111211392e-11
Suva_3.1541.7ON1131091322e-10
TBLA0A049501.7ON113961322e-10
Kwal_YGOB_YCL058W-A1.7ON1051141225e-09
Kwal_33.13015singletonOFF1051141225e-09
CAGL0B00374g1.7ON121951097e-07
KLTH0F00528g1.7ON104112982e-05
TDEL0C069501.7ON111107931e-04
ZYRO0F18436g1.7ON11290879e-04
TPHA0E039901.7ON11643840.002
KNAG0C002401.7ON12699750.043
Suva_16.1868.622ON25361671.0
AFR743CA1.7ON10141613.0
TBLA0I020003.284ON66490624.5
TPHA0C038502.476ON105675624.9
TBLA0A040108.330ON92836625.5
Ecym_52793.147ON41182608.2
Skud_2.1973.295ON97377608.6
NOTE: 1 genes in the same pillar as NDAI0A00160 were not hit in these BLAST results
LIST: KLLA0C00528g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A00160
         (123 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...   246   2e-85
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    65   2e-14
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    64   8e-14
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    64   2e-13
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    62   8e-13
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    61   1e-12
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    59   9e-12
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    58   2e-11
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...    55   2e-10
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    55   2e-10
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    52   5e-09
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    52   5e-09
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    47   7e-07
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    42   2e-05
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    40   1e-04
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    38   9e-04
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    37   0.002
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    33   0.043
Suva_16.186 Chr16 (326296..327057) [762 bp, 253 aa] {ON} YPL124W...    30   1.0  
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    28   3.0  
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...    28   4.5  
TPHA0C03850 Chr3 complement(829920..833090) [3171 bp, 1056 aa] {...    28   4.9  
TBLA0A04010 Chr1 (997412..1000198) [2787 bp, 928 aa] {ON} Anc_8....    28   5.5  
Ecym_5279 Chr5 complement(566393..567628) [1236 bp, 411 aa] {ON}...    28   8.2  
Skud_2.197 Chr2 (354621..357542) [2922 bp, 973 aa] {ON} YBR074W ...    28   8.6  

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score =  246 bits (627), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%)

Query: 1   MAARSNSLHRRRLPTGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSEL 60
           MAARSNSLHRRRLPTGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSEL
Sbjct: 1   MAARSNSLHRRRLPTGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSEL 60

Query: 61  NSQSMSPIKQKQDSLRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISG 120
           NSQSMSPIKQKQDSLRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISG
Sbjct: 61  NSQSMSPIKQKQDSLRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISG 120

Query: 121 FKF 123
           FKF
Sbjct: 121 FKF 123

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score = 65.5 bits (158), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 52/92 (56%), Gaps = 5/92 (5%)

Query: 32  IKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLSAHDLLNDQK 91
           I  ++RK+ K++V   NK S + +      + +  P K+     R  S+L A +L+ DQ 
Sbjct: 27  ISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKK-----RAKSTLKAEELVKDQA 81

Query: 92  KDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123
           KD +   +IQTEK + ND ML QIEMISGF  
Sbjct: 82  KDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 64.3 bits (155), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 67/111 (60%), Gaps = 10/111 (9%)

Query: 12  RLPTGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQK 71
           R   G +I+K K+   + NVI QS+RKKNK+ V  FN+++    NV ELN      +K+ 
Sbjct: 8   RQAGGNRIKKIKS---RKNVISQSERKKNKLIVEKFNQQTI--TNVQELNK----DLKKD 58

Query: 72  QDSLRKG-SSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGF 121
           +  L K  ++L    LL+DQ +D E    I+T+ K+  D ML+QIEMISGF
Sbjct: 59  KRRLSKTKNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGF 109

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 63.5 bits (153), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 72/123 (58%), Gaps = 7/123 (5%)

Query: 3   ARSNSLHRRRLPTGRKIRKPKNHTNKN-NVIKQSDRKKNKIKVAMFNK-ESSLHMNVSEL 60
           ARS+S  + +  T  + +  KN   KN N I  SDRKK K +V   NK E+ L MNV +L
Sbjct: 2   ARSHST-KTKAATNNRNKTGKNQVKKNKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDL 60

Query: 61  NSQSMSPIKQKQDSLRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISG 120
             Q    + +K + L+  S L A  LL DQKKD E  N+I+ E+K  +D + +QIEMISG
Sbjct: 61  --QKKKNLSKKPEPLK--SILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISG 116

Query: 121 FKF 123
           F F
Sbjct: 117 FTF 119

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score = 61.6 bits (148), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 62/111 (55%), Gaps = 12/111 (10%)

Query: 13  LPTGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQ 72
           +  G+K++K ++       I  ++RK+ K++V   NK S   +      + +  P K   
Sbjct: 15  VGVGKKVQKKRS-------ISTAERKRTKLQVEKLNKSSETMIPTLLREASTQEPAK--- 64

Query: 73  DSLRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123
             L+  ++L A +L+ DQ+KD +   +I+TEK + ND ML+QIEMISGF  
Sbjct: 65  --LKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 61.2 bits (147), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 67/122 (54%), Gaps = 16/122 (13%)

Query: 6   NSLHRRRLP----TGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELN 61
           NS+ R+ +      G+K++K ++       I  + +K+ K++V   NK S + +      
Sbjct: 4   NSMRRKSVGKNVGVGKKVQKRRS-------ISTAVKKRTKLQVEKLNKSSEMMIPTLLRE 56

Query: 62  SQSMSPIKQKQDSLRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGF 121
           + +  P K+K +S     +L A DL+ DQ+KD +    IQ EK + ND+ML+QIEMISGF
Sbjct: 57  TGAQEPAKRKTES-----TLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGF 111

Query: 122 KF 123
             
Sbjct: 112 SL 113

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 58.9 bits (141), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 14/110 (12%)

Query: 19  IRKPKNHTNKNNV-------IKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQK 71
           + KP + T K+N        IK+S +K+ +I+V   NK+  L   +S+LN  +    K K
Sbjct: 1   MAKPLSKTKKDNGSKKPSGGIKKSQKKRTRIQVEQLNKQEFL---LSDLNMTNAGSTKTK 57

Query: 72  QDSLRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGF 121
           +    K  +L A  L  DQKKD E  ++++ ++K  ND+ML Q+EMISGF
Sbjct: 58  E----KPKTLQAKALAQDQKKDKETRDKLEKQRKDTNDNMLAQLEMISGF 103

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 58.2 bits (139), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 68/121 (56%), Gaps = 11/121 (9%)

Query: 3   ARSNSLHRRRLPTGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNS 62
           A+S+   R++   G+K       + + NVI QS++K+NKIK+   NKE  L  ++ +LN+
Sbjct: 2   AKSSVSMRKKGNVGKK-------SKRKNVISQSEKKRNKIKMEKINKEGILPSDILQLNN 54

Query: 63  QSMSPIKQKQDSLRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGFK 122
           ++    +  Q    K  +L +  L  D  KD E   +I+  KK+ +D ML+QIE+++GF 
Sbjct: 55  ET----RNGQSEGNKERALESQKLQQDNVKDRETIAKIEASKKETDDSMLKQIELMTGFS 110

Query: 123 F 123
            
Sbjct: 111 L 111

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 55.5 bits (132), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 55/109 (50%), Gaps = 11/109 (10%)

Query: 23  KNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELN--SQSMSPI------KQKQDS 74
           K    KN  + +  +KK  I  A   +     + V  LN  S++M P       KQ  D 
Sbjct: 8   KKTQGKNGGVGKKQQKKRPISTAEMKR---TKLQVERLNKSSETMIPTLLKEASKQDLDK 64

Query: 75  LRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123
            +  S+L A +L+ DQ +D +    I+TEK + ND ML+QIEMISGF  
Sbjct: 65  KKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 55.5 bits (132), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 56/96 (58%), Gaps = 7/96 (7%)

Query: 28  KNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLSAHDLL 87
           K N I   D+K+ K++V   NK+ SL  ++  LN +S       ++  +  ++LS+  L 
Sbjct: 25  KANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKS-------KELAKNVNTLSSKQLK 77

Query: 88  NDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123
            DQ+KD   N  I+ +KKQ NDD++ QIEMISGF  
Sbjct: 78  KDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 51.6 bits (122), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 66/114 (57%), Gaps = 21/114 (18%)

Query: 11  RRLPTGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQ 70
           ++LPT     KP+      NVIK+  + + K+KV   NKE  L   +SELN        +
Sbjct: 8   KKLPTS----KPRGS---KNVIKKHQKIRTKLKVEQANKEVFL---ISELN--------K 49

Query: 71  KQDSLRKGS---SLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGF 121
           ++D+ R+ S   SL    L+ D KKD  A  ++++++K  ++++LRQ+E+ISGF
Sbjct: 50  REDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGF 103

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 51.6 bits (122), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 66/114 (57%), Gaps = 21/114 (18%)

Query: 11  RRLPTGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQ 70
           ++LPT     KP+      NVIK+  + + K+KV   NKE  L   +SELN        +
Sbjct: 8   KKLPTS----KPRGS---KNVIKKHQKIRTKLKVEQANKEVFL---ISELN--------K 49

Query: 71  KQDSLRKGS---SLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGF 121
           ++D+ R+ S   SL    L+ D KKD  A  ++++++K  ++++LRQ+E+ISGF
Sbjct: 50  REDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGF 103

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 46.6 bits (109), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 56/95 (58%), Gaps = 5/95 (5%)

Query: 30  NVIKQSDRKKNKIKVAMFNKESSLHMNVSELNS-QSMSPIKQKQDSLRKGSSLSAHDLLN 88
           N I  S+RKK+KI  A  NK++    +V+EL   Q ++  K  ++  ++ ++L  + L+ 
Sbjct: 31  NKISASERKKSKILTARLNKDA----DVAELKIIQELNDNKIAEEPKKRQTALDMNCLVK 86

Query: 89  DQKKDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123
           DQK+D +    I+    + N DML+Q+E++SGF  
Sbjct: 87  DQKRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 64/112 (57%), Gaps = 10/112 (8%)

Query: 12  RLPTGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQK 71
           R  +G+K R  ++ +    VI++  + + K+KV   NKES L   +SELN +  +   ++
Sbjct: 3   RKGSGKKPRSTRDVSK--GVIRKHQKIRTKLKVEQANKESFL---ISELNEREHNT--KR 55

Query: 72  QDSLRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123
             +L    SL   DL+ D++KD     +++ +K+  +++++ Q+E+ISGF  
Sbjct: 56  TPAL---ESLKVSDLIEDREKDKSMQKKMEEQKQSTDNNIIEQLELISGFSL 104

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%), Gaps = 7/107 (6%)

Query: 15  TGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDS 74
           TG+ ++K  N  N    I + D KK K +V   N++++    + +LN+ +       + S
Sbjct: 10  TGKGVQK--NQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAV-----KGS 62

Query: 75  LRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGF 121
            RK ++L    L  D +KD +   + + EK+++ +++ +QIE ISGF
Sbjct: 63  ARKANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGF 109

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 38.1 bits (87), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 6/90 (6%)

Query: 32  IKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLSAHDLLNDQK 91
           I  SD+K+ K KV   + +  L   + +LN  + S            SSL A +L  D+K
Sbjct: 27  ISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRSASSKTSNGS------SSLLARNLEQDRK 80

Query: 92  KDIEANNRIQTEKKQVNDDMLRQIEMISGF 121
            D +  ++   +KK+ ++++L+QIEMISGF
Sbjct: 81  MDQDTRDKANAKKKETDNNILQQIEMISGF 110

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%)

Query: 79  SSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGF 121
           S L A  L  D  KD +   +I+++KK+ N  +L+QIEM+SGF
Sbjct: 72  SVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGF 114

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 33.5 bits (75), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 9/99 (9%)

Query: 31  VIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGS------SLSAH 84
            I  S+RK+NK++V   N+ ++    + E N+  +     K +   +G       SL   
Sbjct: 31  TIPLSERKRNKLQVEKLNRPTN---GMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVE 87

Query: 85  DLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123
            L  D+ KD     ++  ++K+ +  ML QIEMISGF  
Sbjct: 88  KLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>Suva_16.186 Chr16 (326296..327057) [762 bp, 253 aa] {ON} YPL124W
           (REAL)
          Length = 253

 Score = 30.4 bits (67), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 34/61 (55%)

Query: 61  NSQSMSPIKQKQDSLRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISG 120
           NS ++  I+++  S  +    +A D+++DQ+ +I+   RI  ++  V DD+  +I  +  
Sbjct: 108 NSSNLDRIRRRTSSPVRSERFTAQDVIDDQRLEIKYLERIVHDQGSVIDDLTSRITRLES 167

Query: 121 F 121
           F
Sbjct: 168 F 168

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 28.1 bits (61), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 81  LSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGF 121
           L A  L  DQ+ D +A  +   E+  V+  +++Q+E I+GF
Sbjct: 59  LQAASLAQDQRSDAQAQQQRAQERSNVDKKVVQQLEAIAGF 99

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score = 28.5 bits (62), Expect = 4.5,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 13/90 (14%)

Query: 23  KNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLS 82
           KN+TN +N I  S+   N    A  ++E +  + V++    S  P+          SSL 
Sbjct: 2   KNNTNNSN-IGSSNGNTNSTTTAASSEEKNTQIFVTD----SQVPVST--------SSLD 48

Query: 83  AHDLLNDQKKDIEANNRIQTEKKQVNDDML 112
              ++ND K  +  N  I  +   +  D++
Sbjct: 49  NFSMINDDKLSLSNNQAIDKDNYTIQSDLV 78

>TPHA0C03850 Chr3 complement(829920..833090) [3171 bp, 1056 aa] {ON}
           Anc_2.476 YMR086W
          Length = 1056

 Score = 28.5 bits (62), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 9/75 (12%)

Query: 47  FNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLSAHDLLNDQKKDI-----EANNRIQ 101
           FN +S +  N+ + NS  ++PI ++   +   SS  A   LND+KK+I     + NN  Q
Sbjct: 505 FNNQSDIQNNIDDNNSTGIAPIDKRISRISVTSSDYAS--LNDEKKEILKLFDDFNNGAQ 562

Query: 102 TEKKQVNDDMLRQIE 116
             +  V D+ ++++E
Sbjct: 563 --ESDVEDENVKEVE 575

>TBLA0A04010 Chr1 (997412..1000198) [2787 bp, 928 aa] {ON} Anc_8.330
           YLR135W
          Length = 928

 Score = 28.5 bits (62), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 5/36 (13%)

Query: 14  PTGRKIRKPKNHTNKNNVIKQ-----SDRKKNKIKV 44
           PT RK RKP+N T+K +++ Q     S + KN IK+
Sbjct: 349 PTKRKTRKPQNITDKTDILLQKLSGNSSKYKNIIKM 384

>Ecym_5279 Chr5 complement(566393..567628) [1236 bp, 411 aa] {ON}
           similar to Ashbya gossypii AER197W
          Length = 411

 Score = 27.7 bits (60), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 45/82 (54%), Gaps = 14/82 (17%)

Query: 37  RKKNKIKVAMFN--------KESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLSAHDLLN 88
           ++ N  +V  FN        KE SL    +E+ SQ M   K++++  R+ SSL   D+L+
Sbjct: 24  KQNNPTEVVTFNEGDDVSSVKEQSLF---NEVFSQMMK--KERKNPARQQSSL-LPDILD 77

Query: 89  DQKKDIEANNRIQTEKKQVNDD 110
           D + D ++N +I  EK++  DD
Sbjct: 78  DMEADDQSNVQIVFEKRRTRDD 99

>Skud_2.197 Chr2 (354621..357542) [2922 bp, 973 aa] {ON} YBR074W
           (REAL)
          Length = 973

 Score = 27.7 bits (60), Expect = 8.6,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 7/77 (9%)

Query: 21  KPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSS 80
           KPK    K N I+  DR      ++  + E   H N  +  +Q  SP+ Q + S R+  +
Sbjct: 516 KPK--AGKGNGIEVVDRHSGYSSLSQVDIEGENHENTEQFRNQ--SPLSQDEQSSRQDDN 571

Query: 81  LS---AHDLLNDQKKDI 94
           +S   A  + +DQ  D+
Sbjct: 572 VSTTLAPHVSDDQDADL 588

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.124    0.325 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,344,701
Number of extensions: 563392
Number of successful extensions: 4163
Number of sequences better than 10.0: 325
Number of HSP's gapped: 4137
Number of HSP's successfully gapped: 332
Length of query: 123
Length of database: 53,481,399
Length adjustment: 92
Effective length of query: 31
Effective length of database: 42,932,127
Effective search space: 1330895937
Effective search space used: 1330895937
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)