Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A001401.5ON1091109144590.0
NCAS0B091101.5ON1020114513661e-171
KAFR0D001401.5ON1041113210361e-122
YCL061C (MRC1)1.5ON10966969141e-105
Smik_3.141.5ON11136988621e-97
ZYRO0F18480g1.5ON96011207793e-87
TPHA0E040101.5ON9656657212e-79
Suva_3.1521.5ON11404217105e-77
CAGL0B00330g1.5ON11367036742e-72
SAKL0C00462g1.5ON11773786592e-70
Kpol_2002.81.5ON9854446038e-64
KLLA0C00484g1.5ON9256725832e-61
TDEL0C069701.5ON9414084837e-49
TBLA0A075701.5ON12524414681e-46
KLTH0F00484g1.5ON9933584213e-41
Ecym_10081.5ON11183514181e-40
AFR745W1.5ON10183363544e-33
Kwal_33.130051.5ON9703623312e-30
Skud_3.31.5ON1152952543e-21
KNAG0C002201.5ON11612481891e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A00140
         (1091 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...  1722   0.0  
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   530   e-171
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   403   e-122
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   356   e-105
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   336   1e-97
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   304   3e-87
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   282   2e-79
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   278   5e-77
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   264   2e-72
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   258   2e-70
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   236   8e-64
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   229   2e-61
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   190   7e-49
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   184   1e-46
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   166   3e-41
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   165   1e-40
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   140   4e-33
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   132   2e-30
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   102   3e-21
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...    77   1e-13

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score = 1722 bits (4459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 892/1091 (81%), Positives = 892/1091 (81%)

Query: 1    MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60
            MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS
Sbjct: 1    MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60

Query: 61   TIDKVRARLSGKNYIEQEKTPLASSEQETQIITNLYTNGEDLEKDLIKHIPVSQTQPITN 120
            TIDKVRARLSGKNYIEQEKTPLASSEQETQIITNLYTNGEDLEKDLIKHIPVSQTQPITN
Sbjct: 61   TIDKVRARLSGKNYIEQEKTPLASSEQETQIITNLYTNGEDLEKDLIKHIPVSQTQPITN 120

Query: 121  TGERTQLEQEIKVTIDNDSNEMPTQVIGSTERDDETAERTQIGEVATQLIPGDTYDRTST 180
            TGERTQLEQEIKVTIDNDSNEMPTQVIGSTERDDETAERTQIGEVATQLIPGDTYDRTST
Sbjct: 121  TGERTQLEQEIKVTIDNDSNEMPTQVIGSTERDDETAERTQIGEVATQLIPGDTYDRTST 180

Query: 181  MQKTQEQLLKTQRIPQNSRDNHNQTNIINESFGSVPFTFTQKIKNFETNITNENDDFTNG 240
            MQKTQEQLLKTQRIPQNSRDNHNQTNIINESFGSVPFTFTQKIKNFETNITNENDDFTNG
Sbjct: 181  MQKTQEQLLKTQRIPQNSRDNHNQTNIINESFGSVPFTFTQKIKNFETNITNENDDFTNG 240

Query: 241  SKSQTVLISTNVDNVRAEYVDASSSLLQATAIAATVRDDGPSSTALVGTVADDKLSSGSN 300
            SKSQTVLISTNVDNVRAEYVDASSSLLQATAIAATVRDDGPSSTALVGTVADDKLSSGSN
Sbjct: 241  SKSQTVLISTNVDNVRAEYVDASSSLLQATAIAATVRDDGPSSTALVGTVADDKLSSGSN 300

Query: 301  LAIHKFQKXXXXXXQLANNSKYKEYKGISKPILTNIVKFTKDSFLQGFDNXXXXXXXXXG 360
            LAIHKFQK      QLANNSKYKEYKGISKPILTNIVKFTKDSFLQGFDN         G
Sbjct: 301  LAIHKFQKELEEEEQLANNSKYKEYKGISKPILTNIVKFTKDSFLQGFDNSSSSSSEEEG 360

Query: 361  DKVKETKRNGKEXXXXXXXXXXXXXXXXXXDGXXXXXXXXXXXXXXXLNTLSRYENKLKT 420
            DKVKETKRNGKE                  DG               LNTLSRYENKLKT
Sbjct: 361  DKVKETKRNGKENTSSNSYSTKNNNSTASSDGTTIKPKIKSPKKFSKLNTLSRYENKLKT 420

Query: 421  VLNSKNQLQLGXXXXXXXXXXXXLPVSRTSKATILTIKARLSKQKSKKNVQKDGTVNTNL 480
            VLNSKNQLQLG            LPVSRTSKATILTIKARLSKQKSKKNVQKDGTVNTNL
Sbjct: 421  VLNSKNQLQLGSDDESSDDTENSLPVSRTSKATILTIKARLSKQKSKKNVQKDGTVNTNL 480

Query: 481  NKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQEIKRNQKIRQREKE 540
            NKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQEIKRNQKIRQREKE
Sbjct: 481  NKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQEIKRNQKIRQREKE 540

Query: 541  REXXXXXXXXXXXXXXXXXEFDLSANEQEEQESDAELSDVSKPDIDEEVVYQRRNIDEDG 600
            RE                 EFDLSANEQEEQESDAELSDVSKPDIDEEVVYQRRNIDEDG
Sbjct: 541  REDKKNNANDSDSVNDSDVEFDLSANEQEEQESDAELSDVSKPDIDEEVVYQRRNIDEDG 600

Query: 601  IQXXXXXXXXXXXXXXXXXPLQLSKRSNGVTAKIISVSEDDEDTISKRNAIDLGAYGDNL 660
            IQ                 PLQLSKRSNGVTAKIISVSEDDEDTISKRNAIDLGAYGDNL
Sbjct: 601  IQDEDVLDNVDADEEEEEAPLQLSKRSNGVTAKIISVSEDDEDTISKRNAIDLGAYGDNL 660

Query: 661  TTANVKSQXXXXXXXXXXXXXXXXTQPLELTEQERIDIIEAEKTKIXXXXXXXXXXXXXX 720
            TTANVKSQ                TQPLELTEQERIDIIEAEKTKI              
Sbjct: 661  TTANVKSQDDDDLEVDDDKNENLDTQPLELTEQERIDIIEAEKTKIKMQQEKMRHKEKEM 720

Query: 721  XXXGVTKFFXXXXXXXXXXWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLA 780
               GVTKFF          WHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLA
Sbjct: 721  MKKGVTKFFEMEAEESEDEWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLA 780

Query: 781  AENKEMDLNMINKILYDIXXXXXXXXXXXXXXXXXXXXXXXXXXREYHXXXXXXXXXXXX 840
            AENKEMDLNMINKILYDI                          REYH            
Sbjct: 781  AENKEMDLNMINKILYDIKNGGFRKRKRGGLELELSEDEDDDALREYHLKRKELMRKRRL 840

Query: 841  XXGDDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAAV 900
              GDDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAAV
Sbjct: 841  ELGDDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAAV 900

Query: 901  VKENGDSXXXXXXXXXXSEEFVQRTLSFLKSSREDEEFAMNENLAKEQHGTKVENLLSLK 960
            VKENGDS          SEEFVQRTLSFLKSSREDEEFAMNENLAKEQHGTKVENLLSLK
Sbjct: 901  VKENGDSKRIKKKKTIISEEFVQRTLSFLKSSREDEEFAMNENLAKEQHGTKVENLLSLK 960

Query: 961  QQSSIKVFQSPSNNSSKVIKLXXXXXXXXXXXXSPIALFKVPSILKSFGSKTDINEKFQD 1020
            QQSSIKVFQSPSNNSSKVIKL            SPIALFKVPSILKSFGSKTDINEKFQD
Sbjct: 961  QQSSIKVFQSPSNNSSKVIKLDDINNDDDDDEDSPIALFKVPSILKSFGSKTDINEKFQD 1020

Query: 1021 GNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTHSKMKPLRSRVTDNNKITKGERNIGS 1080
            GNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTHSKMKPLRSRVTDNNKITKGERNIGS
Sbjct: 1021 GNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTHSKMKPLRSRVTDNNKITKGERNIGS 1080

Query: 1081 LFSTGDDSFEN 1091
            LFSTGDDSFEN
Sbjct: 1081 LFSTGDDSFEN 1091

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  530 bits (1366), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 429/1145 (37%), Positives = 565/1145 (49%), Gaps = 180/1145 (15%)

Query: 1    MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60
            M+S+ ++     K RKTTY K   +P+ +E+     LT+      + P ++G GF+F N+
Sbjct: 1    MESIFEEFSLPKKQRKTTYKKIHEEPNNDEE----ALTEAVDV--MAPPVIGNGFIFGNA 54

Query: 61   TIDKVRARLSGKNYIEQEKTPLASSEQETQIITNLYTNGEDLEKDLIKHIPVSQTQPITN 120
             IDK+R RL GK    +E TP+ +   +TQ+I NLY           K     + + I  
Sbjct: 55   LIDKIRNRLDGKE--NKEDTPVPT---QTQMIDNLY-----------KDAEELEEETIEY 98

Query: 121  TGERTQLEQEIKVTIDNDSNEMPTQVIGSTERDDETAERTQIGEVATQLIPGDTYDRTST 180
              E    EQE+          + TQ+I          E+ +I  +     P D Y     
Sbjct: 99   EKEAINKEQEV----------VQTQLIA--------KEKEEIENIKN---PSDAY----- 132

Query: 181  MQKTQEQLLKTQRIPQNSRDNHNQTNIINESFGS------------VPFTFTQKIKNFET 228
            +Q+TQ    K+  +  N      +T +IN                 +PFTFTQKI++F  
Sbjct: 133  LQETQPIEEKSFLLGTNKELETQETQVINPVLSESQPSENRSSNEKIPFTFTQKIQDFVE 192

Query: 229  NITNENDDFTNGSKSQTVLIST---NVDNVRAEYVDASSSLLQAT--------------- 270
             + N + D +  SK +T+ I+      DN  ++     S  LQ T               
Sbjct: 193  TVENYSTDLS-LSKDETITINLPNHATDNSTSKRAHRISQELQRTMTDMDTQVINNTNLD 251

Query: 271  AIAATVRDDGPSSTALVGTVADDKLSSGSNLAIHKFQKXXXXXXQLANNSKYKEYKGISK 330
             I AT+ D  P+      TVAD      + L IH+ QK         N+ + KEYK  SK
Sbjct: 252  VIEATMAD-LPNLNEPQSTVAD---IPSTGLKIHEIQKELERER---NSKELKEYKKPSK 304

Query: 331  PILTNIVKFTKDSFLQGFDNXXXXXXXXXGDKVKETKRNGKEXXXXXXXXXXXXXXXXXX 390
             I    +KF+K S L GFDN            +K T+   K                   
Sbjct: 305  EIKVIPIKFSKTSLLDGFDNSSSDDELEVQKDMKITRTKEK------------------- 345

Query: 391  DGXXXXXXXXXXXXXXXLNTLSRYENKLKTVLNSKNQLQLGXXXXXXXXXXXXLPVSRTS 450
                             L  L+ YENKLK  L  K  +QL              P+SRTS
Sbjct: 346  ----PESSIKPKIKPKKLTGLNTYENKLKKKLLEKKHIQLDSDSDNDSDIAKRFPISRTS 401

Query: 451  KATILTIKARLSKQKSKKNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNF 510
            KAT+L +KARLSK   KK V+ + + NT+L+ LF+NLK++SRKQIL++QREL+EN+G   
Sbjct: 402  KATLLNLKARLSK---KKPVKSNKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGFKL 458

Query: 511  EDIEMEKELVENLLEQEIKRNQKIRQREKEREXXXXXXXXXXXXXXXXXEFDLSANEQEE 570
            EDIE EKE+VENLLE+EIKRN++IR REK++E                 +FDLSANE E+
Sbjct: 459  EDIEKEKEIVENLLEEEIKRNKRIRMREKQKEKSLSENEDA--------DFDLSANELED 510

Query: 571  QESDA--ELSDVSKPDIDEEVVYQRRNI--------DEDG-----IQXXXXXXXXXXXXX 615
            +E D   +  +++   I +E      ++        DE+G                    
Sbjct: 511  EEEDGVNDSDNIANSQISDEEDEDSDSVLDNGNHVADEEGDANREADNSSISSKNEISDE 570

Query: 616  XXXXPLQLSKRSNGVTAKIISVSEDDEDTISKRNAIDLGAYGDNLTTANVKSQXXXXXXX 675
                  QL+++      +II  S DDE+ I+K N IDLG YG NL   N  S        
Sbjct: 571  DEDSIFQLTRKEKH-PVRIIQES-DDENEINKINTIDLGVYGGNLDNPNPLSSQTEPNED 628

Query: 676  XXXXXXXXXTQPLELTEQERIDIIEAEKTKIXXXXXXXXXXXXXXXXXGVTKFFXXXXXX 735
                      +  E+TE+ER  +I AEK +I                 GV K F      
Sbjct: 629  DEDEKSTYENK--EITEEERHALILAEKKRIQLIEKKNAARTKEMKKKGVNKLFEMEAEE 686

Query: 736  XXXXWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKIL 795
                WHGIGG DGE+SDEYDS+VEKMIDDYSK+NF+P+EIR+MLA ENKEMDLNMI KIL
Sbjct: 687  SEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQMLALENKEMDLNMITKIL 746

Query: 796  YDIX-XXXXXXXXXXXXXXXXXXXXXXXXXREYHXXXXXXXXXXXXXXGDDEKKLVKNPK 854
            YDI                           REYH              GDD KKL+KNPK
Sbjct: 747  YDIKNGGFRKRRRGGLDLELSDDDEDDEELREYHKRKRELMKKRMLEIGDD-KKLIKNPK 805

Query: 855  SKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAAVVKENGDSXXXXXXX 914
            SKAFFESMVEDI D+KNAF     G+  + E ++T+ D +EE     KE   +       
Sbjct: 806  SKAFFESMVEDIVDEKNAF-----GDIESIEKSSTELDTQEE-----KEQDVTPGVDKKK 855

Query: 915  XXXSEEFVQRTLSFLKSSREDEEFAMNENLAKEQHGTKVENLLSLKQQSSIKVFQSPSNN 974
               SEEFVQ+TLSFL+S R+ EEF + E+LAKEQHG  VE+L SLKQ+S+IK F++PS  
Sbjct: 856  NVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFSLKQRSTIKEFRNPSQT 915

Query: 975  SSKVIKLXXXXXXXXXXXXSPIALFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYRTV 1034
            ++  I L            SP+  FK PS++KSF S+TDINEKF+DGNKTVTISK Y+TV
Sbjct: 916  NT--IDL---INNVENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNKTVTISKVYKTV 970

Query: 1035 GSSKASITYLGKSRKLMAPTH--------SKMKPLRSRVTDNNKITKGERNIGSLFSTGD 1086
            GSSKASITYLGKSRKLM P          SK+KP RS                SLFS+ D
Sbjct: 971  GSSKASITYLGKSRKLMPPKKNKNREKIGSKIKPTRS----------------SLFSSHD 1014

Query: 1087 DSFEN 1091
            +SFEN
Sbjct: 1015 ESFEN 1019

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  403 bits (1036), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 368/1132 (32%), Positives = 526/1132 (46%), Gaps = 132/1132 (11%)

Query: 1    MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60
            MD +  +L+ +   ++TTY K S          D +  D +   N  P + G GFLF N 
Sbjct: 1    MDGIFGNLQALKPKKRTTYKKIS----------DDLENDTSESNNDPPALTGEGFLFDNP 50

Query: 61   TIDKVRARLSGKNYIEQEKTPLASSEQETQIITNLYTNGEDLEKDLI-----KHIPVSQT 115
            T+++++ RL G+   E++      +  +TQ+I+NLY  GEDL+   +     + +   Q 
Sbjct: 51   TLNRIKKRLDGE---EKDVVQYTMNFSQTQLISNLYGGGEDLDAPEVERREKQQLHEQQL 107

Query: 116  QPITNTGERTQLEQEIKVTID-NDSNEM-PTQVIGSTERDDE--TAERTQIGEV-----A 166
            +       + QL    K + + ND   M PTQVIGST+   E     RT    V     +
Sbjct: 108  ELTKKRASKGQLHAFTKSSGNINDLRLMQPTQVIGSTQLAKEFSPVSRTYFKYVPDVNQS 167

Query: 167  TQLIPGDTYDRTSTM----------QKTQEQLLKTQRIPQNSRDNHNQTNIINESFGSVP 216
            TQ+I   T D T  +          Q TQ     TQ I      N  +T  I +S  + P
Sbjct: 168  TQVIHSATQDDTQVVSAREADTQATQMTQVLSASTQGIY-----NTQETQSITDS--TQP 220

Query: 217  FTFTQKIKNFETNITNENDDFTNGSKSQTVLISTNVDNVRAEYVDASSSLL--------Q 268
             +++   ++++TN  N +      +   T +I    D+      DAS+  +         
Sbjct: 221  ISYSSSTQDYKTNKFNRH-----PTPEDTQIIPREFDD------DASTLPIPEGDKTQKD 269

Query: 269  ATAIAATVRDDGPSSTALVGTVADDKLSSGSNLAIHKFQKXXXXXXQLANNSKYKEYKGI 328
             +A+  T  D     T+   TV+D        L IH+ Q+      +     +YK++   
Sbjct: 270  TSAVLKTQIDSTTEGTSYSATVSD-------TLKIHEIQRELEESQKTKTIPEYKQHVRT 322

Query: 329  SKPILTNIVKFTKDSFLQGFDNXXXXXXXXXGDKVKETKRNGKEXXXXXXXXXXXXXXXX 388
             K    N++ FTK+S+   FD+          D+ KE     +                 
Sbjct: 323  PK----NVIVFTKESYFDEFDSD---------DEEKEENLESEGDSQKVQLLKNTSPSDK 369

Query: 389  XXDGXXXXXXXXXXXX-XXXLNTLSRYENKLKTVLNSKNQLQLGXXXXXXX---XXXXXL 444
              DG                L+ L+ YE KLK  LNS  Q+ L                 
Sbjct: 370  SNDGKRLPDKTRTSPSFKPKLHGLNNYELKLKRQLNSDQQIDLNLDSDDEDGIDRMGEKG 429

Query: 445  PVSRTSKATILTIKARLSKQKSKKNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIE 504
            P+S+ SKAT+  IKARLSK++    +  D    T L+ LF  L+K+SR+QI+E+Q+E+IE
Sbjct: 430  PISQMSKATVFDIKARLSKKRPIVKISNDS--KTTLHTLFNKLQKASRQQIIEHQKEVIE 487

Query: 505  NKGLNFEDIEMEKELVENLLEQEIKRNQKIRQREKEREXXXXXXXXXXXXXXXXXEFDLS 564
             KGLN EDIE EK++VENLLEQEI RN+KIRQREKERE                 +FD S
Sbjct: 488  KKGLNLEDIEKEKKIVENLLEQEINRNKKIRQREKEREKQLADAQDDENDL----DFDHS 543

Query: 565  ANEQEEQESDAELSDV-SKPDIDEEVVYQRRNIDEDGIQXXXXXXXXXXXXXXXXXPLQL 623
            ANE +E E   E S + S  D D+  + + +   +  I                   ++ 
Sbjct: 544  ANELDESELSGEESAIDSDNDYDDFSLEKTKRSKKKVI------------VEDSDTEIED 591

Query: 624  SKRSNGVTAKIISVSEDDEDTISKRNAIDLGAYGDNLTTANVK-SQXXXXXXXXXXXXXX 682
             K S+    +     E D+     RNAI+LG YGDNL+ A ++ +               
Sbjct: 592  EKMSHNAQIR----EEKDDSLFQNRNAINLGPYGDNLSLAPIRITTEKQSGKNFKVSRES 647

Query: 683  XXTQPLELTEQERIDIIEAEKTKIXXXXXXXXXXXXXXXXXGVTKFFXXXXXXXXXXWHG 742
               +  E+ E++RI +IE +K                    G+T F           WHG
Sbjct: 648  GDERDEEIPEKDRIRLIEEKKQHELERQRKQMKKRKEMKAKGITNFLEEEAEESEDEWHG 707

Query: 743  IGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKILYDIXXXX 802
            IGGIDGEMSDEYDS+VEKMIDDYSKANF+P+EIR+MLA ENKE D+ M+ KILYDI    
Sbjct: 708  IGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDI-KNG 766

Query: 803  XXXXXXXXXXXXXXXXXXXXXXREYHXXXXXXXXXXXXXXGDDEKKLVKNPKSKAFFESM 862
                                  ++Y               G+ E  LVKNPKSKAFFESM
Sbjct: 767  GFRKRRKGAMDLELSDEEDDELKQYRLKRRELMRQKRLEVGEAE-TLVKNPKSKAFFESM 825

Query: 863  VEDITDDKNAFND-EPLGETSTQEINNTQDDMKEEDAAVVKENGDSXXXXXXXXXXSEEF 921
            V+DI + KN F   EP    +      T DD  +E+A      G +          SEEF
Sbjct: 826  VDDIVEVKNPFAVFEPQRSGTI-----TTDDGTQENAN--SNEGAASQNPSKKVMLSEEF 878

Query: 922  VQRTLSFLKSSREDEEFAMNENLAKEQHGTKVENLLSLKQQSSIKVFQSPSNNSSKVIKL 981
            VQRTLSFL SS++ ++FA   ++  E +   +E+L +LK+QSSIK F++     + V + 
Sbjct: 879  VQRTLSFLNSSKDMDQFAPARSMRAEANDELIEDLTALKKQSSIKSFKT---TRASVSQE 935

Query: 982  XXXXXXXXXXXXSPIALFKV--PSILKSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKA 1039
                          +   +V   SI+K+F +  DIN+KFQ+G KTV +SK+Y++V SSKA
Sbjct: 936  PTDFDKENDDSFDDLLNSRVGTSSIMKTFSATVDINDKFQEGVKTVKVSKAYKSVSSSKA 995

Query: 1040 SITYLGKSRKLMAPTHSKMKPLRSRVTDNNKITKGERNIGSLFSTGDDSFEN 1091
            SITY+GK RKL+AP         S + + N  T        LFS  D+SFE+
Sbjct: 996  SITYMGKMRKLVAPQKKVANLSSSDIKNTNSRT------SKLFSRQDESFES 1041

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  356 bits (914), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 274/696 (39%), Positives = 355/696 (51%), Gaps = 78/696 (11%)

Query: 444  LPVSRTSKATILTIKARLSKQKSK----KNVQKDGTVNTNLNKLFENLKKSSRKQILENQ 499
            LP+S+ SKATIL +KARLSKQ  K     N  KD  V+ N+  L   L+K+SRKQIL++Q
Sbjct: 431  LPISQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNV--LLNTLRKASRKQILDHQ 488

Query: 500  RELIENKGLNFEDIEMEKELVENLLEQEIKRNQKIRQREKEREXXXX------XXXXXXX 553
            +E+IE KGL  ED+  EKE+VENLLEQEI RN++IRQ+EK RE                 
Sbjct: 489  KEVIETKGLKLEDMAKEKEIVENLLEQEILRNKRIRQKEKRREKLEENDFQLNAHDSGSD 548

Query: 554  XXXXXXEFDLSANEQEEQESDA------ELSDVSKPDIDEEVVYQRRNIDEDGIQXXXXX 607
                   F LS NE  + ES          SD  K D DE ++ Q+++     I      
Sbjct: 549  SGSESSGFALSGNEIADYESSGSENDNRRESDSEKED-DEIILKQKKSHHVKHI------ 601

Query: 608  XXXXXXXXXXXXPLQLSKRSNGVTAKIISVSEDDEDTISKRNAIDLGAYGDNLTTANVKS 667
                         +  S     V AK     E  ++++ KR AI+LG YGDN+     K 
Sbjct: 602  -------------INESDSDTEVEAK---PKEKADESLPKRIAINLGHYGDNIGEDTDKF 645

Query: 668  QXXXXXXXXXXXXXXXXTQPLE------------LTEQERIDIIEAEKTKIXXXXXXXXX 715
            Q                   +E              E  R  +I+ EK ++         
Sbjct: 646  QETNVLDTQNIEEVMAERNTIENEVKDDVYVNEEADEAIRRQLIDKEKLQLKQKEKEHEA 705

Query: 716  XXXXXXXXGVTKFFXXXXXXXXXXWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEI 775
                    GVT FF          WHGIGG DGE SD+YDSD+EKMIDDYSK NF+P+EI
Sbjct: 706  KIKELKKRGVTNFFEMEAEESEDEWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEI 765

Query: 776  REMLAAENKEMDLNMINKILYDIXXXX-XXXXXXXXXXXXXXXXXXXXXXREYHXXXXXX 834
            REMLAAENKEMD+ MINKILYDI                           ++Y       
Sbjct: 766  REMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNSLELELSDDDEDDVLQQYRLKRREL 825

Query: 835  XXXXXXXXGDDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMK 894
                    GDD  KLVKNPKS AFFESMVEDI + KN F  E   E    +I +T  D+ 
Sbjct: 826  MRKRRLEIGDD-AKLVKNPKSSAFFESMVEDIIEYKNPFGAE---EEYNLDITSTATDLD 881

Query: 895  EEDAAV-VKEN-GDSXXXXXXXXXX----SEEFVQRTLSFLKSSREDEEFAMNENLAKEQ 948
             +D ++ V +N G++              SE+FVQ++LSFLKS+   E+F  ++ L++ Q
Sbjct: 882  TQDNSINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSNNY-EDFETDKELSRIQ 940

Query: 949  HGT--KVENLLSLKQQSSIKVFQSPSNNS--SKVI-------KLXXXXXXXXXXXXSPIA 997
            HG    +E+L +LKQ SSIK F +   +S  SK +       K             S + 
Sbjct: 941  HGNDEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVG 1000

Query: 998  LFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTHSK 1057
            +FK PSI+KSF S+TDIN+KF++GNKTV I KSY+TVGSSKASITY+GK+RKL+AP    
Sbjct: 1001 VFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKRKT 1060

Query: 1058 MKPLRSRVTDNNKITKGERNIGS--LFSTGDDSFEN 1091
                R     +NK  K +    S  LF +G DSF+N
Sbjct: 1061 EGSHRYHHDHHNKKMKMKTKTKSNKLFESGQDSFDN 1096

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 97/367 (26%), Positives = 154/367 (41%), Gaps = 57/367 (15%)

Query: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVT-----PTILGTGF 55
           MD  +  L  +T  ++TT  KK   P ++E        D T+G         P + G GF
Sbjct: 1   MDDALHALSSLTAKKRTTTYKKVAVPILDE-------NDNTNGNGPNDIDNPPELTGNGF 53

Query: 56  LFKNSTIDKVRARLSGKNYIEQEKT---PLASSEQETQIITNLYTNGEDLEKDLIKHIPV 112
           LF N+T+++V+ RL GK   EQ        + +   TQ+I+NLY  GE+LEK  +K    
Sbjct: 54  LFANATLNRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSY 113

Query: 113 S---------QTQPITNTGERTQLEQEIKVTIDNDSNEMPTQVIGSTERDDETAERTQIG 163
           S         QTQ I  +    Q ++   V I + ++  PTQ+I      +ET++   + 
Sbjct: 114 SEKNVSSSFTQTQRIPVS---IQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQ--ALK 168

Query: 164 EVATQLIPGDTYDRTSTMQKTQEQLLKTQRIPQNS--RDNHNQTNIINESFGSVPFTFTQ 221
              T   PG T    S+   +Q Q +K+   PQ+     + N +N ++     +P     
Sbjct: 169 TPLTTGRPGATQRIDSSGATSQTQPIKSIE-PQSQIITTSSNHSNALSPKIPIIPTELIG 227

Query: 222 KIKNFETNITNENDDFTNGSKSQTVLISTNVDNVRAEYVDASSSLLQATAI---AATVRD 278
               F++ I N   D       QT   + + D  +A  +  ++   Q T I   A T++D
Sbjct: 228 TSPLFQS-IQNRGPDTQMDVPPQT---AHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQD 283

Query: 279 DGPSSTALVGTVADDKLSSGSNLAIHKFQKXXXXXXQLANNSKYKEYKGISKPILTNIVK 338
           + P +                 L I + Q            ++  EYK   KPI T    
Sbjct: 284 EVPHT-----------------LKIREIQSELASEDSKREKARNVEYKKPQKPIPTKKF- 325

Query: 339 FTKDSFL 345
           F+K+SFL
Sbjct: 326 FSKESFL 332

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  336 bits (862), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 267/698 (38%), Positives = 347/698 (49%), Gaps = 83/698 (11%)

Query: 444  LPVSRTSKATILTIKARLSKQK---SKKNVQ-KDGTVNTNLNKLFENLKKSSRKQILENQ 499
            LP+S+ SKATIL +KARLSKQ    S++ ++ +D  ++ N  KLF  L+K+SRKQIL++Q
Sbjct: 447  LPISQLSKATILNLKARLSKQNQDISQRPLEGRDARLDHN--KLFNTLRKASRKQILDHQ 504

Query: 500  RELIENKGLNFEDIEMEKELVENLLEQE------IKRNQKIRQREKEREXXXXXXXXXXX 553
            RE+IE KG   ED+  EKELVENLLEQE      I++ +K R++ +  E           
Sbjct: 505  REVIETKGFKLEDMVKEKELVENLLEQEIIRNKKIRQKEKRREKLENSEFKLSPHDSGSD 564

Query: 554  XXXXXXEFDLSANEQEEQESDAELSDVSKPDIDEEVVYQRRNIDEDGIQXXXXXXXXXXX 613
                  +F LS NE     +D ELS       ++E+   R   D +  +           
Sbjct: 565  SGSESSKFALSGNEV----TDYELSGS-----EDEI---REEPDNEEEEEEDDIVPKKKK 612

Query: 614  XXXXXXPLQLSKRSNGVTAKIISVSEDDEDTISKRNAIDLGAYGDNLTTANVKSQXXXXX 673
                   +  S   N    K     E  + ++ KR AI+LG YGDN+     K Q     
Sbjct: 613  AHHVKRMIDESDSENEAVPK-----EKVDASVPKRIAINLGHYGDNIEEEVNKFQETNDM 667

Query: 674  XXXXXXXXXXXTQPLE-------------------LTEQERIDIIEAEKTKIXXXXXXXX 714
                          +E                     E  R ++I+ EK ++        
Sbjct: 668  NTQQTDKITMERNIVENKAILEDTAVVDEDNINEEADEAIRRELIDKEKLQLRQKELEKA 727

Query: 715  XXXXXXXXXGVTKFFXXXXXXXXXXWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNE 774
                     GVT FF          WHGIGG DGE SDEYDSDVEKMIDDYSK NF+ +E
Sbjct: 728  IKLKELKHKGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHE 787

Query: 775  IREMLAAENKEMDLNMINKILYDIXXXXXXXXXXXXXXXXXXXXXXXXXXREYHXXXXXX 834
            IREMLAAENKEMD+ MINKILYDI                          ++Y       
Sbjct: 788  IREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRREL 847

Query: 835  XXXXXXXXGDDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMK 894
                    GD   KLVKNPKSKAFFESMVEDI + KN F  E   E S Q+I +T  D+ 
Sbjct: 848  MRKRRLEIGDG-TKLVKNPKSKAFFESMVEDIMEYKNPFRAE---EESNQDITSTATDLD 903

Query: 895  E--------EDAAVVKENGDSXXXXXXXXXXSEEFVQRTLSFLKSSREDEEFAMNENLAK 946
                      D+    E G            SE+FVQ++LSFLKS+  + EF M++ LAK
Sbjct: 904  TLDNNSLNVRDSTRNNEKG-PVDDKSKKIIISEDFVQKSLSFLKSNNYN-EFEMDKELAK 961

Query: 947  EQHGT---KVENLLSLKQQSSIKVFQSPSNNS--SKVI-------KLXXXXXXXXXXXXS 994
             QHG     +E+L +LKQ SSIK F +   +S  S+ +       K             S
Sbjct: 962  MQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSS 1021

Query: 995  PIALFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAPT 1054
             ++ FK PSI+KSF S+TDIN+KF++GNKTV ISKSY+ VGSSKASITY+GK+RKLMAP 
Sbjct: 1022 LVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPK 1081

Query: 1055 HSKMKPLRSRVTDNN--KITKGERNIGSLFSTGDDSFE 1090
                   R   TD N  +  K +     LF +G +SF+
Sbjct: 1082 -------RKAGTDQNHHRHKKTKTKTSKLFESGQNSFD 1112

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 91/197 (46%), Gaps = 35/197 (17%)

Query: 1   MDSLIDDLKPV-TKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKN 59
           MD  ++ L  + +K R TTY K ++    +    DG L   T+     P + G GFLF N
Sbjct: 1   MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNL--YTNDIVAPPALTGNGFLFAN 58

Query: 60  STIDKVRARLSGKNYIEQEKTPLASSEQE---TQIITNLYTNGEDLE-----------KD 105
           +T+++V+ RL G    EQE       +++   +Q+I NLY  GEDLE           K+
Sbjct: 59  ATLNRVKNRLEGGKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNENDCTGKN 118

Query: 106 LIKHIPVSQTQPITNTGERTQLEQEIKVTIDNDSNEMPTQVIGSTERDDETAER------ 159
            +     +Q  P++      Q ++ + V I + + E PTQ+I    +DD    +      
Sbjct: 119 CMPTFTQTQRIPVS-----IQQDKVVDVPIHSVNEEKPTQII----KDDCFVNKIPQAQK 169

Query: 160 ---TQIGEVATQLIPGD 173
              T I  VATQ I  D
Sbjct: 170 LSTTTIKPVATQRIDSD 186

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 960

 Score =  304 bits (779), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 327/1120 (29%), Positives = 490/1120 (43%), Gaps = 191/1120 (17%)

Query: 1    MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60
            MDSL++ L P++  R+TTY K      + E +E+     +++     P ILG GFLF+NS
Sbjct: 1    MDSLLEKLDPLSSKRRTTYKK------VFEPQEEEETQQISNSP--PPPILGNGFLFQNS 52

Query: 61   TIDKVRARL----SGKNYIEQEKTPLASSEQ----ETQIITNLYTNGEDLE---KDLIKH 109
            TIDKVR RL     G N ++Q++      ++    +TQ+I +LY   E+LE   K+ ++ 
Sbjct: 53   TIDKVRNRLRNAEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEGAEELEEQNKERVR- 111

Query: 110  IPVSQTQPITNTGERTQLEQEIKVTIDNDSNEMP-TQVIGSTERDDETAERTQIGEVATQ 168
            +P+S+ +  + + E+TQ+              +P    +   E + E    T I E  TQ
Sbjct: 112  LPLSK-KTSSASQEKTQV--------------IPWAPTVEGVENNVEQG--TDIHEEKTQ 154

Query: 169  LIPGD-TYDRTSTMQKTQEQLLKTQRIPQNSRDNHNQTNIINESFGSVPF-TFTQKIKNF 226
             +P + +YD+            KTQ I               +SF        TQ+I   
Sbjct: 155  QVPNEISYDQ------------KTQAI---------------QSFQQTEVEPLTQRISEP 187

Query: 227  ETNITNENDDFTNGSKSQTVLISTNVDNVRAEYVDASSSLLQATAIAATVRDDGPSSTAL 286
            E  +    D  T  + S+  L +   + +    +D S+SLL                   
Sbjct: 188  ERTL----DVPTYAATSEDQLDTQEQNPITQ--LDISNSLL------------------F 223

Query: 287  VGTVADDKLSSGSNLAIHKFQKXXXXXXQLANNSKYKEYKGISKPILTNIVKFTKDSFLQ 346
              T +D   S    L +H  +K      Q  ++ +  EY+   KP+    V F+K++FL+
Sbjct: 224  QATDSDIPKSPPQRLKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRV-FSKEAFLK 282

Query: 347  GFDNXXXXXXXXXGDKVKETKRNGKEXXXXXXXXXXXXXXXXXXDGXXXXXXXXXXXXXX 406
             FD            + ++ ++   E                                  
Sbjct: 283  NFDEESSSEDELIELRSRDIEKKHTEKDKSTLENTTESSQRQR----------------- 325

Query: 407  XLNTLSRYENKLKTVLNSKNQLQLGXXXXXXXXXXXXLPVSRTSKATILTIKARLSKQKS 466
                 S YE KLK  L+SK  +QL              P+SR SKAT+L IKAR SKQ+ 
Sbjct: 326  ---VFSVYEYKLKGELDSKRCIQLDDDEDESDEDVEV-PLSRVSKATVLDIKARRSKQEP 381

Query: 467  KKNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQ 526
               +++  T    LN L   LKK+S+KQI ++Q EL++++G   EDIE +KE +ENLLEQ
Sbjct: 382  LSKIKQKKTT---LNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQ 438

Query: 527  EIKRNQKIRQREKEREXXXXXXXXXXXXXXXXXEFDLSANEQEEQESDAELSDVSKPDI- 585
            EI RN+++ +RE E +                 E + SA    E   D+E  D  + D+ 
Sbjct: 439  EIARNKRLARRENEEDNSNDLEDRSYGSGN---ESENSAFSDIEFSGDSESDDGQEDDMN 495

Query: 586  -DEEVVYQRRNIDEDGIQXXXXXXXXXXXXXXXXXPLQLSKRSNGVTAKIISVSEDDEDT 644
             D+E V Q+  + E G                    +Q  +  N           + +DT
Sbjct: 496  NDDERV-QKEKMQEAG-DSDNISAREDHSDEEDEDSIQKGRTKNHKMLPAEDSDSEHDDT 553

Query: 645  ISKRNAIDLGAYGDNLTTANVKSQXXXXXXXXXXXXXXXXTQPLELTEQERIDIIEAEKT 704
            +  RN IDLG YG+NL   +                     + L L++   ID  E EKT
Sbjct: 554  LP-RNIIDLGPYGNNLQVNH-----------------EEDMENLPLSDSAEIDAAEEEKT 595

Query: 705  ---------KIXXXXXXXXXXXXXXXXXGVTKFFXXXXXXXXXXWHGIGGIDGEMSDEYD 755
                     KI                 G+ K            W G+GG+DG++SDE+D
Sbjct: 596  NELIMEKIRKIEMRKKKKEQRLKDMKAKGLNKMLEMEAEESEDEWKGVGGVDGDLSDEHD 655

Query: 756  SDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKILYDIXXXXXXXXXXXXXXXXX 815
            SD+E+MIDD++K+N + +++R++LA ENKE+D  M+NKILYDI                 
Sbjct: 656  SDLEEMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDI-KNGGFRKRGRNALDLE 714

Query: 816  XXXXXXXXXREYHXXXXXXXXXXXXXXGDDEKKLVKNPKSKAFFESMVEDITDDKNAFND 875
                     R Y               G D++K  +N KSKAF ESMV+DI + KN    
Sbjct: 715  LSDDEDEDLRNYR-LKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKN---- 769

Query: 876  EPLGETSTQEINNTQDDMKEEDAAVVKENGDSXXXXXXXXXXSEEFVQRTLSFLKSSRED 935
             P G+      +NT  D +E D    KE              S+EFVQR+LSFL ++   
Sbjct: 770  -PFGDPEMDVEDNTDVDTQENDYPKNKEKN----------TLSQEFVQRSLSFLSNNNSS 818

Query: 936  EEFAMNENLAKEQHGTKVENLLSLKQQSSIKVFQSPSNNSSKVIKLXXXXXXXXXXXXSP 995
             EF + E +     G + +++ SLK+ SSI       +NSS  IK             + 
Sbjct: 819  REFELGEQIT---LGDEEQDVSSLKRNSSIHAL----HNSSSPIKEDLEKENQDEDFIT- 870

Query: 996  IALFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTH 1055
            +  FK PS++KS     D N KFQ G KTVT+SKSYR VG S++SITY GK RKL+ P +
Sbjct: 871  LPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKN 930

Query: 1056 SKMKPLRSRVTDNNKITKGER-----NIGSLFSTGDDSFE 1090
                        N+ ++KG R      +G L+ +  +SF+
Sbjct: 931  R-----------NSTLSKGPRPASKPTMGKLWESQQNSFD 959

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
            YCL061C
          Length = 965

 Score =  282 bits (721), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 230/665 (34%), Positives = 324/665 (48%), Gaps = 57/665 (8%)

Query: 408  LNTLSRYENKLKTVLNSKNQLQLGXXXXXXXXXXXXLPVSRTSKATILTIKARLSKQKSK 467
            +N L  YE+ L+   N++   Q+             +  S  SKA IL I+A  SKQ+ K
Sbjct: 320  INGLGNYEHNLRRKANNE---QIIEFSESDEDSDTNISPSYASKAVILNIRANKSKQQPK 376

Query: 468  KNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQE 527
             + + D T    L  L+ NLK++S++QI+  Q+EL+E KG+N E++E E E+VENLLEQE
Sbjct: 377  VSQKSDQTT---LLMLYNNLKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQE 433

Query: 528  IKRNQKIRQREKEREXXXXXXXXXXXXXXXXXEFDLSANEQEEQESDAELSDVSKPDIDE 587
            I RNQKIRQREK+++                 EFDLSANE E+  SD   SD ++ + + 
Sbjct: 434  IARNQKIRQREKQKQKKENQDDLNSNPE----EFDLSANELED--SDIPGSDFAESNNNS 487

Query: 588  EVVYQRRNIDEDGIQXXXXXXXXXXXXXXXXXPLQLSKRSNGVTAKI------ISVSEDD 641
            E   +      D  +                    + KR +  T  +      I     D
Sbjct: 488  EKDDEEEE--NDEEEEDEQEDAPKSTVDEEDEGFAIGKRKHKKTEIVDDSDSEIEAQIVD 545

Query: 642  EDTISKRNAIDLGAYGDNLTTANVKSQXXXXXXXXXXXXXXXXTQPLELTEQERIDIIEA 701
               I   N IDLG YGDN+   + ++                      + +Q+ ++  EA
Sbjct: 546  SKEIITANTIDLGHYGDNIIQQSRETLNETEESDEEDEERYNAIISEGIRKQKELEKREA 605

Query: 702  EKTKIXXXXXXXXXXXXXXXXXGVTKFFXXXXXXXXXXWHGIGGIDGEMSDEYDSDVEKM 761
            ++ K                  GV+K F          WHGIGG+D + SD YDS+VEKM
Sbjct: 606  KRLK-------------EMKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKM 652

Query: 762  IDDYSKANFDPNEIREMLAAENKEMDLNMINKILYDIXXXXXXXXXXXXXXXXXXXXXXX 821
            IDDYS+ NF+P+EIREMLA ENKE DL ++NKILYDI                       
Sbjct: 653  IDDYSRQNFNPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFSDDDDD 712

Query: 822  XXXREYHXXXXXXXXXXXXXXGDDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGET 881
                                 GD  KK+VKNPKSKAFFES+V+DI + KN F+D      
Sbjct: 713  DLKAYRAKRRALMREKRLDIEGD--KKIVKNPKSKAFFESIVDDIIETKNPFDD------ 764

Query: 882  STQEINNTQDDMKEEDAAVVKENGDSXXXXXXXXXX-----SEEFVQRTLSFLKSSREDE 936
                +N + + + E++   V  + D                SEEFVQR+LSFL S RE +
Sbjct: 765  ----MNTSIEQIVEKETPTVDIDNDEKLATNVTKKKKKIVISEEFVQRSLSFLNSCREQD 820

Query: 937  EFAMNENLAKEQHGTKVENLLSLKQQSSIKVFQSPSNNSSKVIKLXXXXXXXXXXXXSPI 996
            EF +N      +  T   +L +LK+ SSIK  QS +++ S                 S  
Sbjct: 821  EFEINNQHNGGEKATSTADLYTLKRYSSIKTLQSVTSSRSS----SIASNLNEQPSQSSG 876

Query: 997  ALF---KVPSILKSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAP 1053
            +LF   +  S+L SF S  DIN KF++G K+V +S +Y+TVGS++ASITY+G SR+L+AP
Sbjct: 877  SLFNDLRKTSVLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAP 936

Query: 1054 THSKM 1058
              S++
Sbjct: 937  KKSRL 941

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 90/173 (52%), Gaps = 27/173 (15%)

Query: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60
           MDSL D L    K ++TTY+K   D   EEQE + IL + T+      + L  G LF NS
Sbjct: 1   MDSLFDQLNHFKK-KRTTYDKIPHDLLEEEQESEDILKNKTAK---EISQLDGGILFGNS 56

Query: 61  TIDKVRARLSGKNYIEQEKTPLAS-------SEQ-------ETQIITNLYTNGEDLEKDL 106
            + ++R RL+  +  +++K   AS       +EQ       +TQII NLY  GEDLE ++
Sbjct: 57  ILGQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEI 116

Query: 107 IKHIPVSQTQPI-------TNTGER-TQLEQEIKVTIDNDSNEMPTQVIGSTE 151
             H    +TQ I       TNT ++ TQ E+   +TI+   ++ P  V+ +T+
Sbjct: 117 F-HNSFKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKPLDVVNNTQ 168

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  278 bits (710), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 182/421 (43%), Positives = 224/421 (53%), Gaps = 30/421 (7%)

Query: 690  LTEQERIDIIEAEKTKIXXXXXXXXXXXXXXXXXGVTKFFXXXXXXXXXXWHGIGGIDGE 749
            ++E  R ++I+ EK++                  GVT FF          WHG+GG DGE
Sbjct: 729  VSEAIRRELIDREKSERRQKEKEQATKLKELKSKGVTNFFEMEAEESEDEWHGVGGADGE 788

Query: 750  MSDEYDSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKILYDIXXXXXXXXXXX 809
             SDEYDS+VEKMIDDYSK  F+ +EIREMLAAENKEMD+ MINKILYDI           
Sbjct: 789  GSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAK 848

Query: 810  XXXXXXXXXXXXXXXREYHXXXXXXXXXXXXXXGDDEKKLVKNPKSKAFFESMVEDITDD 869
                           ++Y               GDD  KLVKNPKSKAFFESMVEDI + 
Sbjct: 849  NSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDD-TKLVKNPKSKAFFESMVEDIMEF 907

Query: 870  KNAF-----NDEPLGETSTQEINNTQDDMKEEDAAVVKENGDSXXXXXXXXXXSEEFVQR 924
            KN F     +D+ +  T+T       D+ K  D     E+             SE+FVQ+
Sbjct: 908  KNPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQK 967

Query: 925  TLSFLKSSREDEEFAMNENLAKEQHGT---KVENLLSLKQQSSIKVFQSPSNNS------ 975
            +LSFLKS+  D EF M+  LA+ QHG     V +L +LKQ SSIK F +   NS      
Sbjct: 968  SLSFLKSNNYD-EFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTM 1026

Query: 976  SKVIKLXXXXX---XXXXXXXSPIALFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYR 1032
            + VI L               S I  FK PS++KSF S+TDIN+KF++GNKTV ISKSY+
Sbjct: 1027 NTVINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYK 1086

Query: 1033 TVGSSKASITYLGKSRKLMAP---THSKMKPLRSRVTDNNKITKGERNIGSLFSTGDDSF 1089
            TVGSSKASITY+GK+RKLMAP   T     P        N I K +     LF  G DSF
Sbjct: 1087 TVGSSKASITYMGKTRKLMAPKRKTEENHHP--------NHIKKSKTQKSKLFENGQDSF 1138

Query: 1090 E 1090
            +
Sbjct: 1139 D 1139

 Score =  136 bits (343), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 161/554 (29%), Positives = 240/554 (43%), Gaps = 71/554 (12%)

Query: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQ-EEDGILTDVTSGGNVTPTILGTGFLFKN 59
           MD  ++ L  +T  ++ T  KK   P ++E  + DG L     G N  P + G GFLF N
Sbjct: 44  MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLP--IDGMNAPPALTGNGFLFGN 101

Query: 60  STIDKVRARLSGKNYIEQEKTPLASSEQE---TQIITNLYTNGEDLEKDLIKHIPVSQTQ 116
           +T+++V+ RL G+N + Q+     + +++   TQ+I NLY  GE+LE    K       Q
Sbjct: 102 ATLNRVKNRLEGRNELGQDGQDKENEDEDVFSTQLIANLYDGGEELES---KSNGDKNNQ 158

Query: 117 PITNTGERTQLEQEIKVTIDNDSNEM--PTQVIGSTERDDETAER-TQIGEVATQLIPGD 173
            + N    TQ  Q I V+I   +NE+  P   I   E   +   R + I    TQ IP  
Sbjct: 159 KV-NVSSFTQT-QRIPVSITQQNNEINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPFT 216

Query: 174 TYDRTSTMQKTQEQLLKTQRIPQNSRDNHNQTNIINESFGSVPFTFTQKIKNFETNITNE 233
           T   T   QKT + L           +NH  T+   +    +P T   + +  + ++   
Sbjct: 217 TAQIT---QKTTQCL-----------NNHGATSQTQQ----IPPTKPSEAQT-QADVATA 257

Query: 234 NDDFTNGSKSQTVLISTNVDNVRAEYVDASSSLLQATAIAATVRDDGPSSTALVGTVADD 293
           ND  T   + +  +++T    +     D S S  Q      TV DD      +  T+ D 
Sbjct: 258 NDSDT---QQKVPMLTTETSPLFQTVPDQSPST-QMNTPPPTVHDDRTQMDTVAQTMQD- 312

Query: 294 KLSSGSNLAIHKFQKXXXXXXQLANNSKYKEYKGISKPILTNIVKFTKDSFLQGFDNXXX 353
                  L IH+ Q            ++  EY+ + K I   + +F+K+SFL  FDN   
Sbjct: 313 --KVPPTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPI-VKRFSKESFLADFDNSSS 369

Query: 354 XXXXXXGDKVKETKR--NGKEXXXXXXXXXXXXXXXXXXDGXXXXXXXXXXXXXXXLNTL 411
                   +  + K+  NG E                  D                +  L
Sbjct: 370 DEDTNFKLESSQPKQQQNGYEMIDISQSNPQPAEKENKKD--------------KKVPLL 415

Query: 412 SRYENKLKTVLNSKNQLQL------------GXXXXXXXXXXXXLPVSRTSKATILTIKA 459
           S Y N LK  ++S   + L                         LP+S+ SKATI  +KA
Sbjct: 416 STYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKA 475

Query: 460 RLSKQKSK--KNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEK 517
           RLSKQ  K  +   K+    ++ NKL   L+K+SRKQIL++QRE++E KG   ED+  EK
Sbjct: 476 RLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEK 535

Query: 518 ELVENLLEQEIKRN 531
           E+VE+LLEQEI RN
Sbjct: 536 EIVEDLLEQEILRN 549

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  264 bits (674), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 232/703 (33%), Positives = 336/703 (47%), Gaps = 87/703 (12%)

Query: 411  LSRYENKLKTVLNSKNQLQLGXXXXXXXXXXXXLPVSRTSKATILTIKARLSKQKSKKNV 470
            L  Y N LK  + +K +LQL               +S  SKAT+L +K RLSK+K  K V
Sbjct: 498  LPAYVNNLKQKVENK-KLQLSSDSDDEVDSAVIYKLSNKSKATLLNLKVRLSKKKPVKKV 556

Query: 471  --QKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQEI 528
              +KD T     N LF NL+K++++QI+ +++EL+E++GLNFED+E +K +VE+LLE+EI
Sbjct: 557  HNEKDST-----NLLFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEI 611

Query: 529  KRNQKIRQREKEREXXXXXXXXXXXXXXXXXEFDLSANEQEEQESDAELS----DVSKPD 584
            +RN KIR+REK +                  E +    EQE  ESD E S    D+S  D
Sbjct: 612  ERNLKIREREKRK------------------ESNEPLAEQEIMESDYEYSGDESDISNSD 653

Query: 585  I--DEEVVYQRRNIDED---GIQXXXXXXXXXXXXXXXXXPLQLS------------KRS 627
            I  +  +  Q+ N  E+   G++                 P++L             KRS
Sbjct: 654  IVDNSSISSQQINYTEEITYGLKNSNESDKGDNSPAVINGPIELELDNVDDEGDIEIKRS 713

Query: 628  NGVTAKIISVSEDDEDTISKRNAIDLGAYGDNLTTANVKSQXXXXXXXXXXXXXXXXTQP 687
            +  + K    S+ + D  +     D  +  + L     +SQ                T  
Sbjct: 714  HRTSKKPFLFSDTESDFQNDDIITDASSSAERLPID--ESQETSPENEDHDSSEDIDT-- 769

Query: 688  LELTEQERIDIIEAEKTKIXXXXXXXXXXXXXXXXXGVTKFFXXXXXXXXXXWHGIGGID 747
                EQERI  I+ +  +                  GV ++F          W GIGG+D
Sbjct: 770  ----EQERIAAIKQQVKRQQEREVKERKKLQELANKGVNQYFEEEAEESDDEWRGIGGVD 825

Query: 748  GEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKILYDIXXXXXXXXX 807
            G+   EYDS+VEKMIDDYSK   D   +R+ +  ENKEMDL ++NKILYDI         
Sbjct: 826  GDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRG 885

Query: 808  XXXXXXXXXXXXXXXXXREYHXXXXXXXXXXXXXXGDDEKKLVKNPKSKAFFESMVEDIT 867
                             +E+                +D  KL KNPKSKAFFESM+ D+ 
Sbjct: 886  RNDMELEFSDDEDAEL-QEFRRKRRELMKQRMLE-NEDTDKLTKNPKSKAFFESMIVDLV 943

Query: 868  DDKNAFNDEPLGETSTQEINNTQDDMKEEDAAVVKENGDSXXXXXXXXXXSEEFVQRTLS 927
            +DKN F+D    +   +E N TQ+D +       KE  ++          SE+FVQ+TLS
Sbjct: 944  EDKNNFDDLS-DQIELKEENITQEDNE-------KEYNEAKSNKRGKIRISEDFVQKTLS 995

Query: 928  FLKSSREDEEFAMNENLAKEQHGTKVENLLSLKQQSSIKVFQSPSNNSSKVIKLXXXXXX 987
            FL +    +EF  +  ++KE+    + ++ +LK  SS+  F S  + S K+I        
Sbjct: 996  FLHNDESTQEFQPSFIMSKEKG---IGDMNALKSNSSLS-FCSKLSTSRKII-------N 1044

Query: 988  XXXXXXSPIALFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKS 1047
                       FK PSI++SF SK  I++KF+DGNK+V +S SY+TVG SKASITYLGK+
Sbjct: 1045 DEEDVIEEFESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKT 1104

Query: 1048 RKLMAPTHSKMKPLRSRVTDNNKITKGERNIGSLFSTGDDSFE 1090
            RKL+ P +     +R R ++         N   LF+  +D F+
Sbjct: 1105 RKLVPPKNGPT--VRKRNSN---------NTSRLFNIQNDPFD 1136

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 60/145 (41%), Gaps = 36/145 (24%)

Query: 1   MDSLIDDLKPVTKVRKTTYNKKSL------DPSIEEQEEDGILTDVTSGGNVTPTILGT- 53
           MD L D+L+ V   ++TTY K  +      D    E   + I+ +  S  + +  +L   
Sbjct: 1   MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNNV 60

Query: 54  ---GFLFKNSTIDKVRARLS--------------GKNYIEQEKTPLASSEQ--------- 87
              GFL  +  +D +R+RL+                   EQ K    SSEQ         
Sbjct: 61  NKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQSD 120

Query: 88  --ETQIITNLYTNGEDLEK-DLIKH 109
              TQII   Y  GEDL+  D+IK+
Sbjct: 121 DISTQIINEYYDGGEDLDATDIIKN 145

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  258 bits (659), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 157/378 (41%), Positives = 202/378 (53%), Gaps = 26/378 (6%)

Query: 724  GVTKFFXXXXXXXXXXWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAEN 783
            GV+K F          WHG+GG DGE+SDEYDS++EKM+DDY+K  FDP EIR+MLAAE+
Sbjct: 814  GVSKMFEMEAEESEDEWHGVGGADGELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAED 873

Query: 784  KEMDLNMINKILYDIXXXXXXXXXXXXXXXXXXXXXXXXXXREYHXXXXXXXXXXXXXXG 843
            KE D  ++NKIL+DI                          R YH              G
Sbjct: 874  KEYDEKIVNKILHDIKNGGFRRRGKGALDIELSDDEDDELQR-YHAKRRELLRQKVLENG 932

Query: 844  DDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEIN----NTQDDMKEEDAA 899
             +  KLV NPKS AFFESMVED+ + KN F+   +GET+  +      N + D   E   
Sbjct: 933  -EASKLVSNPKSHAFFESMVEDLVESKNPFS---IGETADPDSGAISENDKVDNASEHGT 988

Query: 900  VVKENGDSXXXXXXXXXXSEEFVQRTLSFLKSSRE-DEEFAMNENLAKEQHGT------K 952
                 G            S+EFVQR+LSFL S  E D EF ++  LAK QH T       
Sbjct: 989  QPDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDD 1048

Query: 953  VENLLSLKQQSSIKVFQSPSNNSSKVIKLXXXXXXXXXXXXSPIALFKVPSILKSFGSKT 1012
            +E+L +LKQ S IK   +P+  SS+ + L            SP   FK+PS++ SF S+ 
Sbjct: 1049 LEDLFTLKQNSCIKTLHTPARTSSRTVDL-------EVDGNSPANGFKLPSVISSFSSRI 1101

Query: 1013 DINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTHSKMKPLRSRVTDNNKIT 1072
            DINEKF++G KTV +SKSY+T+G S+ASITYLGK RKL AP   +    R  V  +    
Sbjct: 1102 DINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLNAPKRKESG--RKPVFGHRHPE 1159

Query: 1073 KGERNIGSLFSTGDDSFE 1090
               +  G LF+  DDSFE
Sbjct: 1160 AAPKRAG-LFADNDDSFE 1176

 Score =  115 bits (289), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 100/273 (36%), Positives = 135/273 (49%), Gaps = 30/273 (10%)

Query: 411 LSRYENKLKTVLNSKNQLQLGXXXXXXXXXXXXLPVSRTSKATILTIKARLSKQKS-KKN 469
           L+ Y+N+LK  L+SK  + L             +P S+ SKA +L IKAR SK++  KK 
Sbjct: 412 LNSYKNQLKARLDSKEHIDL---DSSSDEDENSVPASKMSKAAVLEIKARTSKRQGIKKT 468

Query: 470 VQKDGTVNT-NLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQEI 528
            Q+  T    +L +LF +LKK+++KQIL+++RE+ E +GLN EDIE EK+ VENLLEQEI
Sbjct: 469 RQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEI 528

Query: 529 KRNQKIRQREKEREXXXXXXXXXXXXXXXXXEFDLSANE---QEEQESDAELSDVSKPDI 585
           +RN+KIR REK+RE                 +FD S NE   + E E  +   DV   D 
Sbjct: 529 ERNRKIRLREKQREKKKELDEQQDGGYPG--DFDYSENELDGEPESEPASGSEDVPDSDA 586

Query: 586 DEEVVYQRRNIDEDGIQXXXXXXXXXXXXXXXXXPLQLSKRSNGVTAKIISVSEDDEDT- 644
            +  V     +DED                    P   SK+     A   S    D D+ 
Sbjct: 587 PDSDV-----LDEDSDDESREKDRDDEDDEAIVLPK--SKKRAKRIANFGSGPGPDSDSD 639

Query: 645 -------ISKR-----NAIDLGAYGDNLTTANV 665
                  IS+      N IDLGAYG NL  A+ 
Sbjct: 640 LGSDNEPISRNGPRPGNVIDLGAYGGNLANADA 672

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 82/320 (25%), Positives = 135/320 (42%), Gaps = 48/320 (15%)

Query: 48  PTILGTGFLFKNSTI-DKVRARLSGKNYIEQEKT--PLASSEQETQIITNLYTNGEDLEK 104
           P +    FLF NSTI DKV++RL+G   +  E+T      +  +TQ+I N Y +GEDLE+
Sbjct: 40  PQLSSASFLFGNSTIVDKVKSRLNG---VSNEETDGERGDALPQTQVIPNYY-DGEDLEQ 95

Query: 105 DLIKHIPVSQTQP--ITNTGERTQLEQEIKVTIDNDSNEMPTQVIGSTERDDETAERTQI 162
           D      VS  +P  ++NTG      Q+     +  +  MPTQ  G+ E        +Q+
Sbjct: 96  DF-----VSPPKPRRVSNTGHG----QDCDCDSEEQTQLMPTQETGAYE--------SQV 138

Query: 163 GEVATQLIPGDTYDRTSTMQKTQEQLLKTQRIPQNSRDNHNQTNIINESFGSVPFTFTQK 222
             V   +   +T   +       E L KT +        +   N+    +G      + +
Sbjct: 139 VPVIAPVQVSETIPVSINDGLLGESLFKTSKDEVKGNGGNTTRNLAEPCYGLTQIIPSPQ 198

Query: 223 IKN-----FETNITNENDDFTNGSKSQTVLISTNVDNVRAEYVDASSSLLQATAIAATVR 277
            KN      ET    E  +     K+Q +L +T  D   +E    ++++   +    T  
Sbjct: 199 YKNSQQMQLETQEAGETQEV---DKTQRILEATARDPTLSEEDFVAATVADGSEAVTTQL 255

Query: 278 DDGPSSTALVGTV---ADDKLS--SGSNLAIHKFQKXXXXXXQLANNSKYKEYKGISKP- 331
           D     T+ +G V   A D+ +  +   L IH+ +K       L    + ++    +KP 
Sbjct: 256 DTCVPDTSALGDVQPTAPDQSAHRNSQRLLIHEIEK------DLDAEEEREKRITEAKPH 309

Query: 332 --ILTNIVKFTKDSFLQGFD 349
             +L    KF K++FL  FD
Sbjct: 310 DVVLVVKKKFDKEAFLNNFD 329

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
            complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  236 bits (603), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 171/444 (38%), Positives = 219/444 (49%), Gaps = 39/444 (8%)

Query: 649  NAIDLGAYGDNLTTANVKSQXXXXXXXXXXXXXXXXTQPLELTEQERIDIIEAEKTKIXX 708
            N I+LG YGDNL+  N                    ++  EL ++    +++ E  +   
Sbjct: 578  NTINLGHYGDNLSQEN---------NNERNNIDSDESEDEELYKE----MVKKEIDRRRD 624

Query: 709  XXXXXXXXXXXXXXXGVTKFFXXXXXXXXXXWHGIGGIDGEMSDEYDSDVEKMIDDYSKA 768
                           G+T  F          WHGIGG+DGE+SDEYDS+VEKMIDDYSK 
Sbjct: 625  QERKQRQKLRELKDKGITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKE 684

Query: 769  NFDPNEIREMLAAENKEMDLNMINKILYDIXXXXXXXXXXXXXXXXXXXXXXXXXXREYH 828
            NF+  EIRE LAAENK+MDL M+N+IL DI                             +
Sbjct: 685  NFNAGEIREKLAAENKDMDLKMVNRILNDIKNGGFRKRRNALEIELSDDEDDDLKA---Y 741

Query: 829  XXXXXXXXXXXXXXGDDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINN 888
                           D  KKL+ N KS AF ESMV+DI + KN F++           +N
Sbjct: 742  RAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDIVEVKNPFDERD---------DN 792

Query: 889  TQDDMKEEDAAVVKENGDSXXXXXXXXXXSEEFVQRTLSFLKSSREDEEFAMNENLAKEQ 948
              DD  E DA     N +           SE FVQ++LSFL SSR  EEF MN NLAKEQ
Sbjct: 793  IMDDTPETDAEG-DVNSNELLNKKKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQ 851

Query: 949  HGTKVENLLSLKQQSSIKVFQS--PSNNSSKVIKLXXXXXXXXXXXXSPIALFKVPSILK 1006
            H     ++ +LK   SIK  +S   S+N+S   KL            +P +  K  S++K
Sbjct: 852  HSHAATDMFALKSHCSIKSLESLPGSHNNSISSKLDLLHEEIVS---TPFSGLKQTSVIK 908

Query: 1007 SFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTHSKMKPLRSRVT 1066
            SF S  DI+ KF+DGNKTV +SKSYRTVGS+KASITYLGK+RKL+ P   + KP   +  
Sbjct: 909  SFSSSIDIDSKFKDGNKTVKVSKSYRTVGSAKASITYLGKARKLVPPKKKEHKPHSHK-- 966

Query: 1067 DNNKITKGERNIGSLFSTGDDSFE 1090
              +K     R    LF   D+SFE
Sbjct: 967  --SKTASASR----LFDEQDNSFE 984

 Score = 82.8 bits (203), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 87/134 (64%), Gaps = 10/134 (7%)

Query: 411 LSRYENKLKTVLNSKNQLQLGXXXXXXXXXXXXLPVSRTSKATILTIKARLSKQKSKKNV 470
           LS YEN LK  +N +N ++                VSR SKATIL+IKA LS+ K  +  
Sbjct: 326 LSNYENILKKDINKQNCIEFSDSEDETEVTS---KVSRASKATILSIKANLSRHKPAQ-- 380

Query: 471 QKDGTVNTN--LNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQEI 528
               ++N    L  LF +LKK+++ QIL++++E++E KG   E+IE EKE+VENLLEQEI
Sbjct: 381 ---SSINNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKMEEIEKEKEIVENLLEQEI 437

Query: 529 KRNQKIRQREKERE 542
           +RN+KIR REK++E
Sbjct: 438 ERNRKIRIREKQKE 451

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 10/105 (9%)

Query: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60
           MD + D L  +   ++TTY KK  D  +E++ +        S  N+    LG   LF NS
Sbjct: 1   MDFVFDGLDALKGKKRTTY-KKVTDGDVEDEPK-------ISEFNIELPGLGQSILFNNS 52

Query: 61  TIDKVRARLSGKNYIEQEKTPLASSE--QETQIITNLYTNGEDLE 103
            + ++R RL G N   +  +  A ++   +TQII+NLY  GEDLE
Sbjct: 53  KLKQIRNRLEGNNNDSENDSSQAETQVIADTQIISNLYEGGEDLE 97

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 925

 Score =  229 bits (583), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 213/672 (31%), Positives = 300/672 (44%), Gaps = 112/672 (16%)

Query: 447  SRTSKATILTIKARLSKQKSKKNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENK 506
            S++SKA +L IKA+ S+ K+ K      +   +L +LF +LK  +R QILE +RE+   K
Sbjct: 336  SQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELFTSLKTKNRDQILEFRREISGKK 395

Query: 507  GLNFEDIEMEKELVENLLEQEIKRNQ--KIRQREKEREXXXXXXXXXXXXXXXXXEFDLS 564
            G++ E IE EK  VE LLEQE++RN+  K+R++ +  +                 + D+ 
Sbjct: 396  GISLEAIEDEKIQVEKLLEQELERNRRVKLREKREREKSKDTSKAASSGSASDVPDSDV- 454

Query: 565  ANEQEEQESDAELSDVSKPDIDEEV-VYQRRNIDEDGIQXXXXXXXXXXXXXXXXXPLQL 623
                   ESD  LSD    D+++ + ++     DED                        
Sbjct: 455  ------MESDLSLSD---SDVEQHLGLHGSTGSDEDSADTSAAH---------------- 489

Query: 624  SKRSNGVTAKIISVSEDDEDTISKRN-AIDLGAYGDNLTTANV-------KSQXXXXXXX 675
             K +N +     S S  D++ +++    I+LG YGDNLT++NV       +S        
Sbjct: 490  -KNNNPIIDDDESSSSSDDNEVTQEPIGINLGHYGDNLTSSNVTENDGADQSDRNVPSNS 548

Query: 676  XXXXXXXXXTQPL-----------------ELTEQERIDIIEAEKTKIXXXXXXXXXXXX 718
                      + L                 EL E ER  + E  K +             
Sbjct: 549  ELKMNRSHSAKLLVGELSSDSSVDSDSSEDELDEVERNRLQERAKMRRRMEIEAAKKRKQ 608

Query: 719  XXXXXGVTKFFXXXXXXXXXXWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREM 778
                 G+ K            WHG+GG DGE SD+YDSD++ MIDD+SK+ FD   IRE 
Sbjct: 609  VLKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRER 668

Query: 779  LAAENKEMDLNMINKILYDIXXXXXXXXXXXXXXXXXXXXXXXXXXREYHXXXXXXXXXX 838
            LA ENKEMD  MINKIL+DI                          R++           
Sbjct: 669  LALENKEMDERMINKILHDINTGGFRKRGRGALDLELSDDEDELL-RQFREKRREIMKQK 727

Query: 839  XXXXGDDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDA 898
                 D    +V N KSKAFF+SMVEDIT  + +         +    +NT+D+M ++  
Sbjct: 728  LLENVDG---VVNNSKSKAFFDSMVEDIT--RKSI-------PAVTSFSNTRDEMGKKKI 775

Query: 899  AVVKENGDSXXXXXXXXXXSEEFVQRTLSFLKSSREDEEFAMNENLAKEQHGTKVENLLS 958
             +                 SEEFVQ +LSFL +  +D    +NE    E      E+L S
Sbjct: 776  VI-----------------SEEFVQSSLSFLSAKDDD----INEFEVTEAAHDATEDLES 814

Query: 959  LKQQSSIKVFQSPSNNSSKVIKLXXXXXXXXXXXXSPIAL-FKVPSILKSFGSKTDINEK 1017
            LKQ+S+IK   SP  N +                    +L FK+PSI+KSF S +D+N+K
Sbjct: 815  LKQRSNIKSLDSPQRNRNSAF----------FDDVDGTSLDFKLPSIVKSFSSNSDVNDK 864

Query: 1018 FQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTHSKMKPLRSRVTDNNKITKGERN 1077
            F+ G KTVTISKSYR    S+++IT+LGK RKL AP   K  PL  + T           
Sbjct: 865  FKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRKSTPLVRKPT----------- 913

Query: 1078 IGSLFSTGDDSF 1089
              SLF +  DSF
Sbjct: 914  -SSLFDSNSDSF 924

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
            YCL061C
          Length = 941

 Score =  190 bits (483), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 150/408 (36%), Positives = 195/408 (47%), Gaps = 35/408 (8%)

Query: 649  NAIDLGAYGDNLTTANVKSQXXXXXXXXXXXXXXXXTQPLELTEQERIDIIEAEKTKIXX 708
            +AI+LGAYGDNL T                      TQ +    + +   +E EK+KI  
Sbjct: 541  SAINLGAYGDNLITTT--------KDEAHTSAEEHTTQLVNEISESQYRTMEKEKSKIRA 592

Query: 709  XXXXXXXXXXXXXXXGVTKFFXXXXXXXXXXWHGIGGIDGEMSDEYDSDVEKMIDDYSKA 768
                           GVT  F          W G+GG+DGE  D+YDSD+EKMIDD+S  
Sbjct: 593  QEEKQRLKQMKES--GVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNT 650

Query: 769  NFDPNEIREMLAAENKEMDLNMINKILYDIXXXXXXXXXXXXXXXXXXXXXXXXXXREYH 828
              + ++IR++L AENKE DL  +NKIL+DI                            Y 
Sbjct: 651  TSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQNNLQLELSDDEDDELLN-YK 709

Query: 829  XXXXXXXXXXXXXXGDDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINN 888
                          G D+KKL+KN +SKAFFESMVEDI D K+ F+++   ETS      
Sbjct: 710  KRKLELMRKRRLQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQ--AETS------ 761

Query: 889  TQDDMKEEDAAVVKENGDSXXXXXXXXXXSEEFVQRTLSFLKSSREDEEFAMNENLAKEQ 948
             + D K E        G            S EFVQ++LSFL SSR+  EF   E     Q
Sbjct: 762  -EKDKKSE--------GLVDASNKQKDTISHEFVQQSLSFLSSSRDFSEF---EVARVSQ 809

Query: 949  HGTKVENLLSLKQQSSIKVFQSPSNNSSKVIKLXXXXXXXXXXXXSPIALFKVPSILKSF 1008
             G +  +L SLKQ S++K   +PSN    +I                       S++KSF
Sbjct: 810  EGERNTDLNSLKQDSTVKTLYAPSN----IISESERADHEEFDNSVLPVESSYSSVVKSF 865

Query: 1009 GSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTHS 1056
            G   + N+K ++G KTVT+SKSYRTVG +KASITYLGK RKL+AP  S
Sbjct: 866  GFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKS 913

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 143/544 (26%), Positives = 228/544 (41%), Gaps = 103/544 (18%)

Query: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60
           MD L +      K R+ TY +K++    +E  ED +         V P +LG GFLF +S
Sbjct: 1   MDKLFESFDNAIKKRRATY-QKAVQNEDDEYTEDPL---------VPPAVLGNGFLFNSS 50

Query: 61  TIDKVRARLSGKNYIEQEKTPLASSEQETQIITNLYTNGEDLEKDLIKHIPVSQTQPITN 120
           T+DKV+ RL+     +QE+   A     TQ+++NLY +GEDLEK+ +  I  S+++PI  
Sbjct: 51  TLDKVKNRLNK----DQEQGTQAIDT--TQVLSNLYEDGEDLEKE-VPSILQSKSKPI-- 101

Query: 121 TGERTQLEQEIKVTIDNDSNEMPTQVIGSTERDDETAERTQIGEVATQLIPGDTYDRTST 180
                                 PT +I S ER+                I    ++    
Sbjct: 102 ----------------------PTILIPSIERE----------------ILKQPFNENHN 123

Query: 181 MQKTQEQLLKTQRIPQNSRDNHNQTNIINESFGSVPFTFTQKIKNFE-TNITNENDDFTN 239
                  + K+  I +N         +  E   S     TQ I +F  +++  +      
Sbjct: 124 FTGVTVPIAKSSAITKN---------LDREDLESPEIPETQPIPDFSASDVPTQTQVLKT 174

Query: 240 GSKSQTVLISTNVDNVRAEYVDASSSLLQATAIAATVRDDGPSSTALVGTVADDKLSSGS 299
            S++     + +   V    +    SL Q      T  D   S   ++   A D +   +
Sbjct: 175 TSET-----AADTGTVATAAIAYEESLTQVEVSEQTYPDQRNSQEDIIQQTAADAVPI-T 228

Query: 300 NLAIHKFQKXXXXXXQLANNSKYKEYKGISKPILTNIVKFTKDSFLQGFDNXXXXXXXXX 359
            L IH+ ++      Q        +Y+   +P+      FTK++F+Q FD          
Sbjct: 229 RLKIHEIEEMWSREVQTETKEHKVKYRA-PRPLKV----FTKEAFMQDFDKSSDSDSDVF 283

Query: 360 GDKVKETKRNGKEXXXXXXXXXXXXXXXXXXDGXXXXXXXXXXXXXXXLNTLSRYENKLK 419
             ++K T   G+                                       L+ Y+ +LK
Sbjct: 284 DQEIKATSPIGRNNDSISEVGTSDVKVLKDKSS----------------GALTAYQRELK 327

Query: 420 TVLNSKNQLQLGXXXXXXXXXXXXLPVSRT--SKATILTIKARLSKQKSKKNVQKDGTVN 477
                K ++  G            L VS +  +KAT+L +KARLSK++     Q      
Sbjct: 328 ----EKAEIAKGVMLLSESDDEEDLAVSTSHEAKATVLKLKARLSKRRPPVESQHG---K 380

Query: 478 TNLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQEIKRNQKIRQR 537
            +L+ L +NL+ S+++QIL+ Q+E IE +GL FED+E EKE+VENLLEQEI RN++IR +
Sbjct: 381 ASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIARNKRIRMK 440

Query: 538 EKER 541
           EKE+
Sbjct: 441 EKEK 444

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  184 bits (468), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 154/441 (34%), Positives = 202/441 (45%), Gaps = 44/441 (9%)

Query: 649  NAIDLGAYGDNL----TTANVKSQXXXXXXXXXXXXXXXXTQPLELTEQERIDIIEAEKT 704
            N I+LG YGDNL    T  N  S+                    EL E E    I+ E  
Sbjct: 793  NIINLGHYGDNLDSKSTIFNENSKKFIEDIEQFEADNSTENSNNELNELEYKRHIKQELE 852

Query: 705  KIXXXXXXXXXXXXXXXXXGVTKFFXXXXXXXXXXWHGIGGIDGEMSDEYDSDVEKMIDD 764
            K                  G +K F          W GIGG DGE+SDEYDS+VEK+IDD
Sbjct: 853  KQKLKEAKKKAKLRELKKVGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDD 912

Query: 765  YSKANFDPNEIREMLAAENKEMDLNMINKILYDIXXXXXXXXXXXXXXXXXXXXXXXXXX 824
            YS+ +F+P+EIR  L  ENKEMD+ M+N+ILYDI                          
Sbjct: 913  YSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDI-KNGGFRKRNRNNIDLELSDDEDDEL 971

Query: 825  REYHXXXXXXXXXXXXXXGDDEKKLVKNPKSKAFFESMVEDITDDKNAF-----NDEPLG 879
            REY                + + K++K  KSKAFF SMV+DI +  N F     +D+   
Sbjct: 972  REYRIKRREIMKKKRLEVTNTD-KILKTSKSKAFFMSMVDDIVETSNPFMITQPSDDDSD 1030

Query: 880  ETSTQEINN-----------TQDDMKEEDAAVVKENGDSXXXXXXXXXXSEEFVQRTLSF 928
            + +   I+N            + D + +D A + ++             SE+FV +TLSF
Sbjct: 1031 DNNMDSISNKNHKDANNAKKDKKDKRTDDHARLSQSS------RKKFVMSEDFVHKTLSF 1084

Query: 929  LKSSREDEEFAMNENLAKEQHGTKVENLLSLKQQSSIKVFQSPSNNS-----------SK 977
            L  S+E  EF       K Q GT + ++ SLKQ+SSIK     S  S             
Sbjct: 1085 LTKSKEVNEFQHVNEHYKSQIGT-INDIQSLKQKSSIKTMHVLSMMSQDTNVDLDASDKD 1143

Query: 978  VIKLXXXXXXXXXXXXSPI-ALFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYRTVGS 1036
               +             P+ ++ K PSI+K FGS  DIN+KF+DGNKTVTIS SY+TVG 
Sbjct: 1144 DDDMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGG 1203

Query: 1037 SKASITYLGKSRKLMAP--TH 1055
             K SIT  G+ RKL+AP  TH
Sbjct: 1204 MKTSITSFGR-RKLVAPVKTH 1223

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 7/70 (10%)

Query: 1  MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTI-LGTGFLFKN 59
          MD++ D L  +   ++TTY K      + EQ    +    T+  N  P+  L  GFLF N
Sbjct: 3  MDAVFDSLDELKIKKRTTYKK------VPEQVATELDKAATTISNPVPSFNLSEGFLFAN 56

Query: 60 STIDKVRARL 69
            ++K++ RL
Sbjct: 57 DKLEKIKNRL 66

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 993

 Score =  166 bits (421), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 127/358 (35%), Positives = 171/358 (47%), Gaps = 38/358 (10%)

Query: 740  WHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKILYDIX 799
            WHGIGG+DGE  D++DSD+EKMIDDYS + FD +E+R+    E    D +M+NKIL+DI 
Sbjct: 666  WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725

Query: 800  XXXXXXXXXXXXXXXXXXXXXXXXXREYHXXXXXXXXXXXXXXGDDEKKLVKNPKSKAFF 859
                                     + YH              G+  K L +NPKSKAFF
Sbjct: 726  TGGFRKRGRNALDLELSDDDDEELLK-YHSRRKELLRQKVSAQGE-AKLLAENPKSKAFF 783

Query: 860  ESMVEDITDDKNAFNDE-PLGETSTQEINNTQDDMKEEDAAVVKENGDSXXXXXXXXXXS 918
            E++VEDI   K A  DE P        +N           A  ++N DS          S
Sbjct: 784  ETIVEDIRS-KGALEDEGPPPVRGFSSVN-----------APEEKNSDSDKKGKKTVL-S 830

Query: 919  EEFVQRTLSFLKSSREDEEFAMNENLAK------EQHGTKVENLLSLKQQSSIKVFQSPS 972
            E FVQ+TLSFL S    EE     NL          +  + +++ +LKQ SSIK   +P+
Sbjct: 831  EAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLSAPT 890

Query: 973  NNSSKVIKLXXXXXXXXXXXXSPIALFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYR 1032
             NSS ++                ++  +  S    F  + D NEKF++G KTV    SY+
Sbjct: 891  RNSSNML---------IDDQEDLLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYK 941

Query: 1033 TVGSSKASITYLGKSRKLMAPTHSKMKPLRSRVTDNNKITKGERNIGSLFSTGDDSFE 1090
              GSSKASITYLGK+RKL AP     +  R R    +K   G    G +F++  +SFE
Sbjct: 942  VAGSSKASITYLGKARKLNAPKKVAHQQSRKR---GHKPAAG---FG-IFASNSESFE 992

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 66/95 (69%), Gaps = 4/95 (4%)

Query: 451 KATILTIKARLSKQKSKKNVQKDGTVNTNLNK---LFENLKKSSRKQILENQRELIENKG 507
           KA IL +KARLSK KS+  +     V +N +    LF +L+K+++ QIL+ ++E  ++KG
Sbjct: 360 KAAILDLKARLSK-KSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKG 418

Query: 508 LNFEDIEMEKELVENLLEQEIKRNQKIRQREKERE 542
           ++++ I  EK  +E+LLE+E+ RN+KIR RE E+E
Sbjct: 419 IDYDKITEEKNSIESLLERELARNKKIRLREIEQE 453

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 6/69 (8%)

Query: 43  GGNVTPTILGTGFLFKNSTIDKVRARLSGKNYIEQE--KTPL---ASSEQETQIITNLYT 97
           G +  P + GTGFLF NS + +V++RL      E +  K+P+        +TQ++   Y 
Sbjct: 24  GCDSLPLVTGTGFLFGNSVLRRVKSRLGDDENHEADSTKSPIDNGCCDLSQTQVVGLAY- 82

Query: 98  NGEDLEKDL 106
           +GEDLE+D 
Sbjct: 83  DGEDLEQDF 91

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  165 bits (418), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 166/351 (47%), Gaps = 53/351 (15%)

Query: 724  GVTKFFXXXXXXXXXXWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAEN 783
            GV K            WHG+GG+D E SDEYDSD++KMIDDY+K  FDP EIR++LA+E+
Sbjct: 781  GVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRKILASED 840

Query: 784  KEMDLNMINKILYDIXXXXXXXXXXXXXXXXXXXXXXXXXXREYHXXXXXXXXXXXXXXG 843
             + D NM+NKIL+DI                           + +               
Sbjct: 841  LQHDKNMVNKILHDIKTGGFRKRGRGELDLELSEDEDGIL--QSYRAKRWNEQKQKMLDS 898

Query: 844  DDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAAVVKE 903
            +    +  NPKS  FFESMV++ T       +  LG   +    +T       +   +K+
Sbjct: 899  EHNTSVKSNPKSLPFFESMVDEFT----IPVERALGTPDSPPAQST-------NVLELKQ 947

Query: 904  NGDSXXXXXXXXXXSEEFVQRTLSFLKSSREDEEFAMNENLAKEQ-----HGTKVENLLS 958
            N             SE FV++TLSFL S           N+ K       + ++VE+L +
Sbjct: 948  N------TKQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSEVEDLYT 1001

Query: 959  LKQQSSIKVFQSPSNNSSKVIKLXXXXXXXXXXXXSPIA---------LFKVPSILKSFG 1009
            LK+ S+IKV  + S                      PI           FK PS++++FG
Sbjct: 1002 LKETSTIKVLNTYSG--------------------KPIVNEDEDGAEFGFKAPSVMQTFG 1041

Query: 1010 SKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTHSKMKP 1060
            S+ D+N+KF+DG K+V IS  Y+T+GSS+A+IT+LGK RKL+ P  S   P
Sbjct: 1042 SRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKRSSKSP 1092

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 71/95 (74%), Gaps = 6/95 (6%)

Query: 451 KATILTIKARLSKQKSKKNVQKDGTVNTN---LNKLFENLKKSSRKQILENQRELIENKG 507
           KA +L IKA++SK     N+ K+   + N   L +LF +LKK+++KQIL+++RE+ E +G
Sbjct: 443 KAALLNIKAKISKNM---NLSKNAEQSINSPTLKQLFISLKKANKKQILDHRREITEKRG 499

Query: 508 LNFEDIEMEKELVENLLEQEIKRNQKIRQREKERE 542
           ++ E +E E+E VE+LLEQ+IKRN++IR REK++E
Sbjct: 500 ISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKE 534

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 103/392 (26%), Positives = 162/392 (41%), Gaps = 86/392 (21%)

Query: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60
           MD L  +L P    RKTTY    ++     QE   I+   ++  NV          F N+
Sbjct: 1   MDLL--NLLPGKARRKTTY---KIEHEKLSQEAGYIIIKPSNAENV----------FANA 45

Query: 61  TIDKVRARLSGKNYIEQEKTPLASSEQETQIITNLYTNGEDLEKDLIKHIPVSQTQPITN 120
            +DKVR RL G          L+S   ET  + NLY +GE LE+D   +I  S  + + N
Sbjct: 46  IVDKVRNRLEGTISSPDRLDTLSSKLSET--VGNLY-DGEALEEDFDPNIDNS-FKGMVN 101

Query: 121 TGERTQLEQEIKVTIDN----DSNEMPTQV----IGSTERDDETAERTQIGEVA------ 166
           +        + K T+D+    D+  +P ++    I ++E ++ +   ++   ++      
Sbjct: 102 SYNVNFEHIKSKGTMDHNRTIDAIPLPVKLDNGGIFASESNNHSLRDSKTDTISCNSLTS 161

Query: 167 --TQLIPGDTYDRTSTMQKTQE---------------------QLLKTQRIPQNSRDNHN 203
             TQ     +   T+ +Q+TQ+                     Q +K  RI   S  N N
Sbjct: 162 NHTQHARSSSGIHTAQLQETQKVITDVKSALFTSSSISSNSNLQKVKATRI---SAPNFN 218

Query: 204 QTNIINESFGSVPFTFTQKIKNFETNITNENDDFTNGSKSQTVLIS--TNVDNVRAEYVD 261
                NE  G   +T TQ IKN +         F  G  S+T LI   T+ D+ R+ +  
Sbjct: 219 ----TNEDRG---YTQTQIIKNIQ---------FDEGKYSETQLIPEITDDDDCRSLHNA 262

Query: 262 ASSSLLQATAIAATVRDDGPSSTALVGTVADDKLSSGSN----LAIHKFQKXXXXXXQLA 317
                   + +A T+  +   S  L  TV +  +S  +     LAIHKFQ+         
Sbjct: 263 QGPDSQTLSTLADTL--ESKLSEKLRATVPNQVISQSNKKKEELAIHKFQRDLGEAED-- 318

Query: 318 NNSKYKEYKGISKPILTNIVKFTKDSFLQGFD 349
            N+K  E+   S   L N + FTK++FL  F+
Sbjct: 319 ENNKVTEHILPSYVALQNHI-FTKEAFLDDFE 349

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  140 bits (354), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 101/336 (30%), Positives = 159/336 (47%), Gaps = 40/336 (11%)

Query: 724  GVTKFFXXXXXXXXXXWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAEN 783
            G+TK            WHGIGG D E+S++YDS+VEKMIDDYS  + + + +R +LA   
Sbjct: 685  GITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNE 744

Query: 784  KEMDLNMINKILYDIXXXXXXXXXXXXXXXXXXXXXXXXXXREYHXXXXXXXXXXXXXXG 843
            ++ D N++NKIL+DI                          +++               G
Sbjct: 745  RQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQEL-QQFRQKRRELLKQKILENG 803

Query: 844  DDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAAVVKE 903
            D   KLV NPKS AFF++MV+D+T+          G T    I+   D        V+  
Sbjct: 804  D-TSKLVSNPKSYAFFQTMVDDVTE-------ASFGNTFDANIDEKTDPSAAGRKIVI-- 853

Query: 904  NGDSXXXXXXXXXXSEEFVQRTLSFLKSSREDEEFAM------NENLAKEQHGTKVENLL 957
                          SE+FV+ TLSFL S   D E         +  + +E+    +++L 
Sbjct: 854  --------------SEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREE----IQDLH 895

Query: 958  SLKQQSSIKVFQSPSNNSSKVIKLXXXXXXXXXXXXSPIALFKVPSILKSFGSKTDINEK 1017
            +LKQ S+IK  +      +++ +L               +L +  S  KSF + T++++K
Sbjct: 896  TLKQNSNIKHLKGSLELPAQMAELSSGDEGDYG-----FSLDRFRSAAKSFNNGTNVDDK 950

Query: 1018 FQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAP 1053
            F+ G K V I K+ +T+G SKA+IT++G+ R+L+ P
Sbjct: 951  FKSGTKAVRILKANKTIGGSKAAITFIGRKRRLIPP 986

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 57/82 (69%), Gaps = 2/82 (2%)

Query: 447 SRTSKATILTIKARLSKQKSKKNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENK 506
           S  SKA +L IKAR SK  + + +  D T ++  N+LF  L+K++R+Q+LE +R  IE +
Sbjct: 382 SAVSKAAVLAIKARNSKFITPQKI--DETKSSKSNELFAKLRKANREQLLEQRRNAIERR 439

Query: 507 GLNFEDIEMEKELVENLLEQEI 528
           G+N +++E E+E + NLLEQE+
Sbjct: 440 GINMQNLEQEREQLGNLLEQEL 461

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
            YCL061C (MRC1) - protein involved in replication
            checkpoint [contig 123] FULL
          Length = 970

 Score =  132 bits (331), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 113/362 (31%), Positives = 164/362 (45%), Gaps = 51/362 (14%)

Query: 740  WHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKILYDIX 799
            W G+GG DGE SD YDS++++MIDDYS    DP  +R+ L  E K  D +M+++IL+DI 
Sbjct: 650  WFGVGGADGENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIE 709

Query: 800  XXXXXXXXXXXXXXXXXXXXXXXXXREYHXXXXXXXXXXXXXXGDDE-KKLVKNPKSKAF 858
                                     R YH              G+ E   L  NPKSKAF
Sbjct: 710  NGGFRKRGRYAMDLTLSDDEDDDLLR-YHARRKELLNERKS--GNQEISVLATNPKSKAF 766

Query: 859  FESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAAVVKENGDSXXXXXXXXXXS 918
            F+S+ ED  D K    +    ++    +   +D++  +    +                S
Sbjct: 767  FDSIFED--DLKGGIANLKEYQSHASPLKAAKDEISGKRETRI----------------S 808

Query: 919  EEFVQRTLSFLKSSREDE----EFAMNENLAKEQHGTKVE--NLLSLKQQSSIKVFQSPS 972
            E+FVQ+TLSFLKS +EDE    EF    +  +   G   E  +   LKQ S IK F +P 
Sbjct: 809  EQFVQKTLSFLKS-KEDEQGDAEFVSVADTQESSSGDFAEATDFYRLKQLSGIKSFSAPL 867

Query: 973  NNSSKVIKLXXXXXXXXXXXXSPIALFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYR 1032
             +S   I+L            +   L      ++ F    D NEKF++G KTV    SY+
Sbjct: 868  RSS---IRLQVRNKDGVLSGKANTTL------VERFVRSVDTNEKFEEGRKTVKSLNSYK 918

Query: 1033 TVGSSKASITYLGKSRKLMA---PTHSKMKPLRSRVTDNNKITKGERNIGSLFSTGDDSF 1089
              GSS+ASIT+LGK+R L A     H++  P   ++  +++           F++   SF
Sbjct: 919  IAGSSRASITFLGKARSLKARKRGPHARSAPHGQKIMTSHQ----------FFASDGQSF 968

Query: 1090 EN 1091
            EN
Sbjct: 969  EN 970

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 65/94 (69%), Gaps = 2/94 (2%)

Query: 447 SRTSKATILTIKARLSKQKSKKNV--QKDGTVNTNLNKLFENLKKSSRKQILENQRELIE 504
           S +SKA IL +KAR+SK+K    V   K+   + +L  LF +L+K++R Q++E++  L+ 
Sbjct: 335 SLSSKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLL 394

Query: 505 NKGLNFEDIEMEKELVENLLEQEIKRNQKIRQRE 538
            +G++  +I  EKE VE+LLE+E+ RN+K++Q E
Sbjct: 395 LRGVDLAEIAKEKESVESLLERELARNKKVKQEE 428

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 47  TPTILGTGFLFKNSTIDKVRARLSGK--NYIEQEKTPLASSE-----QETQIITNLYTNG 99
            PT+ GTGFLF+NS  ++V+ R+     N I       AS+E      ETQ I   Y +G
Sbjct: 29  CPTVGGTGFLFENSIFNQVKKRIKATDDNEINHNAPTTASTEILKDTCETQAIERPY-DG 87

Query: 100 EDLEKDLI 107
           E+LE D +
Sbjct: 88  EELETDFV 95

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON}
           YCL061C (REAL)
          Length = 1152

 Score =  102 bits (254), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/95 (57%), Positives = 69/95 (72%), Gaps = 2/95 (2%)

Query: 444 LPVSRTSKATILTIKARLSKQKSK--KNVQKDGTVNTNLNKLFENLKKSSRKQILENQRE 501
           LP+SR SKA IL +KARLSKQ     +   K+     + NKLF  L+K+SRKQIL++QRE
Sbjct: 489 LPISRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQILDHQRE 548

Query: 502 LIENKGLNFEDIEMEKELVENLLEQEIKRNQKIRQ 536
           +IE KG   ED+  EKE+VENLLEQEI RN++IRQ
Sbjct: 549 VIETKGFKLEDMAKEKEIVENLLEQEILRNRRIRQ 583

 Score = 68.6 bits (166), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 105/384 (27%), Positives = 163/384 (42%), Gaps = 78/384 (20%)

Query: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60
           MD++++ L  +T  ++ T  KK   P I + ++D     +++     P + G GFLF N+
Sbjct: 56  MDNVLEVLSSLTSKKRVTTYKKIASP-IPDGDDDVDGDLLSNNMGAPPALTGNGFLFGNA 114

Query: 61  TIDKVRARLSGKNYIEQEKTPLASSEQE----TQIITNLYTNGEDLE-----------KD 105
           T+++V+ RL G +  E ++  +  +E E    TQ+I NLY  GEDLE           KD
Sbjct: 115 TLNRVKNRLEGIDVPEDDRQ-IKDNENEDAVSTQLIANLYDGGEDLEETKSMGDNASLKD 173

Query: 106 LIKHIPVSQTQPITNTGERTQLEQEIKVTIDNDSNEMPTQVIGSTERDD---ETAERTQ- 161
            I     +Q  P++      Q E  + V I + +     ++I    RDD    TA +TQ 
Sbjct: 174 GIAAFTQTQRIPVS-----IQSENVVDVPIHSINQGKSARII----RDDGFFSTAAQTQK 224

Query: 162 IGEVATQLIPGDTYDRTSTMQKTQEQLLKTQRIPQNSRDNHNQTNIINESFGSVPFTFTQ 221
           I     ++IP                 + TQRI  +SRD  +QT         VPFT   
Sbjct: 225 IIPATARIIP-----------------VATQRI--HSRDTASQTQ-------QVPFT--- 255

Query: 222 KIKNFETNI--TNENDDFTNG------SKSQTVLISTNVDNVRAEYVDASSSL------L 267
           K    +T I  T  ND  T        +   ++L  T  D V    +D  S +       
Sbjct: 256 KPIEPQTQIIGTTANDSDTQPLRIPVLTAEASLLFQTTPDCVPTIRMDPPSQIEHDKYKT 315

Query: 268 QATAIAATVRDDGPSST-ALVGTVADDKLSSGSNLAIHKFQKXXXXXXQLANNSKYKEYK 326
           Q   +  T  D+G +    +  T+ DD       L I + Q            ++  EYK
Sbjct: 316 QLDTMTQTAHDEGKTQVDTMPQTIHDD---VSHTLKIRELQSELALEDSKREKARNVEYK 372

Query: 327 GISKPILTNIVKFTKDSFLQGFDN 350
              + I T ++ F+K+SFL  FDN
Sbjct: 373 KSRRNIPT-MINFSKESFLADFDN 395

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
           Anc_1.5 YCL061C
          Length = 1161

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 111/248 (44%), Gaps = 25/248 (10%)

Query: 289 TVADDKLSSGSNLAIHKFQKXXXXXXQ--LANNSKYKEYKGISKPILTNIVKFTKDSFLQ 346
           TVADD  S G+ L IH+ Q       +  L    ++++ +G+   +    V+FTK+SF+ 
Sbjct: 404 TVADDVKSGGNTLKIHEIQTQIDEETRNMLNRGVEHRKSRGVPSRVE---VRFTKESFMA 460

Query: 347 GFD-NXXXXXXXXXGDKVKETKRNGKEXXXXXXXXXXXXXXXXXXDGXXXXXXXXXXXXX 405
            F+ +          D++ +T                                       
Sbjct: 461 DFEESDSASDMESDSDQINDT---------------TPETGSSQNSDSNKARKPTEAPKT 505

Query: 406 XXLNTLSRYENKLKTVLNSKNQLQLGXXXXXXXXXX--XXLPVSRTSKATILTIKARLSK 463
             +  LS YE  L+  +N    L LG                VS+ SKA +L IKA    
Sbjct: 506 KRVTGLSSYETILRNKVNDDECLDLGSDDTYSSEEEYDKESKVSQASKAAVLNIKA--KA 563

Query: 464 QKSKKNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENL 523
            K K  V+   T  T L+ LF +LKK +R+QIL +Q E+I  KG+N +D+E EKE+VE+L
Sbjct: 564 LKKKAIVKAANTNKTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDL 623

Query: 524 LEQEIKRN 531
           LEQEI RN
Sbjct: 624 LEQEILRN 631

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 59/110 (53%), Gaps = 17/110 (15%)

Query: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTIL-GTGFLFKN 59
           MD L++    V   R+TTY K   + + E   +D          +  PT L G GFLF N
Sbjct: 1   MDDLLERFNSVKVKRRTTYKKVQQNSTDEAAGDD----------DCVPTSLAGNGFLFGN 50

Query: 60  STIDKVRARLSGKNYIEQ--EKTPLASSEQ----ETQIITNLYTNGEDLE 103
           +T+DK++ RL+ +++     + T  +S +Q    ++Q+++ LY  GEDLE
Sbjct: 51  ATVDKIKNRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGEDLE 100

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.126    0.331 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 98,673,321
Number of extensions: 4204846
Number of successful extensions: 22457
Number of sequences better than 10.0: 220
Number of HSP's gapped: 23240
Number of HSP's successfully gapped: 288
Length of query: 1091
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 971
Effective length of database: 39,721,479
Effective search space: 38569556109
Effective search space used: 38569556109
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 71 (32.0 bits)