Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A001301.4ON47847821190.0
NCAS0B091201.4ON4335005511e-64
TDEL0C069801.4ON4265015241e-60
ZYRO0F18502g1.4ON4503854262e-46
Suva_3.1511.4ON4214983911e-41
KNAG0C001901.4ON4424263815e-40
Skud_3.21.4ON4265173586e-37
YCL063W (VAC17)1.4ON4235083472e-35
SAKL0C00440g1.4ON4623903431e-34
CAGL0B00308g1.4ON4303943384e-34
Smik_3.131.4ON4253903367e-34
Kpol_2002.71.4ON4745133281e-32
TPHA0E040201.4ON5404412966e-28
KLLA0C00462g1.4ON4604112565e-23
TBLA0A075801.4ON5133372141e-17
KAFR0D001201.4ON3993871355e-08
KLTH0F00462g1.4ON4512901285e-07
Kwal_33.130031.4ON4491491205e-06
NCAS0G023802.140ON24026678.1
NOTE: 2 genes in the same pillar as NDAI0A00130 were not hit in these BLAST results
LIST: AFR746C Ecym_1007

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A00130
         (478 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   820   0.0  
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...   216   1e-64
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   206   1e-60
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   168   2e-46
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   155   1e-41
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   151   5e-40
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      142   6e-37
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   138   2e-35
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   136   1e-34
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...   134   4e-34
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   134   7e-34
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   130   1e-32
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...   118   6e-28
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...   103   5e-23
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...    87   1e-17
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    57   5e-08
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    54   5e-07
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    51   5e-06
NCAS0G02380 Chr7 (422008..422730) [723 bp, 240 aa] {ON} Anc_2.14...    30   8.1  

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/478 (87%), Positives = 420/478 (87%)

Query: 1   MSTTLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLA 60
           MSTTLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLA
Sbjct: 1   MSTTLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLA 60

Query: 61  QLNSLIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLXXXXXXXXXX 120
           QLNSLIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDL          
Sbjct: 61  QLNSLIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLSKKNKTTSSS 120

Query: 121 XXXXXXXXXXXXXXXFEPKPLKIIKRTKNDQKVSNTINNDHDLIMQDENLQRPNSLPSSP 180
                          FEPKPLKIIKRTKNDQKVSNTINNDHDLIMQDENLQRPNSLPSSP
Sbjct: 121 ENSSKTASSKSSMESFEPKPLKIIKRTKNDQKVSNTINNDHDLIMQDENLQRPNSLPSSP 180

Query: 181 IEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQFFKSQQRLSIG 240
           IEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQFFKSQQRLSIG
Sbjct: 181 IEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQFFKSQQRLSIG 240

Query: 241 IFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRNDDDFTPLRRYNSHESI 300
           IFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRNDDDFTPLRRYNSHESI
Sbjct: 241 IFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRNDDDFTPLRRYNSHESI 300

Query: 301 LSQKISSTPLIDNNNNLTFNSKLPLYSSIRRPSMQSIHVTSNPIFARSSQGKTSKDLLSS 360
           LSQKISSTPLIDNNNNLTFNSKLPLYSSIRRPSMQSIHVTSNPIFARSSQGKTSKDLLSS
Sbjct: 301 LSQKISSTPLIDNNNNLTFNSKLPLYSSIRRPSMQSIHVTSNPIFARSSQGKTSKDLLSS 360

Query: 361 FVTSSIPRNNNRNIXXXXXXXXXXXXXXXLRDHTINQTSTSSFFGNWNFLNRFXXXXXXX 420
           FVTSSIPRNNNRNI               LRDHTINQTSTSSFFGNWNFLNRF       
Sbjct: 361 FVTSSIPRNNNRNIQTRTKTRTQSRRNNQLRDHTINQTSTSSFFGNWNFLNRFNMITSET 420

Query: 421 XXXXXXXXXXXIPLVNQSRAHNIDVNDTMDSISIKEPVYDNTISLDDLEDALNTELLL 478
                      IPLVNQSRAHNIDVNDTMDSISIKEPVYDNTISLDDLEDALNTELLL
Sbjct: 421 NTTTNRKRNYNIPLVNQSRAHNIDVNDTMDSISIKEPVYDNTISLDDLEDALNTELLL 478

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score =  216 bits (551), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 188/500 (37%), Positives = 253/500 (50%), Gaps = 96/500 (19%)

Query: 5   LQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDN-----------Q 53
           LQDI+ERLL+RSQEAILQLD+WIQR+++ QEL           D   N           +
Sbjct: 4   LQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQFLE 63

Query: 54  QYNVYLAQLNSLIVRVQYIRDKFLHNIN------QLDS--TQDEQKYIENLVYEFKQITL 105
           QYN Y+AQLNSL VRV++IRD  ++  N      QL+S  + DEQKYI++LV+EF+ IT 
Sbjct: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQDITQ 123

Query: 106 KLNDLXXXXXXXXXXXXXXXXXXXXXXXXXFEPKPLKIIKRTKNDQKVSNTINNDHDLIM 165
           KL++L                         F+PKPL+II R+           N H  + 
Sbjct: 124 KLSEL---STVRNPSTASSRSTSTKSSIESFKPKPLRIISRS-----------NTHSHLH 169

Query: 166 QDENLQRPNSL-----PSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIR 220
           Q  +L +  S       SS     S  ++ +N ++LR  KS D   K++T +N       
Sbjct: 170 QQTSLDKKVSFNEDESNSSISHSRSMESLHENSKSLRNTKSMDV-LKRSTFKN------- 221

Query: 221 KFENDTINQFFKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGT 280
              +   ++   S+QRLSI IF  DDD I + +         +Y   ++SDQATVIS GT
Sbjct: 222 ---HSDFSKLLNSRQRLSINIF--DDDLIANED---GNEFYNQY---SDSDQATVISHGT 270

Query: 281 IKRNDDDFTP-LRRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSSIRRPSMQSIHV 339
             R  D  TP LRRYNSHESILS +  +        +   N  LP YSS+R+PSMQS+ V
Sbjct: 271 PIRGAD--TPLLRRYNSHESILSFRKPT-------QSRQPNQILP-YSSVRQPSMQSVAV 320

Query: 340 TSNPIFARSSQGKTSKDLLSSFVTSSIPRNNNRNIXXXXXXXXXXXXXXXLRDHTIN-QT 398
            SNPIF+R     TSKDLLSSF+    P                       R H    + 
Sbjct: 321 NSNPIFSRMRPNATSKDLLSSFINKPQPN----------------------RLHQQKPKP 358

Query: 399 STSSFFGNWNFLNRFXXXXXXXXXXXXXXXXXXIPLVNQSRAHNIDVNDTMDSISIKEPV 458
           +++S FG WNF N+F                      N S ++  + ND   S SI+EPV
Sbjct: 359 NSNSLFGKWNFFNKFNSVTSEIGTTTTQLYP-----TNSSMSNKFNPNDIPSSASIREPV 413

Query: 459 YDNTISLDDLEDALNTELLL 478
           +D+++ L+DL DALNTELLL
Sbjct: 414 FDDSLHLEDLNDALNTELLL 433

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  206 bits (524), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 165/501 (32%), Positives = 243/501 (48%), Gaps = 108/501 (21%)

Query: 5   LQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLNS 64
           L+D++ERLL RSQEAILQL+LWIQR   QQ L  L +S   + D + NQ YNVY+AQLNS
Sbjct: 3   LEDLSERLLTRSQEAILQLELWIQR---QQHLRELEDS---SIDKLGNQ-YNVYIAQLNS 55

Query: 65  LIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLXXXXXXXXXXXXXX 124
           L VR +Y+RDK      +  S  +++KYIE+LV+EF+ IT+KLN+L              
Sbjct: 56  LCVRSEYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNEL----AQSQSIDSTP 111

Query: 125 XXXXXXXXXXXFEPKPLKIIKRTKNDQKV-------------SNTINNDHDLIMQDENLQ 171
                      F+P+PLK+ +R   + K              S   +  HD   ++E + 
Sbjct: 112 SSKSTRSSLGSFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHD--SKEEAVS 169

Query: 172 RPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQFF 231
           +  SLP SP      V ++   +++R+ KS D  T  N+         R ++  +I   F
Sbjct: 170 KCLSLPGSP------VRVTGPTRSIRMAKSYD--TGLNSKNTKKSKGSRDYDVPSI---F 218

Query: 232 KSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRNDDDFTPL 291
           +  QRLSI +FD+ D++                  D+ SDQ TVIS   +  +D    PL
Sbjct: 219 RENQRLSITVFDDFDED-----------------ADSTSDQDTVIS--LVPADDGKGLPL 259

Query: 292 RRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSSI-----RRPSMQSIHVTSNPIFA 346
           RR+NSHESILS K+   P+          S LPL+SS       RPSM+S+ V+S P+F+
Sbjct: 260 RRFNSHESILSTKV--QPI----------SSLPLFSSFLLPSSNRPSMKSVRVSSAPVFS 307

Query: 347 RSSQGKTSKDLLSSFVTSSIPRNNNRNIXXXXXXXXXXXXXXXLRDHTINQTSTSSFFGN 406
           ++S   +S+DLLS+FVT     +N                        I Q +   FF N
Sbjct: 308 KTSAPASSRDLLSTFVTRPGKASNATG---------------------IKQENKLGFFAN 346

Query: 407 WNFLNRFXXXXXXXXXXXXXXXXXXIPLVNQSRAHNIDVNDTMDSIS---------IKEP 457
           WNF  +                    P  N +       + T++ ++         +K P
Sbjct: 347 WNFF-KGPSSASHDIRATKQKASASRPESNSADCR----SKTLEKMAPRRFSPRSPVKAP 401

Query: 458 VYDNTISLDDLEDALNTELLL 478
           V+D+ IS +DL +AL+TE++L
Sbjct: 402 VFDSLISYEDLREALSTEIIL 422

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  168 bits (426), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 133/385 (34%), Positives = 196/385 (50%), Gaps = 72/385 (18%)

Query: 4   TLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQ---QYNVYLA 60
           +L DI+ERL IRSQEA+LQL+LWI+R   QQ LS       I ++H  ++   QYN+Y+A
Sbjct: 3   SLDDISERLFIRSQEAVLQLELWIRR---QQHLS------EIEHEHARDKIADQYNLYMA 53

Query: 61  QLNSLIVRVQYIRDKFLHNI-NQLDSTQDEQKYIENLVYEFKQITLKLNDLXXXXXXXXX 119
           QLNSL VR +Y+RDK      N+     +EQ YIE+LVYEF+ IT+KLN+L         
Sbjct: 54  QLNSLCVRSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNEL----AQNQK 109

Query: 120 XXXXXXXXXXXXXXXXFEPKPLKIIKRTKND----QKVSNTINND-HDLIMQDENL---- 170
                           F+P+PLKI +R + D    ++    IN    ++   +E+L    
Sbjct: 110 EQVTPSSKHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELF 169

Query: 171 --QRPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTIN 228
              +  SLP SP++  S   +   ++ LR+ KS D     N+        ++K + + + 
Sbjct: 170 CPSKCTSLPGSPLKMRSPDRLP--DRPLRVAKSYDTGLNPNSRAK-----LKKQKEEEML 222

Query: 229 QFFKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRN---- 284
             FK  QRLSI   D+ D+                  +D+ SDQ TVIS   I  +    
Sbjct: 223 SVFKENQRLSITFCDDIDEG-----------------SDSASDQNTVISTSPIPPSHPIQ 265

Query: 285 ---DDDFTPLRRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSSIR---RPSMQSIH 338
                +  PLRRYNSH+S+LS K+              ++K P + +I    RPSM+S+ 
Sbjct: 266 YDVQSEKPPLRRYNSHDSVLSTKVQP----------ISSAKCPTFLTIPTANRPSMKSVT 315

Query: 339 VTSNPIFARSSQGKTSKDLLSSFVT 363
           V+S PI + +    +SKDLLSSF++
Sbjct: 316 VSSAPIISSTGGKASSKDLLSSFIS 340

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  155 bits (391), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 158/498 (31%), Positives = 227/498 (45%), Gaps = 97/498 (19%)

Query: 1   MST-TLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYL 59
           M+T  L+DITERLL RS+EAILQLDLWIQR   QQ  S    S+  + D + +QQYN Y+
Sbjct: 1   MATQALEDITERLLTRSEEAILQLDLWIQR---QQRSSVCEPSDRDSLDKL-SQQYNQYM 56

Query: 60  AQLNSLIVRVQYIRDKF-LHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLXXXXXXXX 118
           +QLNSL VR + +RDK       +L++ ++E K IE+LV+EF+ IT++LNDL        
Sbjct: 57  SQLNSLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDL--ATVPNK 114

Query: 119 XXXXXXXXXXXXXXXXXFEPKPLKIIKRTK-------NDQKVSNTINNDHDLIMQDENLQ 171
                            F+P+PLKII+R +          K S   N  +D+    E   
Sbjct: 115 ASNDSPQSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDV----ECPS 170

Query: 172 RPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQFF 231
           + NSLP SP ++            LR  KS D  T  N S+  +         D    FF
Sbjct: 171 KTNSLPCSPKKQPGKA------HTLRAAKSHD--TGLNKSKKPS-------STDAYESFF 215

Query: 232 KSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRNDDDFTPL 291
           K++QRLS+  F  D+ +    +    T I     T ++ D AT   +G       +F PL
Sbjct: 216 KNKQRLSLTFF--DEMDDEDLDSDQDTIILPNISTPSHMDMAT---KGA------EFEPL 264

Query: 292 RRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSSIRRPSMQSIHVTSNPIFARS--- 348
           RRYNSHESILS K +    +   +   F    P + +    S+ ++ V   P  A S   
Sbjct: 265 RRYNSHESILSNKPAPAMSLSLGSFPFFKPSNPTFGT----SVSNVQVNYRPKMAASMIP 320

Query: 349 ----SQGKTSKDLLSSFVTSSIPRNNNRNIXXXXXXXXXXXXXXXLRDHTINQTSTSSFF 404
               S+  TSK LLSSF+        +R +                    + Q ST+   
Sbjct: 321 KRNGSRAPTSKALLSSFIAQP-----DRIV--------------------VKQKSTN--L 353

Query: 405 GNWNFLNRFXXXXXXXXXXXXXXXXXXIPLVNQSRAHNIDVNDTMDSISIKEP----VYD 460
            + +FL++F                      N+    + D+ND      I       + D
Sbjct: 354 KHTSFLDKFNSSLSTISES----------FQNKKGKKSSDLNDDRIPPHIMPEHNNNLMD 403

Query: 461 NTISLDDLEDALNTELLL 478
             +S+++L+DALNTELLL
Sbjct: 404 MGVSIEELQDALNTELLL 421

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  151 bits (381), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 131/426 (30%), Positives = 192/426 (45%), Gaps = 89/426 (20%)

Query: 4   TLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDN--QQYNVYLAQ 61
            L+D+T+RLLIRSQ+AILQL+LW+Q    QQE   L +  ++     +   QQ N++L+Q
Sbjct: 3   CLEDVTDRLLIRSQDAILQLELWVQ----QQEKLLLTDHASVDRKKFEAIAQQRNLHLSQ 58

Query: 62  LNSLIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLXXXXXXXXXXX 121
           LNSL +R +YI++K     N     +  + YIENLVYEF+ I + LN+L           
Sbjct: 59  LNSLCLRSRYIKEKLASERNICSIRKGRRSYIENLVYEFQDIAMSLNEL----SETNRKN 114

Query: 122 XXXXXXXXXXXXXXFEPKPLKIIKRTKNDQKVSNTINNDHDLIMQDENLQR--------- 172
                         FEPKPL+I++R +     S T  N + + +  E  +          
Sbjct: 115 GSPVSQATTNSSDSFEPKPLRILERQRTCNAKSPTKRNSNHIKIPRETEKSDFTENVADC 174

Query: 173 -PNSLPSSPIEKSSYVTISQNEQNLRLMKS--QDFSTKKNTSRNTNYNTIRKFENDTINQ 229
             +SLPSSP+  S     + ++Q +RL KS  +  + +K TS +   N            
Sbjct: 175 LHSSLPSSPLRGS-----NGSQQTIRLTKSYHESLNGQKPTSHSPLMNP----------- 218

Query: 230 FFKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRNDDDFT 289
            F ++ RLS+ +FDN D+   +               D+NSDQ TV+    +      F 
Sbjct: 219 -FNAKNRLSLYLFDNIDEKELTP------------CDDDNSDQETVMYNSPVVSKGAAFE 265

Query: 290 PLRRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSSI--RRPSMQSIHVTSNPIFAR 347
           PLRRYNSHESILS      P+  +   L F      Y S      S QS+ V+S P++ +
Sbjct: 266 PLRRYNSHESILSV-AKKAPIHSSAQKLQF------YPSATNGTTSAQSVFVSSKPVYTK 318

Query: 348 S-SQGKTSKDLLSSFVTSSIPRNNNRNIXXXXXXXXXXXXXXXLRDHTINQTSTSSFFGN 406
             S    SKDLLSS   +   ++                            T T+S F  
Sbjct: 319 PLSVQSRSKDLLSSIAHAEASKD----------------------------TKTTSVFNG 350

Query: 407 WNFLNR 412
           WN   +
Sbjct: 351 WNLFGK 356

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  142 bits (358), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 157/517 (30%), Positives = 223/517 (43%), Gaps = 130/517 (25%)

Query: 1   MST-TLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYL 59
           M+T  L+DITERLLIRSQEAILQLDLWIQR   QQ  S    S+  + D + +QQYN Y+
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQR---QQRSSVCQTSDQESLDKL-SQQYNQYM 56

Query: 60  AQLNSLIVRVQYIRDKFLHNINQLDSTQD-EQKYIENLVYEFKQITLKLNDLXXXXXXXX 118
           +QLNSL VR + +RDK      +   T+D E + IE+LV+EF+ IT +LN+L        
Sbjct: 57  SQLNSLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNEL--ATVPHG 114

Query: 119 XXXXXXXXXXXXXXXXXFEPKPLKIIKRTK-------NDQKVSNTINNDHDLIMQDENLQ 171
                            F+P+PLKII+R +          K S   N  +D+    +   
Sbjct: 115 VSNDSPQSQSTRSSSGSFQPRPLKIIERQRVCMVTPSKPPKKSVGFNPINDV----DCPS 170

Query: 172 RPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFEN-DTINQF 230
           + NSLP SP +  +        + LR  KS D          T  N  +K  + D    F
Sbjct: 171 KTNSLPCSPKKPPA------KNRTLRAAKSHD----------TGLNKSKKMSSTDAYESF 214

Query: 231 FKSQQRLSIGIFDN--------DDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIK 282
           FK++QRLS+  FD         D D I   N+ T   +              V ++G   
Sbjct: 215 FKNKQRLSLTFFDEMDDEDLDSDQDTIILPNISTPPHM-------------NVTAKGA-- 259

Query: 283 RNDDDFTPLRRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSSIRRPSMQS------ 336
               +F PLRRYNSHESILS K    P++    +L+         S  +PS  +      
Sbjct: 260 ----EFEPLRRYNSHESILSNK--PAPIM----SLSLGG---FPGSFYKPSHPTFGTSTS 306

Query: 337 -IHVTSNPIFARS-------SQGKTSKDLLSSFVTSSIPRNNNRNIXXXXXXXXXXXXXX 388
            + V  +P    S           +SK LLSSF+                          
Sbjct: 307 NVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIA------------------------- 341

Query: 389 XLRDHTINQTSTSSFFGNWNFLNRFXXXXXXXXXXXXXXXXXXIPLVNQSRAHNIDVNDT 448
             R   I      +   + +FL++F                      N+    N DVND 
Sbjct: 342 --RPDRIAAKQDPTNLKHTSFLDKFNSSLSTISES----------FQNKKGKKNKDVNDG 389

Query: 449 ----MDSISIKEP---VYDNTISLDDLEDALNTELLL 478
               ++ I+ +E    + D ++S+++L+DALNTELL 
Sbjct: 390 RISNLNHIATQEQKKNIMDMSVSIEELQDALNTELLF 426

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  138 bits (347), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 158/508 (31%), Positives = 227/508 (44%), Gaps = 115/508 (22%)

Query: 1   MST-TLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYL 59
           M+T  L+DITERLLIRSQEAILQLDLWIQR   QQ  S    ++  + D + +QQYN Y+
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQR---QQRSSICQTTDQESLDKL-SQQYNQYM 56

Query: 60  AQLNSLIVRVQYIRDKFLHNINQLDSTQD-EQKYIENLVYEFKQITLKLNDLXXXXXXXX 118
           +QLNSL VR + +RDK      +   T+D E + IE+LV EF+ ITL+LN+L        
Sbjct: 57  SQLNSLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAP 116

Query: 119 XXXXXXXXXXXXXXXXXFEPKPLKIIKRTK-------NDQKVSNTINNDHDLIMQDENLQ 171
                            F+P+PLKII+R +          K S   N     I + +   
Sbjct: 117 NDSPQSQSTRSSLGS--FQPRPLKIIERQRLCMVTPSKPPKKSVGFNP----INEVDCPS 170

Query: 172 RPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQFF 231
           + NSLP SP ++ +        + LR  KS D  T  N S+  +        +DT   FF
Sbjct: 171 KTNSLPCSPKKQPA------RNRTLRAAKSHD--TGLNKSKKPS-------SSDTYESFF 215

Query: 232 KSQQRLSI--------GIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKR 283
           K++QRLS+          FD+D D I   N+ T   +              V ++G    
Sbjct: 216 KNRQRLSLTFFDEMDDEDFDSDQDTIILPNISTPPHVG-------------VTAKGA--- 259

Query: 284 NDDDFTPLRRYNSHESILSQKISSTPLIDNNNNLT------FNSKLPLYSSIRRPSMQSI 337
              +F PLRRYNSHESILS K    P    + NL       F    P + +    S+ ++
Sbjct: 260 ---EFEPLRRYNSHESILSNK----PAPSKSLNLGSFSASFFRPSNPTFGT----SISNV 308

Query: 338 HVTSNPI----FARSSQGK---TSKDLLSSFVTSSIPRNNNRNIXXXXXXXXXXXXXXXL 390
            V  +P      A S  G    +SK LLSSF+  S                         
Sbjct: 309 QVNCHPTVAATMAPSRNGPRISSSKALLSSFIARS------------------------- 343

Query: 391 RDHTINQTSTSSFFGNWNFLNRFXXXXXXXXXXXXXXXXXXIPLVNQSRAHNIDVNDTMD 450
             HT+ + +T+    + +F+++F                     +N+ R  N +V     
Sbjct: 344 DTHTVKENNTN--LKHASFMDKFNSSLSTISESFQSKRGRKNKGMNEERISNHNVAQEQK 401

Query: 451 SISIKEPVYDNTISLDDLEDALNTELLL 478
           +        D ++S+++L+DALNTELL 
Sbjct: 402 N------NMDISVSIEELQDALNTELLF 423

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  136 bits (343), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 126/390 (32%), Positives = 184/390 (47%), Gaps = 72/390 (18%)

Query: 5   LQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLNS 64
           L +I+++LL+RSQEAILQLDL+IQR+++  E  TL+  +N     +  Q+Y   LAQLNS
Sbjct: 4   LHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKL--QEYQTCLAQLNS 61

Query: 65  LIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLXXXXXXXXXXXXXX 124
           L +R +++RD+     ++     D    I +LV EF++IT KLN+L              
Sbjct: 62  LHIRSEHLRDRIASTDHRASQDGDS---IGHLVTEFQKITTKLNEL----AATQDRAYQS 114

Query: 125 XXXXXXXXXXXFEPKPLKIIKRTKNDQKVSNT--------------INNDHDLIMQDENL 170
                      FEPKPLKI++RTK     S T               N   D  +     
Sbjct: 115 PGSQSTKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH 174

Query: 171 QRPNSLPSSP-IEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQ 229
            +  SLP SP +  SS V+I Q E+  R  KS D    K   R       R+  ++ +N 
Sbjct: 175 SKSTSLPGSPSMAASSPVSI-QQERFPRHAKSCDAGLNKQQRR-------RQDSDNRLN- 225

Query: 230 FFKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVIS----QGTIKRND 285
           FFK  QRLSI  FD++                     D +SD+ TVIS    + T  +  
Sbjct: 226 FFKENQRLSISFFDDE--------------------IDYSSDEDTVISVSPPETTSFKGF 265

Query: 286 DDFTPLRRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSS---IRRPSMQSIHVTSN 342
               PLRRYNSHES+LS+K    P         F+    L++      +P  +S+ +   
Sbjct: 266 PKAEPLRRYNSHESVLSRK-EVLPAALPARAGWFS----LWAGRNNKPKPMAESVSINDK 320

Query: 343 PIF-------ARSSQGKTSKDLLSSFVTSS 365
           P++       + S   +TSKDLL+ FV+++
Sbjct: 321 PVYSTAALLRSHSKTTETSKDLLAQFVSAA 350

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score =  134 bits (338), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 129/394 (32%), Positives = 196/394 (49%), Gaps = 58/394 (14%)

Query: 3   TTLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQL 62
            +L++ITERLL RS EAI QLD WI  + K + +S  N S   + + +D+ +Y  +L +L
Sbjct: 2   ASLEEITERLLERSNEAIEQLDEWILLQNKNRHISE-NKSGLDSIERLDD-KYTEFLEKL 59

Query: 63  NSLIVRVQYIRDKFLHNINQLDSTQDEQ---KYIENLVYEFKQITLKLNDLXXXXXXXXX 119
           NSL +R QYI+DK     N   + +  +     I+ L+ EFK+ITL LN++         
Sbjct: 60  NSLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNS 119

Query: 120 XXXXXXXXXXXXXXXXFEPKPLKIIKRTKNDQKVSNTINNDHDL----IMQDENLQRPNS 175
                           F PKPLKI+ R    +   N+     ++    I ++ ++    S
Sbjct: 120 KQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENLSVTEYES 179

Query: 176 LPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQFFKSQQ 235
           LPSSP  +S+ +     EQ   L  ++ F T   T +       RK + + ++++FK +Q
Sbjct: 180 LPSSP-NRSNLL----EEQEQVLHPARSFQTGLRTEK------ARKPDKNQLDKYFKDKQ 228

Query: 236 RLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNN-SDQATVI--SQGTIKRND--DDFTP 290
           RLS+ +F            G+A    GE L +N+ SD+ TVI  S   I+ +   DD  P
Sbjct: 229 RLSLTLF------------GSADADDGESLNNNDYSDEETVIFTSSSNIETDAITDDMKP 276

Query: 291 LRRYNSHESILSQKISSTPLIDNNNNLTFNSKLP-----LYSSIRR----PSMQSIHVTS 341
           +RR NSHES+LS      P   NNNNL F ++L      L +S  R    PS+Q+I V+ 
Sbjct: 277 IRRCNSHESVLSVHNKFVP--KNNNNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSG 334

Query: 342 NPIFARSSQ----------GKTSKDLLSSFVTSS 365
               +R S+           KTSKDLL+S +T++
Sbjct: 335 TSTLSRFSREQDREMTQLGSKTSKDLLTSVMTAT 368

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  134 bits (336), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 131/390 (33%), Positives = 180/390 (46%), Gaps = 79/390 (20%)

Query: 4   TLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLN 63
            L+DITERLLIRSQEAILQLDLWIQR   QQ  S    ++    D V ++QYN Y++QLN
Sbjct: 5   ALEDITERLLIRSQEAILQLDLWIQR---QQRSSVCQTTDQELLDKV-SKQYNQYMSQLN 60

Query: 64  SLIVRVQYIRDKFLHNINQLDSTQD-EQKYIENLVYEFKQITLKLNDLXXXXXXXXXXXX 122
           SL VR + +RDK      +   T+D E + IE+LV EF+ ITL+LN+L            
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNEL--ATAPNEVAND 118

Query: 123 XXXXXXXXXXXXXFEPKPLKIIKRTK-------NDQKVSNTINNDHDLIMQDENLQRPNS 175
                        F+P+PLKII+R +          K S   N  +D+    +   + NS
Sbjct: 119 SPQSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINDV----DCPSKTNS 174

Query: 176 LPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFEN-DTINQFFKSQ 234
           LP SP ++ +          LR  KS D          T  N  +K  + D    FFK++
Sbjct: 175 LPCSPKKQPA------KNHTLRAAKSHD----------TGLNKSKKPSSADAYESFFKNR 218

Query: 235 QRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRNDDDFTPLRRY 294
           QRLS+  FD  DD  + ++  T           +      V ++G       +F PLRRY
Sbjct: 219 QRLSLTFFDEMDDEDFDSDQDTVI-----LPNISTPPHVNVTAKGA------EFEPLRRY 267

Query: 295 NSHESILSQKISSTPLIDNN-----------NNLTFNSKL--------PLYSSIRRPSMQ 335
           NSHESILS K    PL+ ++           +N TF + +        P  ++   P   
Sbjct: 268 NSHESILSNK--PAPLMSHSLGSFPVSFFKPSNPTFGTSISNVQANCHPTITATMAPRRN 325

Query: 336 SIHVTSNPIFARSSQGKTSKDLLSSFVTSS 365
            +H  S            SK LLSSF+  S
Sbjct: 326 GVHAPS------------SKALLSSFIGRS 343

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 19/21 (90%)

Query: 458 VYDNTISLDDLEDALNTELLL 478
           + D ++S+++L+DALNTELLL
Sbjct: 405 IMDMSVSIEELQDALNTELLL 425

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  130 bits (328), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 154/513 (30%), Positives = 233/513 (45%), Gaps = 84/513 (16%)

Query: 5   LQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLNS 64
           + D++ERLL+RSQEAILQLDLWIQR+++  E    ++ N++  + V +  YN+Y++QLNS
Sbjct: 6   IDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDL--EKVTD-TYNLYMSQLNS 62

Query: 65  LIVRVQYIRDKF----------LHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLXXXX 114
           L +R Q +RDK           +  ++      + Q  IE+L++EF+ IT KLN L    
Sbjct: 63  LYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVL---A 119

Query: 115 XXXXXXXXXXXXXXXXXXXXXFEPKPLKI-IKRTKN-DQKVSNTINNDHDLIMQDENLQR 172
                                F+PKPLKI +KR K+  ++   T+  D + +  D N+  
Sbjct: 120 SSRRRCSSSKSSSSRSSSIGSFQPKPLKISLKRNKSLKEQNKKTVTFDVEEVT-DLNINS 178

Query: 173 PNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTI-NQFF 231
             SLP SP+        S    N  L +++ + T  N+ R+      +K + D++ +  F
Sbjct: 179 VISLPGSPLRNEQ----SSPPMNHHLRQAKSYDTGLNSKRSIK---PKKSKIDSVYDSTF 231

Query: 232 KSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRND------ 285
           K+ QRLSI +FD D      TN    T I         SDQ TVIS  ++  ++      
Sbjct: 232 KNTQRLSISLFDID------TNENDITNI---------SDQETVISSSSLTMDEPLEIID 276

Query: 286 ---DDFTPLRRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSSIRRPSMQS-IHVTS 341
              ++  PLRRYNSHESILS KI    +        F S     +S    +  S   V +
Sbjct: 277 DQKNNLKPLRRYNSHESILSTKIRPISISKRFQIGPFRSVSTTTTSTNYDTTASNTDVKA 336

Query: 342 NPIFARS-SQGKTSKDLLSSFVTSSIPRNNNRNIXXXXXXXXXXXXXXXLRDHTINQTST 400
           +  +  + S   TSKD+LS +   +  +N+NR                 + ++     S+
Sbjct: 337 DDFYKPNLSNSTTSKDILSMYSIKNDVQNSNRG---------------NIINNKKESNSS 381

Query: 401 SSFFGNWNFLNRFXXXXXXXXXXXXXXXXXXIPLVNQSRAH--------------NIDVN 446
           +SFF  WN  N F                      +Q +                 I  N
Sbjct: 382 TSFFNKWNIFN-FPLIASSEVGSKQENNTTAKHFGSQRKKQISSLSYNKANYSTMTIGPN 440

Query: 447 DTM-DSISIKEPVYDNTISLDDLEDALNTELLL 478
            +M  S +I EP + NT+S  +L DALNTEL L
Sbjct: 441 GSMFCSPTIYEPTFSNTVSFQELHDALNTELDL 473

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score =  118 bits (296), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 123/441 (27%), Positives = 192/441 (43%), Gaps = 99/441 (22%)

Query: 1   MSTTLQDITERLLIRSQEAILQLDLWIQREKKQQ---ELSTLNNSNNITYDHVD-----N 52
           +++ L++++E+LLIRSQEAILQLDLWI R+++Q       T  ++ N T D  +      
Sbjct: 4   LNSNLEELSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALR 63

Query: 53  QQYNVYLAQLNSLIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLXX 112
             Y++Y++QLNSL VR ++IRDK     N ++    + + IE LV+EF+ I  KLN L  
Sbjct: 64  STYDLYMSQLNSLYVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAA 123

Query: 113 XXXXXXXXXXXXXXXXXXXXXXXFEPKPLKIIKRTKNDQKVSNTINNDHDLIMQDENLQR 172
                                     KPLK++ +              H+  M  E L+ 
Sbjct: 124 SSKLDKHSPPKTSTRSSSMESMNL--KPLKVVAK--------------HEKRMSKE-LEL 166

Query: 173 PNSLPSSPIEKSSYVTISQNEQNLRLMKSQD--------------------FSTKKNTSR 212
            N   S    K + ++++ N    +LM   D                    + T  N+  
Sbjct: 167 KNKEKSVTFGKETRISLTTNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLNSKS 226

Query: 213 NTNYNTIRKF--ENDTI-NQFFKSQQRLSIGIFDNDDDNIYSTNMG----TATRITGEYL 265
            +N  + R++  +ND   +  FK++QR SI +F++  D   +TN      T        L
Sbjct: 227 KSNKRSNREYRKKNDAAYDSLFKNKQRFSISLFEDYVDTTTNTNYNEFNPTVDASINTEL 286

Query: 266 TDNNSDQATVISQGTI-------------------------KRNDDDFTPLRRYNSHESI 300
            +NNSDQ TVIS   +                           N+   + LRR NSHESI
Sbjct: 287 IENNSDQETVISSSHLPCITNEPLDDYILSNSIQLDKNNNSGNNEGKKSHLRRCNSHESI 346

Query: 301 LSQKISSTPLIDNNNNLTFNSKLPLYSSIRRPSMQSIHVTSNPI---------------- 344
           LS K+ +T   +  +N  F  +  ++SS  RP++ S+  TS  I                
Sbjct: 347 LSTKLENTFYKNVGSN--FYDRF-IFSSFYRPTVASVSTTSTNIEPFLSDGKNESPNKNL 403

Query: 345 ---FARSSQGKTSKDLLSSFV 362
                 S++G TS++LLS F 
Sbjct: 404 QLPLTSSTRGVTSRELLSKFA 424

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score =  103 bits (256), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 106/411 (25%), Positives = 180/411 (43%), Gaps = 110/411 (26%)

Query: 5   LQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLNS 64
           ++ + ERL+IR  EA++QL+L IQR+     +   + +N+  +  V  Q+Y  +LA+L+S
Sbjct: 4   MRYVAERLVIRCNEAVMQLELSIQRK-----MCEFDPNNSHCFIQV--QEYYSFLARLSS 56

Query: 65  LIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLXXXXXXXXXXXXXX 124
           L +R +++++   H     +    E + +E L+YEF+ IT+ LN++              
Sbjct: 57  LKLRAEHVQESLRHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTKSARSG 116

Query: 125 XXXXXXXXXXXFEPKPLKIIKRTKND--------QKVSNTINNDH--------------- 161
                         K LKII+R ++         + +S     +H               
Sbjct: 117 SSKESSVIPL----KTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQED 172

Query: 162 --DLIMQDENLQRPNSLPSSPIEKSSYVT--ISQNEQNLRLMKSQDFSTKKNTSRNTNYN 217
             D++    +++R NSLP SP+  +   +   S+  + LR+ KS D        +N ++ 
Sbjct: 173 DLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKKNADW- 231

Query: 218 TIRKFENDTINQFFKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVIS 277
                      +FFK++ RLS+ +FD+                    +  + SD+ TVIS
Sbjct: 232 -----------EFFKNKNRLSLSVFDD--------------------VNTDASDEETVIS 260

Query: 278 QGT------IKRNDDDFTP--LRRYNSHESILSQKI--SSTPLIDNNNNLTFNSKLPLYS 327
                    + +N+D +    +RR NSHESILS+KI   STP      NL          
Sbjct: 261 VSPPNISYYLSQNEDQYPSKQVRRCNSHESILSRKILSPSTPA-----NL---------- 305

Query: 328 SIRRPSMQSI----HVTSNPIFARSSQGKT----------SKDLLSSFVTS 364
            I RP+ QS+     + + P  + S+   T          SKD+LS FVT+
Sbjct: 306 -IMRPTYQSVWQKKAIVTKPTISCSTSNSTASPTIGSPHLSKDMLSQFVTA 355

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 98/337 (29%), Positives = 158/337 (46%), Gaps = 73/337 (21%)

Query: 6   QDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLNSL 65
           ++++ RLL ++QEA+LQLDLWI+ ++  Q    L  S + + +  + + YN Y+ QLNSL
Sbjct: 5   EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAE-RDYNRYMFQLNSL 63

Query: 66  IVRVQYIRDKF----LHNINQLDSTQDE---QKYIENLVYEFKQITLKLNDLXXXXXXXX 118
            +R QYIRDK      +N+   D   ++     Y++ LV EF  +++K+N+L        
Sbjct: 64  YLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQENVT 123

Query: 119 XXXXXXXXXXXXXXXX------XFEPKPLKIIKRTKNDQKVSNTINNDHDLIMQDENLQR 172
                                  F+P+PLKI++R K+        NN+ +   Q + L+ 
Sbjct: 124 NGSSPLSNKSSHSNDSLSKITDGFQPRPLKILQRQKH--------NNNQNTHPQPD-LES 174

Query: 173 PNSLPSSPIEKSSY-VTISQNEQNLRLMKSQDFSTKKNTSRNTNYNT------IRKFEND 225
           P  L      +SSY   +S N++  +  K  +F++KK  S+N    +      I+ FE  
Sbjct: 175 PLKL----KHRSSYNKLLSSNKKESKPYK--NFNSKK--SKNNELLSDISPVKIQSFEEP 226

Query: 226 TIN---------------QFFKSQQRLSIGI---FDNDDDNIYSTNMGTATRITGEYLTD 267
           T +                 FK+  RLSI     +DNDD+    T +             
Sbjct: 227 TFSVANTRNKNSMDPLHYSLFKTNNRLSIQFPDGYDNDDEYDDPTCI------------- 273

Query: 268 NNSDQATV-ISQGTIKRNDDDFT-PLRRYNSHESILS 302
             SDQ T+ +S   I  +  + + PLR++NSHESILS
Sbjct: 274 --SDQDTIFVSTPKIASSIKNTSEPLRKFNSHESILS 308

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 97/387 (25%), Positives = 162/387 (41%), Gaps = 123/387 (31%)

Query: 8   ITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLNSLIV 67
           +++ LL RS+EA+ QL+ W+   K+Q++L            H    +Y     QLNSL  
Sbjct: 5   VSDTLLQRSEEAVSQLESWL---KQQEQL------------HQTTAEY----KQLNSLCA 45

Query: 68  RVQYIRDKFLHNINQLDSTQDEQK----YIENLVYEFKQITLKLNDLXXXXXXXXXXXXX 123
           + +YI +    + + +     EQK     +E+L++EF +I+ KLN++             
Sbjct: 46  KSKYISNLLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEI------------- 92

Query: 124 XXXXXXXXXXXXFEPKPLKIIK---------------RTKNDQKVSNTINNDHDLIMQDE 168
                       FEPKPL +++               R + ++K+S  IN     +    
Sbjct: 93  VTHTSPQSTIDSFEPKPLNLLRKNKILESPTRSSPVTRGRLERKIS--IN-----LFPMH 145

Query: 169 NLQRPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTIN 228
              + NS+P+SP  KS   T + N++ LR +KS  +                    D IN
Sbjct: 146 TTTKCNSVPTSPKCKS---TSTLNQRTLRNIKSYHYG----------------LNGDYIN 186

Query: 229 QFFKSQQRLSIGIF-------DNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTI 281
             FK   RLSI  F       DN+ D+    +      +T  +LT  N  Q         
Sbjct: 187 P-FKENNRLSISFFNGDNTFNDNNSDSESDIDDDDTVLVTSPFLT--NPKQK-------- 235

Query: 282 KRNDDDFTPLRRYNSHESILSQKISSTPLIDNNNNL---TFNSKLPLY-SSIRRPSMQSI 337
                    L+R NS +S+            N N L   +F  +L L+ S++ +P+ +  
Sbjct: 236 ---------LKRSNSQDSVFW----------NENYLRKPSFQKQLNLFPSTLTKPTAE-- 274

Query: 338 HVTSNPIFARSSQ--GKTSKDLLSSFV 362
            ++S  +F +++   G +SK LL+SFV
Sbjct: 275 -LSSTQVFLKNTGRLGSSSKALLTSFV 300

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 116/290 (40%), Gaps = 51/290 (17%)

Query: 5   LQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLNS 64
           LQ+I +  L  SQ A+ +LD  ++R+++  E S   +         +  QY  Y+ QL S
Sbjct: 4   LQEIAQESLALSQSALARLDSCLERQRRLYE-SGFPDQCLSDKSSTNMAQYYEYIGQLYS 62

Query: 65  LIVRVQYIRDK-FLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLXXXXXXXXXXXXX 123
           L  + Q + D   L +   L S Q  Q+ IENL+ EF++I    ND              
Sbjct: 63  LYTKAQKLSDTVILSDSKSLSSVQ--QRAIENLIQEFQEIA--KND----ENFISYSMRE 114

Query: 124 XXXXXXXXXXXXFEPKPLKIIKR--------TKNDQKVSNTI---NNDHDLIMQDENLQR 172
                       F+PKPLKI++R        TK   + S ++     D   +    +  +
Sbjct: 115 SPNSMSVQSICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETNLATASDRSQ 174

Query: 173 PNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQFFK 232
              L SSP     +     N   L +  ++      N   N + N +          FFK
Sbjct: 175 ERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNPHENRL---------NFFK 225

Query: 233 SQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIK 282
            +QRLSI   ++++D                      SD+ATVIS G+++
Sbjct: 226 DRQRLSISFIEDEED---------------------VSDEATVISAGSLQ 254

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 67/149 (44%), Gaps = 21/149 (14%)

Query: 5   LQDITERLLIRSQEAILQLDLWIQR-------EKKQQELSTLNNSNNITYDHVDNQQYNV 57
           L  I +  L RS+EA+++L+  + +       E+  Q LS  ++S  +        QY  
Sbjct: 4   LAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIV--------QYYS 55

Query: 58  YLAQLNSLIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLXXXXXXX 117
           YL QLN L ++ Q ++D   +    L ++   Q+ IE L +++K +    N+L       
Sbjct: 56  YLGQLNCLYIKAQSLKDMMGNRCGHLPNST--QEAIERLEHDYKALCNHANEL----GIR 109

Query: 118 XXXXXXXXXXXXXXXXXXFEPKPLKIIKR 146
                             F+PKPLKII+R
Sbjct: 110 EKNLEDSPSCLSPASVSSFQPKPLKIIER 138

>NCAS0G02380 Chr7 (422008..422730) [723 bp, 240 aa] {ON} Anc_2.140
           YNL129W
          Length = 240

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 222 FENDTINQFFKSQQRLSIGIFDNDDD 247
           FEND +   FK  +R +I +FDN DD
Sbjct: 193 FENDDVEGSFKPTKRFNIQLFDNSDD 218

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,645,707
Number of extensions: 2351943
Number of successful extensions: 12110
Number of sequences better than 10.0: 506
Number of HSP's gapped: 12638
Number of HSP's successfully gapped: 550
Length of query: 478
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 365
Effective length of database: 40,524,141
Effective search space: 14791311465
Effective search space used: 14791311465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)