Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A001201.3ON37737717560.0
NCAS0B091301.3ON36737313041e-180
KAFR0D001101.3ON36537112261e-168
Skud_3.11.3ON36036812121e-166
KNAG0C001801.3ON35934411961e-164
YCL064C (CHA1)1.3ON36034511951e-164
Suva_3.1501.3ON36134711951e-164
Smik_3.121.3ON36034111861e-162
Kpol_2002.61.3ON35036411351e-155
TBLA0A049201.3ON36037411141e-151
TPHA0E040401.3ON35735310971e-149
CAGL0B00286g1.3ON36034910761e-146
KAFR0I00130singletonON34434910671e-145
KAFR0F04430singletonON34334510421e-141
ZYRO0F15774gsingletonON41036210191e-136
NCAS0A15330singletonON3473539981e-134
SAKL0C00418g1.3ON3643449501e-126
NDAI0K02950singletonON3343409071e-120
Ecym_10061.3ON3643678431e-110
ZYRO0F18524g1.3ON3353398301e-109
KLTH0F00440g1.3ON3413418291e-109
KNAG0D05380singletonON3343478261e-108
KLLA0C00440g1.3ON3773388121e-106
SAKL0C13904gsingletonON3393368051e-105
Smik_9.2na 1ON3383337991e-104
AFR747W1.3ON4263778001e-103
Scer_YGOB_SDL1 (SDL1)na 1ON3373337672e-99
Skud_9.2na 1ON3393337551e-97
TDEL0D06540singletonON3373357333e-94
KLLA0E01805gsingletonON3223096844e-87
KNAG0A01150singletonON2312205782e-72
YIL167W (SDL1)singletonOFF2101895092e-62
YIL168WsingletonOFF1271312722e-28
SAKL0F11858g7.367ON5622641924e-15
KAFR0K017007.367ON5792641773e-13
NCAS0A142307.367ON5692641684e-12
Suva_5.1997.367ON5762641641e-11
Kpol_530.167.367ON5662641632e-11
YER086W (ILV1)7.367ON5762641604e-11
Skud_5.2057.367ON5762641604e-11
NDAI0A018107.367ON5702641604e-11
ZYRO0B02772g7.367ON5692641586e-11
Smik_5.2257.367ON5762641586e-11
CAGL0I05126g7.367ON5712641587e-11
KLLA0E19779g7.367ON5672641571e-10
TDEL0C018007.367ON5692641551e-10
Ecym_47087.367ON5702681506e-10
ACR232C7.367ON5602801507e-10
TPHA0F031307.367ON5682641507e-10
TBLA0C050707.367ON5752671418e-09
KNAG0C036907.367ON5772641372e-08
Kwal_33.148227.367ON5622641373e-08
KLTH0B04884g7.367ON5732641321e-07
SAKL0A10626gsingletonON3202611158e-06
YKL218C (SRY1)na 2ON326319900.010
NCAS0I011203.357ON159105701.6
NDAI0J017604.131ON44891703.7
Suva_14.10na 3ON37638685.8
KAFR0J010805.242ON32666677.3
KLTH0E16852gsingletonON37555677.5
NCAS0B005908.743ON28933678.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A00120
         (377 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   681   0.0  
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    506   e-180
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   476   e-168
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   471   e-166
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   465   e-164
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   464   e-164
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   464   e-164
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   461   e-162
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   441   e-155
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   433   e-151
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   427   e-149
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   419   e-146
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   415   e-145
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              405   e-141
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   397   e-136
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            389   e-134
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   370   e-126
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             353   e-120
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   329   e-110
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   324   e-109
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   323   e-109
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   322   e-108
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   317   e-106
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   314   e-105
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      312   e-104
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   312   e-103
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   300   2e-99
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      295   1e-97
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            286   3e-94
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   268   4e-87
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   227   2e-72
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   200   2e-62
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   109   2e-28
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    79   4e-15
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    73   3e-13
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    69   4e-12
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    68   1e-11
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    67   2e-11
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    66   4e-11
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    66   4e-11
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    66   4e-11
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    65   6e-11
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    65   6e-11
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    65   7e-11
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    65   1e-10
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    64   1e-10
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    62   6e-10
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    62   7e-10
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    62   7e-10
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    59   8e-09
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    57   2e-08
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    57   3e-08
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    55   1e-07
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    49   8e-06
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    39   0.010
NCAS0I01120 Chr9 complement(205511..205990) [480 bp, 159 aa] {ON...    32   1.6  
NDAI0J01760 Chr10 complement(432212..433558) [1347 bp, 448 aa] {...    32   3.7  
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    31   5.8  
KAFR0J01080 Chr10 (198475..199455) [981 bp, 326 aa] {ON} Anc_5.2...    30   7.3  
KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]...    30   7.5  
NCAS0B00590 Chr2 complement(88134..89003) [870 bp, 289 aa] {ON} ...    30   8.0  

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/377 (88%), Positives = 334/377 (88%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MSVVYNKTPLLRQFFQN              PQFFVKYECLQPSGSFKSRGIGNLILKSA
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
           MNINKIGQKTPQV               CQRLSLPCTVVVPTATKQRMVEKIKSTGANVI
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           INKVKGIVCSV              KYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK
Sbjct: 181 INKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH
Sbjct: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP 360
           LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP
Sbjct: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP 360

Query: 361 NFIDTENTQHFPIDISA 377
           NFIDTENTQHFPIDISA
Sbjct: 361 NFIDTENTQHFPIDISA 377

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  506 bits (1304), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 252/373 (67%), Positives = 286/373 (76%), Gaps = 10/373 (2%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MS+VYNKTPLLRQFF                PQFF+KYECLQPSGSFKSRGIGNLI+K+A
Sbjct: 1   MSIVYNKTPLLRQFFP-----AVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNA 55

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
           + I K G K+PQV                QRLSLPCTVVVPTATKQRMVEKI++TGANVI
Sbjct: 56  IRIKKSGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVI 115

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           INGAHWKEAD +LK+S+MN ID N  EPIYVHPFDNP IWEGH+TMVDEI+D+LN+QNI 
Sbjct: 116 INGAHWKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIA 175

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           +NK+KGIVCSV              K+ LADKIPIVGVETKGCHVFNTSLKL KQIEFSK
Sbjct: 176 LNKIKGIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSK 235

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           ITSIATSLGTA+IS +TFEYA+KY TRSVV+ED +VIETCLKYTQD+NMV EPACGAS+H
Sbjct: 236 ITSIATSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLH 295

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP 360
           LAY+T+ILE +LGHKL+SDDIILVIACGGSSNT  DLE  L+ ++   K        T P
Sbjct: 296 LAYNTNILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAKHE----RITPP 351

Query: 361 NFIDTENTQHFPI 373
            FI+ +  Q  PI
Sbjct: 352 TFIN-DPIQPVPI 363

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  476 bits (1226), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 233/371 (62%), Positives = 275/371 (74%), Gaps = 10/371 (2%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MSVVYNKTPLLRQFF                PQFF+KYECLQPSGSFKSRGIGNLILK A
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSL-----PQFFLKYECLQPSGSFKSRGIGNLILKQA 55

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
           M I+K G K P+V               CQRLSLPCTVVVPTATKQRM+EKIK TGANVI
Sbjct: 56  MQIHKKGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVI 115

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           I+GA WKEAD +LK S+MNKI+ N I+PIYVHPFDNPLIWEGH+++VDEIMD+L +Q + 
Sbjct: 116 IDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQ 175

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
            + +KGIVCSV              ++ L DKIP+VGVET+GCHVFNTSLKL KQ+EF K
Sbjct: 176 PSNIKGIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEK 235

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           ITSIATSL TA+IS KTFE A KY TRSV+++D +VIETCLKYT+DYNMV EPACGASIH
Sbjct: 236 ITSIATSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIH 295

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP 360
           LAY+ DILE +LG KL  DD ++VIACGGSSNT  D+E  LL ++++E     +++ T+P
Sbjct: 296 LAYNIDILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEE-----NAAMTLP 350

Query: 361 NFIDTENTQHF 371
           N     N + F
Sbjct: 351 NPFLKVNKETF 361

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  471 bits (1212), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 233/368 (63%), Positives = 275/368 (74%), Gaps = 15/368 (4%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MS+VYNKTPLLRQFF +               QFF+KYECLQPSGSFKSRGIGNLILK+A
Sbjct: 1   MSIVYNKTPLLRQFFPSKSPA-----------QFFLKYECLQPSGSFKSRGIGNLILKNA 49

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
           + I K G+++PQV               CQRLSLPCTVVVPTATK+RMVEKI++TGA VI
Sbjct: 50  IRIQKDGRRSPQVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVI 109

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           +NGA+WKEAD FLK +IMN+ID+  +EPIYVHPFDNP IWEGH++MVDEI+  L  Q I 
Sbjct: 110 VNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRIS 169

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           +NKVKGIVCSV              +Y+LADKIPIVGVET GCHVFNTSL++ + ++F K
Sbjct: 170 MNKVKGIVCSVGGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKK 229

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           ITSIATSLGTA IS +TFEYA KY T+SVVIEDK+VIETCLKYT   NMV EPACGA++H
Sbjct: 230 ITSIATSLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALH 289

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP 360
           L YHT+ILEK+LG KL +DDI+++IACGGSSNT  DLE  L ++K   KQ L  +  T  
Sbjct: 290 LGYHTEILEKALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLK---KQGL-PAIETAD 345

Query: 361 NFIDTENT 368
           NFI  E T
Sbjct: 346 NFIFVEKT 353

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  465 bits (1196), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 226/344 (65%), Positives = 259/344 (75%), Gaps = 11/344 (3%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MS+VYNKTPLLRQFF                PQ F+KYECLQPSGSFKSRGIGNLILK+A
Sbjct: 1   MSLVYNKTPLLRQFFPGKNL-----------PQLFLKYECLQPSGSFKSRGIGNLILKNA 49

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
           M I KIG++   V               CQRLSLPCTVVVPTATK RMVEKI++TGA VI
Sbjct: 50  MRIQKIGERRAHVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVI 109

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           +NGAHWKEAD  LK ++M++ID    EPIYVHPFDNP IWEGHAT+VDEIM++LN Q I 
Sbjct: 110 VNGAHWKEADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQ 169

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
              VKGIVCSV              K+ LA+KIPIVGVET+GCHV NTSL LNKQIEF K
Sbjct: 170 TENVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEK 229

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           ITSIATSLGTA+ISK+TFE A+KY TRSVV++D  VIETCLKYT+D+NMV EPACGA++H
Sbjct: 230 ITSIATSLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALH 289

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNM 344
           LAY+ DILEK+LGH L  +D+ILVIACGGSSNT  DLE  L+ +
Sbjct: 290 LAYNVDILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTL 333

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  464 bits (1195), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/345 (64%), Positives = 265/345 (76%), Gaps = 11/345 (3%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MS+VYNKTPLLRQFF                 QFF+KYECLQPSGSFKSRGIGNLI+KSA
Sbjct: 1   MSIVYNKTPLLRQFFPGKASA-----------QFFLKYECLQPSGSFKSRGIGNLIMKSA 49

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
           + I K G+++PQV               CQRLSLPCTVVVPTATK+RMV+KI++TGA VI
Sbjct: 50  IRIQKDGKRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVI 109

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           ++GA+WKEAD FLK ++MNKID+  IEPIYVHPFDNP IWEGH++M+DEI+  L  Q+I 
Sbjct: 110 VSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHIS 169

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           +NKVKGIVCSV              +Y LAD+IPIVGVET GCHVFNTSLK+ + ++F K
Sbjct: 170 VNKVKGIVCSVGGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKK 229

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           ITSIATSLGTA IS +TFEYA+KY TRSVVIEDK+VIETCLKYT  +NMV+EPACGA++H
Sbjct: 230 ITSIATSLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALH 289

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMK 345
           L Y+T ILE +LG KL +DDI+++IACGGSSNT  DLE  L +M+
Sbjct: 290 LGYNTKILENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSMR 334

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  464 bits (1195), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/347 (63%), Positives = 263/347 (75%), Gaps = 11/347 (3%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MS+VYNKTPLLRQFF                 QF++KYECLQPSGSFKSRGIGNLILK+A
Sbjct: 1   MSIVYNKTPLLRQFFPGKSLA-----------QFYLKYECLQPSGSFKSRGIGNLILKNA 49

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
           + I K G+++PQV               CQRLSLPCTVVVPTATK+RMVEKI++TGA VI
Sbjct: 50  IRIQKNGKRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVI 109

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           +NGA WKEAD +LK ++MN ID   +EPIYVHPFDNP IWEGH++MVDEI+  L  Q +P
Sbjct: 110 VNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVP 169

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           + KVKGIVCSV              ++ LADKIPIVGVETKGCHVFNTSL++ + ++F K
Sbjct: 170 MEKVKGIVCSVGGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKK 229

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           ITSIATSLGTANIS +TFEYA+KY T+SVV+EDK+VIETCLKY+  +NMV EPACGA++H
Sbjct: 230 ITSIATSLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALH 289

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKAD 347
           L YHTDILE +L  KL +DDI+L+IACGGSSNT  DLE  L +MK +
Sbjct: 290 LGYHTDILETALDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKE 336

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  461 bits (1186), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 219/341 (64%), Positives = 261/341 (76%), Gaps = 11/341 (3%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MS+VYNKTPLLRQFF                 QFF+KYECLQPSGSFKSRGIGNLI+KSA
Sbjct: 1   MSIVYNKTPLLRQFFPGKSPA-----------QFFLKYECLQPSGSFKSRGIGNLIMKSA 49

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
           + I K G+K+PQ+               CQRLSLPCTVVVPTATK+RMVEKI++TGA VI
Sbjct: 50  IRIQKDGKKSPQIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVI 109

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           ++GA+WKEAD FLK  +M KIDT  +EPIYVHPFDNP IWEGH++MVDE++  L  Q I 
Sbjct: 110 VSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRIS 169

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           +NKVKGIVCSV              +Y LADKIPIVGVET GCHVFNTSL++ + ++F K
Sbjct: 170 MNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKK 229

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           ITSIATSLGTA IS +TF+YA+KY TRSVVIEDK+VI+TCLKYT  +NMVVEPACGA++H
Sbjct: 230 ITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALH 289

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLL 341
           L Y+T+ILE++LG KL +DDI+++IACGGSSNT  DLE  L
Sbjct: 290 LGYNTEILERALGSKLAADDIVIIIACGGSSNTIQDLEEAL 330

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  441 bits (1135), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 224/364 (61%), Positives = 272/364 (74%), Gaps = 15/364 (4%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MS+VYNKTPLL+ FF                PQF++KYE LQPSGSFKSRGIGNLILK+A
Sbjct: 1   MSLVYNKTPLLKHFFPGKNL-----------PQFYLKYESLQPSGSFKSRGIGNLILKNA 49

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
           + I KI  K P V                QRLSLPCTVVVPTATK+RMV+KI++TGANVI
Sbjct: 50  IRIKKINVKKPYVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVI 109

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           I G HWKEAD FLK +IMN+I+ + IEPIYVHPFDNPLIWEGH+TMVDEIM++ + Q   
Sbjct: 110 IKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFN 169

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           I  +K IVCSV              KYNLADKIP+VGVET+GCHVFNTSLKLNK +EF+K
Sbjct: 170 IKNLKAIVCSVGGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTK 229

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           I++IATSLGTANIS + F+YA+KY T+SVV+EDK+V+ETCLK+T D+NMV+EPACGA+IH
Sbjct: 230 ISTIATSLGTANISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIH 289

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP 360
           L YHTD+LE +LG KL  DD +L++ACGGSSNT  +LE+ LL +    ++    +S TIP
Sbjct: 290 LGYHTDLLETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQK----ASPTIP 345

Query: 361 NFID 364
           +FID
Sbjct: 346 SFID 349

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  433 bits (1114), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 221/374 (59%), Positives = 261/374 (69%), Gaps = 20/374 (5%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MS+VYNKTPLLRQFF+               PQFF+KYEC+QPSGSFKSRGIGNLILKS 
Sbjct: 1   MSIVYNKTPLLRQFFRGSPI-----------PQFFLKYECMQPSGSFKSRGIGNLILKSI 49

Query: 61  MNINKIG-QKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANV 119
             IN     K PQV                +RLS+PCTVVVPTATK+RMV KIK TGA V
Sbjct: 50  DKINSSNLNKRPQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKV 109

Query: 120 IINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNI 179
           I+NG HW EAD +L+N ++NKID N IEPIYVHPFDNPLIWEGH+TM+DEI++SLN+QNI
Sbjct: 110 IVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNI 169

Query: 180 PINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFS 239
            I  VK I CS+              KYNLA KIPI+GVET GC VFNTSLKL K ++F 
Sbjct: 170 DIRNVKAITCSIGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFP 229

Query: 240 KITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASI 299
           KI +IATSLGT+ IS KTFE A KY T+SVV+++ +VI+TCL+YT D+N V EPACGA++
Sbjct: 230 KINTIATSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAAL 289

Query: 300 HLAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTI 359
           HLAY+T ++E +L   L  DDII+VIACGGSSNT  +LE  LL  K      LD S    
Sbjct: 290 HLAYNTGLIENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYK------LDYSLPQT 343

Query: 360 PNFIDTENTQHFPI 373
           P +I TEN  H PI
Sbjct: 344 PEYIFTEN--HTPI 355

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  427 bits (1097), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 209/353 (59%), Positives = 256/353 (72%), Gaps = 13/353 (3%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MS VYNKTPLLR  F                PQ F+KYEC QPSGSFKSRGIGNLI  ++
Sbjct: 1   MSQVYNKTPLLRHLFPGKNL-----------PQVFLKYECFQPSGSFKSRGIGNLIQSTS 49

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
           + I K  +K+P+V                + LSLPCTVVVPTATK RMVEKIK+TGANVI
Sbjct: 50  LEIQKNSKKSPEVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVI 109

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           + G HWKEAD +LK ++++ ID   IEPIYVHPFDN  IWEGHATM+DEI+++   Q+IP
Sbjct: 110 VKGNHWKEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIP 169

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           I KVK IVCSV              K++LA KIP+VGVET GCHVFNTSLK+ K I+F K
Sbjct: 170 IEKVKAIVCSVGGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEK 229

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           I +IATSLGTANIS +TFEYA+KY T+S+V++D  V+ETCLK+T+D NMV EPACGA++H
Sbjct: 230 INTIATSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALH 289

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLL--LNMKADEKQN 351
           + Y+ DILEKSLG KL +DDI+L+IACGGSSNT  +LE+ L  L  K++EK+N
Sbjct: 290 MGYNMDILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSNEKEN 342

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  419 bits (1076), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 202/349 (57%), Positives = 261/349 (74%), Gaps = 18/349 (5%)

Query: 4   VYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSAMNI 63
           VYNKTPL+RQ F +              PQ ++K+EC QPSGSFKSRGIG+LI K +  I
Sbjct: 3   VYNKTPLIRQIFPSI-------------PQMYLKHECFQPSGSFKSRGIGHLISKQSQRI 49

Query: 64  --NKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVII 121
             N +G+K P V                + L+LPCTVV+PTATKQRM +KI++TGANVI+
Sbjct: 50  LGNGLGKK-PMVFASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIV 108

Query: 122 NGAHWKEADMFLKNSIMNKIDTNH--IEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNI 179
           +G  WKEAD +LK++I++K++  H  +EPIYVHPFDNP IWEGHA+MVDEI++   ++ I
Sbjct: 109 SGNFWKEADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMI 168

Query: 180 PINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFS 239
           P+NK+K IVCSV              KYNLADKIPIVGVETKGCHVFNTSL++NK + F 
Sbjct: 169 PLNKIKAIVCSVGGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFK 228

Query: 240 KITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASI 299
           KITSIATSLGTA+IS + F+YA++Y T+SVV+ D++V++TCL+YT D+NMV+EPACGA++
Sbjct: 229 KITSIATSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAV 288

Query: 300 HLAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADE 348
           HLAYHT+ILEK LG KLN+DDI+LV+ACGGSSNT  D+ES+L  +  +E
Sbjct: 289 HLAYHTEILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEE 337

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  415 bits (1067), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 249/349 (71%), Gaps = 5/349 (1%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           M +VYNKTPL+ Q F                PQ  +KYE LQPSGSFKSRGIGNL+ + A
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSL-----PQVLIKYEYLQPSGSFKSRGIGNLVYQKA 55

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
           + I K   K P+V                Q+LSLPCTVVVP ATKQRM+EKI+STGA V 
Sbjct: 56  LQIQKNSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVT 115

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           I+G  WK AD ++KNS++N+I+T  +EPIYVHP D+PLIWEG++ +VDE+M+SL +Q I 
Sbjct: 116 IHGTFWKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKID 175

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
            +KVK IVCSV              +Y LADKIPIVGVET G HVFNT LK  K IEF K
Sbjct: 176 PSKVKAIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEK 235

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           I+++ATSLG+A+I+KKTFEYA KY+ R V+++D  V+ETCL+YTQDYNM+ EPACGA+IH
Sbjct: 236 ISTVATSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIH 295

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEK 349
           LAYH DILEK+L  +L+ DD++++IACGGSSN+ HD+E  L  MK++ +
Sbjct: 296 LAYHVDILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKKMKSESQ 344

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  405 bits (1042), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 187/345 (54%), Positives = 252/345 (73%), Gaps = 5/345 (1%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           M  VYNKTPLLR +F                PQ F KYE  QP  SFKSRGIGNLILK+A
Sbjct: 1   MPTVYNKTPLLRPYF-----LEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNA 55

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
             + + G KT +V               C+ LS+PCTVVVP++TK RMVEKI+STGA VI
Sbjct: 56  KKVEEEGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVI 115

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           ++G  WKEAD +L+NS++NK+D++ +EP+YVHPFD+PLIWEGH+T++DEI++SLND+N+ 
Sbjct: 116 VSGNFWKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVH 175

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
            +KVKG+VCS+              ++ LADKIP++ VET+GCHVFNT L+L K +EF K
Sbjct: 176 TSKVKGVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEK 235

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           I+SIATSLG+ +IS KTFEYAQKY ++ VV++D +V+ETCL+Y++D NM++EPAC AS+H
Sbjct: 236 ISSIATSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVH 295

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMK 345
           LAY+ DILE++L  KL+ DD+I++IACGGS+ T  D++  L  +K
Sbjct: 296 LAYNVDILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKLK 340

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  397 bits (1019), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 251/362 (69%), Gaps = 13/362 (3%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           M  +YNKTPLL+Q F +               Q FVKYECLQPSGSFKSRGIG+LI K A
Sbjct: 47  MPSIYNKTPLLKQIFNHATSA-----------QVFVKYECLQPSGSFKSRGIGHLISKRA 95

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
            +I   G+K+P V                Q+L+LPCTVV+PT TKQRM +KI+  GANV+
Sbjct: 96  KDIQGDGRKSPHVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVV 155

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           + G+HWKEAD  LKN + N+++   +EPIYVHPFDNP IWEGHA++VDEI+ SL ++N  
Sbjct: 156 VQGSHWKEADSHLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTA 215

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           +N+VKGIVCSV              KYNLA+KIP++ VETKGCHV NTSL++ + +EF+K
Sbjct: 216 LNRVKGIVCSVGGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNK 275

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           + S+ATSL T+ IS +T +Y QKY ++S+V+EDK V++TCLKY +++NM+ EPACGAS+H
Sbjct: 276 MNSVATSLCTSQISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLH 335

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP 360
           L YH  ++E++LG  L+ DD+I+VIACGGSSNT  DLE  L   K +E  +L    +  P
Sbjct: 336 LGYHPQLIERALGKNLDKDDVIIVIACGGSSNTILDLEESL--AKLEEAPHLSIRRNATP 393

Query: 361 NF 362
           + 
Sbjct: 394 SL 395

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  389 bits (998), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 186/353 (52%), Positives = 247/353 (69%), Gaps = 10/353 (2%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MS+VYNKTPLLR+ F                PQ +VKYE LQPSGSFKSRGIG+LI+K+A
Sbjct: 1   MSLVYNKTPLLRRVFPTGLKVPSA-------PQLYVKYESLQPSGSFKSRGIGHLIMKNA 53

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
           + + ++G K+  V                Q L LPCTVVVPT+TK RMVEKI++ G  VI
Sbjct: 54  LRVQQLGGKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVI 113

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           + G+HWKEAD FLKNS++  +D    EPIYVHPFD+P +WEGH+TMVDEI+D+   QN+ 
Sbjct: 114 VKGSHWKEADSFLKNSVIPSVDRIE-EPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVS 172

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           +NKVK IVCSV              KY+LADKIP++ +ET GC+ FN  LK  KQ+E  K
Sbjct: 173 LNKVKAIVCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPK 232

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           ITS+ATSLG   ++ K FE  Q+Y++ SVV++D +V+ TCLKY  D+N++ EPACGAS+H
Sbjct: 233 ITSVATSLGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLH 292

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLL--LNMKADEKQN 351
           +AY+T ++EK+LG KL+SDDII++IACGGS+NT  DL++    L+ +A+ K+N
Sbjct: 293 MAYNTKLIEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQLSAEANTKKN 345

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  370 bits (950), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 180/344 (52%), Positives = 225/344 (65%), Gaps = 8/344 (2%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           M+  Y+KTPLLR+ F +              PQF VKYE  QPSGSFKSRGIG+LI +SA
Sbjct: 1   MTSFYSKTPLLRRIFPSSVLSAT--------PQFLVKYEVFQPSGSFKSRGIGHLITQSA 52

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
             I   G KT  V               C+  SLPCTVVVPT T  RMV KI+ TGA+VI
Sbjct: 53  ARIESEGNKTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVI 112

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           ++G HW +AD +L  S+M  IDT   EP+Y HPFDNP+IWEGH+T+VDEI++SL  Q IP
Sbjct: 113 VHGNHWGDADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIP 172

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
            ++VKGIVCS+              K++LA  IPI+GVETKGC VF+ SLK  K + F K
Sbjct: 173 ASQVKGIVCSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDK 232

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           ITS+ATSLGTA I KKT E A KY T+SVV+ D +V+ TCL +  D N+V EPACGAS+H
Sbjct: 233 ITSVATSLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLH 292

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNM 344
             Y+  +LE +LG  L  +DII+VIACGGSS T  DL+ + + +
Sbjct: 293 FGYNPHLLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRL 336

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  353 bits (907), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 174/340 (51%), Positives = 226/340 (66%), Gaps = 11/340 (3%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MS +YNKTPLLRQ F +              P+ F+KYE LQPSGSFKSRGIG LIL+  
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIG----------PRIFLKYENLQPSGSFKSRGIGCLILQHI 50

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
             + + G KT  V                + L +PCTVVVP +TK+RMV KI+ TGA+V+
Sbjct: 51  NKLKQDGNKTAHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVL 110

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           I G HWKEAD FL+ S M ++D    +PIYVHPFD+P+IWEGH+T++DEI+ +L  + I 
Sbjct: 111 IKGDHWKEADDFLRKS-MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKIS 169

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           I KVKGI+CSV              ++NLA  IP++ VETKGC V N SLK    ++  K
Sbjct: 170 IEKVKGIICSVGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPK 229

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           ITS+ATSLG+  IS   FE A KY +RS+ + DK+V+ETCLKY  D++M +EPACGAS+H
Sbjct: 230 ITSVATSLGSTYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVH 289

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESL 340
           LAY+  I+E +LG  L++ DI++V+ CGGSS T HDLESL
Sbjct: 290 LAYNPGIVESALGTALSNHDIVIVVLCGGSSCTLHDLESL 329

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  329 bits (843), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 170/367 (46%), Positives = 227/367 (61%), Gaps = 14/367 (3%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           MS +Y KTPLLR+ F                PQF VKYE  QPSGSFKSRGIGNLI    
Sbjct: 1   MSSLYVKTPLLRRAFGKPNIQISKV------PQFLVKYEFFQPSGSFKSRGIGNLIYNKV 54

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
             I +   K P V                QR+ +PCTVVVPT+T+QR++EKI +TGA +I
Sbjct: 55  SEIRRDPAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATII 114

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIE----PIYVHPFDNPLIWEGHATMVDEIMDSLND 176
             G ++ EAD +LK+ +    + N  +    PIYVHPF++PLIW GH+ +V+EI++SL +
Sbjct: 115 CRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRN 174

Query: 177 QNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQI 236
           +NIP ++VKGIVCSV              +++LA+ IPI+GVET+GC V + SL   K I
Sbjct: 175 ENIPYSRVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLI 234

Query: 237 EFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACG 296
            F K  S+ATSL    I+K+T  YAQKYKT+S+V+ +  V++TCL++T + N+V EPACG
Sbjct: 235 TFKKALSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACG 294

Query: 297 ASIHLAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSS 356
           A++HL YH  IL K LG  L+S+DI+++IACGGS+ T  DL  L L         LD S 
Sbjct: 295 ATLHLGYHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLKYNP---VTLDDSP 350

Query: 357 STIPNFI 363
             IP  I
Sbjct: 351 VEIPGLI 357

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  324 bits (830), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 217/339 (64%), Gaps = 16/339 (4%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLI-LKS 59
           M+  Y KTPLLRQ                  PQ F+KYE LQP GSFKSRGIGNLI LKS
Sbjct: 1   MNNWYYKTPLLRQILN--------WKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS 52

Query: 60  AMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANV 119
              + K       V                +++ LPCTVVVPT+TKQRMV+KIK++GA V
Sbjct: 53  ENGLVK-----SHVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEV 107

Query: 120 IINGAHWKEADMFLK-NSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQN 178
           II G+HWKEAD +L+ N I +  +    +P+YVHPFD+P +WEGH+TMV EI+D+L +QN
Sbjct: 108 IIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQN 167

Query: 179 IPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEF 238
           I +  V+GIVCSV               + LADKIP++ VET GC+V N SL   + +  
Sbjct: 168 ISVENVRGIVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVML 227

Query: 239 SKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGAS 298
            KITS+ATSLG+  I +  FE A +Y  +S+V+EDK+VIETCL+Y  D+  +VEPACGAS
Sbjct: 228 DKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGAS 287

Query: 299 IHLAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDL 337
           +H+ YH ++LE  LG   + DDII++IACGGS+ T  DL
Sbjct: 288 LHIGYHPELLENFLG-GFSKDDIIVIIACGGSTTTFKDL 325

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  323 bits (829), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 161/341 (47%), Positives = 216/341 (63%), Gaps = 6/341 (1%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           M   + KTPLL  +F                PQF +K E LQPSGSFKSRGIG +I K A
Sbjct: 1   MKSAFVKTPLLAHYF------AASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQA 54

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
           + I   G K P V                + LS+PC+VVVP +T  RMV+KI + GA V 
Sbjct: 55  IKIRSEGNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVH 114

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           + G +WKEAD FLK SI++  + +  + IY HPFD+PLIWEGH+++VDEI+DSL +Q I 
Sbjct: 115 VYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKID 174

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           +  +K IVCSV              ++ L  KIPI+GVE+KGC VFN+SLKL K  EF  
Sbjct: 175 LKNIKAIVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFED 234

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           ITSIATS+GT +ISKKT E A +Y T+SVV+ D+ +I TCL++  + N++ EPACGA++H
Sbjct: 235 ITSIATSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALH 294

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLL 341
           L Y+ DIL ++L      +D+I++I CGGS+ + +DL SL 
Sbjct: 295 LGYYPDILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLF 335

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  322 bits (826), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 162/347 (46%), Positives = 214/347 (61%), Gaps = 13/347 (3%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           M  +YNKTPLL +                  P F  KYE +QP GSFK RG+ +LI K  
Sbjct: 1   MPALYNKTPLLPKNLSGGDG-----------PTFLFKYENMQPGGSFKIRGVSHLIEKRV 49

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
             I   G+K P V               C  LS+PCTVVVPT TK RMVEKI+   A VI
Sbjct: 50  EQIKSEGKKPPHVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVI 109

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
           + G++WKEAD +L+ +++     N ++PIYV+PFD+PL+WEGH+TM+DEI+++LN +NI 
Sbjct: 110 VKGSNWKEADDYLRGTVI--ASNNAVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIK 167

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           ++ VKGIVCSV               + LA  IP+V VETKGC V   SL   K +  +K
Sbjct: 168 LDAVKGIVCSVGGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNK 227

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
           I SIATSLG++ +S + F+ A K+K+RSVV+ D +V+ TC +Y  D+N +VEPACGA+IH
Sbjct: 228 IDSIATSLGSSYVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIH 287

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKAD 347
            AYH  ILEK+LG KL   DII++I CGGS  T  DLE+    +  D
Sbjct: 288 TAYHYKILEKALGQKLTPSDIIIIIVCGGSCVTIQDLENAKRKLDTD 334

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  317 bits (812), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 158/338 (46%), Positives = 210/338 (62%), Gaps = 12/338 (3%)

Query: 4   VYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSAMNI 63
           +++KTPLL+  F+               PQ  +KYE LQPSGSFKSRGIG+LI      I
Sbjct: 24  LFSKTPLLKHQFKRSKG-----------PQVLLKYEFLQPSGSFKSRGIGHLISTKVEEI 72

Query: 64  NKIG-QKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVIIN 122
            K   +K   V                  L++PCTVVV  AT+ R++EKI+S GA+V+++
Sbjct: 73  KKSSPEKIGHVFASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVH 132

Query: 123 GAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIPIN 182
           G HWKEAD F+K  +M K+D+   EPIY HPFDNPLIWEGH+ MVDEIMD L    IPI 
Sbjct: 133 GNHWKEADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPIT 192

Query: 183 KVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSKIT 242
           K+KGIVCS               +YNLADKIPIV VETKG  V + SL++   +EF KI+
Sbjct: 193 KIKGIVCSFGGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKIS 252

Query: 243 SIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIHLA 302
           S ATSLGTA IS   ++  +++ ++S VI D  VI TCL+++ D N+V EP CGA+++  
Sbjct: 253 SCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFG 312

Query: 303 YHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESL 340
           Y+ D L+  LG  +  DD +++I CGGSS +  DL+ L
Sbjct: 313 YNIDKLQNILGSDIKDDDYVILIGCGGSSTSLEDLKEL 350

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  314 bits (805), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 210/336 (62%), Gaps = 10/336 (2%)

Query: 5   YNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSAMNIN 64
           YNKTPLL +                  P+FF+KYE LQP GSFKSRGIG L+ KS     
Sbjct: 8   YNKTPLLPRVLTTTDGA----------PRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKAR 57

Query: 65  KIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVIINGA 124
           + G K+  V                Q  S+ CTVVVP  TK RMVEKI+ TGA V++ G 
Sbjct: 58  RDGGKSLAVFSSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGK 117

Query: 125 HWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIPINKV 184
           HW  AD +L+  +M ++D + + P+YVHPFDNP+IW+GH+T+VDE++  L ++N+ I+KV
Sbjct: 118 HWGMADEYLREVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKV 177

Query: 185 KGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSKITSI 244
           K IVCSV               + LAD+IPI+ +ETKGC V N SL     +    +TS+
Sbjct: 178 KAIVCSVGGGGLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSV 237

Query: 245 ATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIHLAYH 304
           A+SL +  IS+K FE A+KY+++S++++D  VIETCL +  D  +VVEPACGAS++  YH
Sbjct: 238 ASSLASPYISEKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYH 297

Query: 305 TDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESL 340
            ++L   +G +L  DD+I+VIACGGS+ T  DLE +
Sbjct: 298 PELLPLYIGKELTEDDVIVVIACGGSAVTYKDLEYM 333

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  312 bits (799), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 155/333 (46%), Positives = 206/333 (61%), Gaps = 10/333 (3%)

Query: 5   YNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSAMNIN 64
           Y KTPL+RQ F N              P F++K++ LQP GSFKSRGIG+LI K      
Sbjct: 6   YEKTPLIRQVFDNGKTN----------PLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEAL 55

Query: 65  KIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVIINGA 124
             G     V               C+ ++L CTVVVP  TK RMV+KI+S GA VII+G 
Sbjct: 56  AEGSGKLVVFSSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGD 115

Query: 125 HWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIPINKV 184
           HW EAD +LK  +M +   +  + +YVHPFD+ +IWEGH+T+VDEI+  L +++I   +V
Sbjct: 116 HWGEADEYLKQEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQV 175

Query: 185 KGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSKITSI 244
           KG+VCSV              +  LA KIPIV VET GC V N SLK    +   ++TS+
Sbjct: 176 KGLVCSVGGGGLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSV 235

Query: 245 ATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIHLAYH 304
           ATSLG+  I+   FE    Y  +SVV+ D++V++TCL+Y  DYN +VEPACGAS+HL YH
Sbjct: 236 ATSLGSPYIAPFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYH 295

Query: 305 TDILEKSLGHKLNSDDIILVIACGGSSNTTHDL 337
            +ILEK+LG KL+ DD++++IACGGS  T  DL
Sbjct: 296 PEILEKALGQKLSEDDVVIIIACGGSCMTYEDL 328

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  312 bits (800), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 227/377 (60%), Gaps = 19/377 (5%)

Query: 1   MSVVYNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSA 60
           M+  Y KTPL+R  F                P+  +KYE  QPSGSFKSRGIGNLI K  
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTAN------PEIMLKYEFFQPSGSFKSRGIGNLIWKEM 122

Query: 61  MNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120
             I +     P V                ++L LPCTVVVP  T++RMVE+I+STGA+VI
Sbjct: 123 QKIRQNSSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVI 182

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180
             G+  KE+D +L++ +M  ++   + PIY HPFDNPLIWEGHATMVDE++++L+ Q + 
Sbjct: 183 SMGSVLKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQ 242

Query: 181 INKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240
           +  VKGIVCSV              K+ LAD IP+V VET+GC V + SL L + +  + 
Sbjct: 243 LESVKGIVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP 302

Query: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300
             S+ATSL T+ ++  T  YAQKY+T+SVV++   V++TCL + ++ N+V EPACGA++H
Sbjct: 303 -KSVATSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALH 361

Query: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP 360
           L YH +ILE+ LG  L   D+++VIACGGS+          +N+ AD K++ D     I 
Sbjct: 362 LGYHPEILERELG-PLTPQDVVIVIACGGST----------MNL-ADLKESEDQLQPKIK 409

Query: 361 NFIDTENTQHFPIDISA 377
           +F     TQH  I +++
Sbjct: 410 DFHTPIGTQHETIILTS 426

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  300 bits (767), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 153/333 (45%), Positives = 201/333 (60%), Gaps = 11/333 (3%)

Query: 5   YNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSAMNIN 64
           Y KTPL+RQF  N                F+VK+E LQP GSFKSRGIG+LI KS     
Sbjct: 6   YEKTPLIRQFLNNGKTNS----------WFYVKHEMLQPGGSFKSRGIGHLIRKSNEEAL 55

Query: 65  KIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVIINGA 124
             G     V               C+ ++L C+VVVP  TK RMV+KI+S GA VII+G 
Sbjct: 56  SEGSGKLAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGD 115

Query: 125 HWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIPINKV 184
           HW EAD +L++  M +   +  + +YVHPFDN  IWEGH+T+VDEI++ L + +I + +V
Sbjct: 116 HWGEADEYLRHE-MAQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRV 174

Query: 185 KGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSKITSI 244
           K +VCSV              +  LA+KIP+V VET GC V N SLK    +   K+TS+
Sbjct: 175 KALVCSVGGGGLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSV 234

Query: 245 ATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIHLAYH 304
           ATSL +  I+   FE   KY  +SVV+ D++V+ TCL+Y  DYN +VEPACGAS+HL YH
Sbjct: 235 ATSLASPYIASFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYH 294

Query: 305 TDILEKSLGHKLNSDDIILVIACGGSSNTTHDL 337
            +ILE  L  K+  DDI+++IACGGS  T  DL
Sbjct: 295 PEILEDILEQKIYEDDIVIIIACGGSCMTYEDL 327

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  295 bits (755), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 200/333 (60%), Gaps = 10/333 (3%)

Query: 5   YNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSAMNIN 64
           Y +TPL+ Q F N              P+ +VK+E LQP GSFKSRGIG+LI +S     
Sbjct: 6   YERTPLIHQVFNNGQTG----------PRLYVKHEMLQPGGSFKSRGIGHLINRSNEEAL 55

Query: 65  KIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVIINGA 124
             G     V               C  ++L CTVVVP  TK RM++KI++ GA VII+G+
Sbjct: 56  ADGSGKLAVFSSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGS 115

Query: 125 HWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIPINKV 184
           HW EAD +L+  +M +      + +YVHPFD+  IWEGH+T+VDE++  L ++NI + ++
Sbjct: 116 HWGEADEYLRQELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARI 175

Query: 185 KGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSKITSI 244
           K +VCSV              + NLA KI ++ VET GC V N SL     I   +++SI
Sbjct: 176 KAMVCSVGGGGLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSI 235

Query: 245 ATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIHLAYH 304
           ATSLG+  I+   FE    Y  +SVV+ D++V+ TCL+Y  DYN +VEPACGAS+HL YH
Sbjct: 236 ATSLGSPYIAPFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYH 295

Query: 305 TDILEKSLGHKLNSDDIILVIACGGSSNTTHDL 337
            +ILE +L  KL+ DDI+++IACGGS  T  DL
Sbjct: 296 QEILENALEQKLSDDDIVIIIACGGSCMTYEDL 328

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  286 bits (733), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 145/335 (43%), Positives = 201/335 (60%), Gaps = 10/335 (2%)

Query: 6   NKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSAMNINK 65
           +K+PLL + F+               PQFF+KYE LQPSGSFKSRGIG LI   A     
Sbjct: 5   HKSPLLNRRFKESEKDG---------PQFFLKYETLQPSGSFKSRGIGYLINSKAKEARS 55

Query: 66  IGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVIINGAH 125
                  V                + L+L CTVVVP  TK+ M+++I++ G+ VI++G H
Sbjct: 56  RDGSDVHVFSSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTH 115

Query: 126 WKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIPINKVK 185
           W  AD +LK  +M K+ +N +EP+YVHPFD+PL+WEGH+ M+DEI++ L +Q   +  VK
Sbjct: 116 WGMADTYLKEVVMKKVPSN-VEPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVK 174

Query: 186 GIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSKITSIA 245
           GI+CSV              ++  A KIPI+ VET G      SL   K +  +++TSIA
Sbjct: 175 GIICSVGGGGLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIA 234

Query: 246 TSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIHLAYHT 305
           +SLG+  I++ +FE A +YKTRS V  D+  + T L++ Q+ N++VEPAC AS+ L YH 
Sbjct: 235 SSLGSPYIAQDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHV 294

Query: 306 DILEKSLGHKLNSDDIILVIACGGSSNTTHDLESL 340
           D L K L  KL+S DI++VI CGGS+ T  DLE L
Sbjct: 295 DELNKLLSCKLSSKDIVIVIVCGGSATTISDLEML 329

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  268 bits (684), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 135/309 (43%), Positives = 195/309 (63%), Gaps = 8/309 (2%)

Query: 32  PQFFVKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQR 91
           P F +KYE LQP GSFKSRGI +LI K+ M+     +    V               C  
Sbjct: 21  PTFLLKYENLQPGGSFKSRGISHLI-KTTMDSISDPENELAVYSSSGGNAGLAAARACAT 79

Query: 92  LSLPCTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYV 151
           L +PCTV+VP +TK RM++KI+S GA V+I G HWKEAD +L+  +M +  +++   +YV
Sbjct: 80  LKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWKEADTYLREYVMRQ--SSYSNTLYV 137

Query: 152 HPFDNPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLAD 211
           HPFDNP+IW+GH+TM+DEI++ L + +  IN VKGIVCSV              ++ LA 
Sbjct: 138 HPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGIVCSVGGGGLYNGVVNGLERHGLAG 197

Query: 212 KIPIVGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVI 271
            IP+  +ET GC V + SL   + +   +I+SIATSLG+  I   +F+ A K+ ++S+V+
Sbjct: 198 SIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATSLGSTEICADSFQKAIKFSSKSIVL 257

Query: 272 EDKNVIETCLKYTQDYNMVVEPACGASIHLAYHTDILEKSLGHKLNSDDIILVIACGGSS 331
           +DKNV++TCL++  + +++VEPACGAS+H  Y  ++L       L  DDI++VI CGGS 
Sbjct: 258 DDKNVVDTCLRFFDETSILVEPACGASLHTCYRPELL-----GPLGPDDIVVVILCGGSC 312

Query: 332 NTTHDLESL 340
           NT  DL+S 
Sbjct: 313 NTYDDLKSF 321

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  227 bits (578), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 105/220 (47%), Positives = 152/220 (69%), Gaps = 2/220 (0%)

Query: 119 VIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQN 178
           V ++ A+ KEAD +L+N +++      ++PIYV+PFD+PLIWEGH+T++DEI+++L  +N
Sbjct: 5   VFVHVANLKEADYYLQNVVIDL--YKDVQPIYVNPFDDPLIWEGHSTIIDEILNTLTQEN 62

Query: 179 IPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEF 238
           I +  VKGI+CS               KY+LA  IP+V VETKGC V N SL  NK ++ 
Sbjct: 63  IEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQL 122

Query: 239 SKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGAS 298
             ITSIA SLG++ +S+K F+   KY ++S+V+ D + ++TC KY  D+  V+EPACGAS
Sbjct: 123 DSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGAS 182

Query: 299 IHLAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLE 338
           +H AYH ++LE++L  KL  DD+I++IACGGS  T  DLE
Sbjct: 183 VHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLE 222

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  200 bits (509), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 94/189 (49%), Positives = 125/189 (66%)

Query: 149 IYVHPFDNPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYN 208
           +YVHPFDN  IWEGH+T+VDEI++ L + +I + +VK +VCSV              +  
Sbjct: 12  LYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQ 71

Query: 209 LADKIPIVGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRS 268
           LA+KIP+V VET GC V N SLK    +   K+TS+ATSL +  I+   FE   KY  +S
Sbjct: 72  LAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKS 131

Query: 269 VVIEDKNVIETCLKYTQDYNMVVEPACGASIHLAYHTDILEKSLGHKLNSDDIILVIACG 328
           VV+ D++V+ TCL+Y  DYN +VEPACGAS+HL YH +ILE  L  K+  DDI+++IACG
Sbjct: 132 VVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIIIACG 191

Query: 329 GSSNTTHDL 337
           GS  T  DL
Sbjct: 192 GSCMTYEDL 200

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  109 bits (272), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 72/131 (54%), Gaps = 10/131 (7%)

Query: 5   YNKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSAMNIN 64
           Y KTPL+RQF  N                F+VK+E LQP GSFKSRGIG+LI KS     
Sbjct: 6   YEKTPLIRQFLNNGKTNS----------WFYVKHEMLQPGGSFKSRGIGHLIRKSNEEAL 55

Query: 65  KIGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVIINGA 124
             G     V               C+ ++L C+VVVP  TK RMV+KI+S GA VII+G 
Sbjct: 56  SEGSGKLAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGD 115

Query: 125 HWKEADMFLKN 135
           HW EAD +L++
Sbjct: 116 HWGEADEYLRH 126

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/264 (23%), Positives = 110/264 (41%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I K   +     QKT  V                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMIAKLDES-----QKTQGVIACSAGNHAQGVAYASKHLNIP 137

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P +T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 138 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLTEERGLTN------IPPFD 191

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  +++ +    K+K + C+V              +  +A  I +
Sbjct: 192 HPYVIAGQGTIAMEILRQVHNAS----KIKAVFCAVGGGGLITGVGAYLKR--IAPHIKV 245

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET      +TSLK  K++    + + A       I ++TF  A+      V++    
Sbjct: 246 IGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVAKDVVDEVVLVNTDE 305

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   S+
Sbjct: 306 ICAAVKDIFEDTRSIVEPSGALSV 329

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 109/264 (41%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I K   N+   G     V                ++L +P
Sbjct: 100 LKREDLLPVFSFKLRGAYNMIAKLDDNVRNQG-----VIACSAGNHAQGVAYAAKKLGIP 154

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P +T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 155 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLSEERGLTN------IPPFD 208

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  +++ N    K+  +   V              +  +A  I +
Sbjct: 209 HPYVIAGQGTVAMEILRQVHNAN----KINAVFVPVGGGGLIAGVGAYLKR--IAPHIKV 262

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET      +TSL+  K+ E +K+ + A       I ++TF  AQ+     V++    
Sbjct: 263 IGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQEVVDEIVLVNTDE 322

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   ++EP+   S+
Sbjct: 323 LCAAIKDVFEDTRSILEPSGALSV 346

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 106/264 (40%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I K   +     Q+   V                + L +P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDDS-----QRNQGVIACSAGNHAQGVAYAAKHLGIP 144

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P +T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN------IPPFD 198

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  +++ N    K+  +   V              +  +A  I +
Sbjct: 199 HPYVIAGQGTVAMEILRQVHNAN----KIGAVFVPVGGGGFIAGVGAYLKR--IAPHIKV 252

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET      +TSLK NK+     + + A       I ++TF  AQ+     V++    
Sbjct: 253 IGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEVVLVNTDE 312

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   ++
Sbjct: 313 ICAAVKDIFEDTRSIVEPSGALAV 336

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 103/264 (39%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I K   +     Q+   V                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAKLDDS-----QRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P  T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEAKAECTKLAEERGLTN------IPPFD 205

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  +      +NK+  +   V              +  +A  I +
Sbjct: 206 HPYVIAGQGTVAMEILRQVRT----VNKIGAVFVPVGGGGLIAGIGAYLKR--IAPHIKV 259

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET      + SL+ N++     + + A       I ++TF  AQ+     V++    
Sbjct: 260 IGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNTDE 319

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   S+
Sbjct: 320 ICAAVKDVFEDTRSIVEPSGALSV 343

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 106/264 (40%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N++ K   +     QK   V                + L++P
Sbjct: 87  LKREDLLPVFSFKLRGAYNMMAKLDDS-----QKNQGVIACSAGNHAQGIAYAAKHLNIP 141

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P +T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 142 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERGLTN------IPPFD 195

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  ++  N    K+  +   V              +  +A  I I
Sbjct: 196 HPYVIAGQGTVAMEILRQVHKAN----KIGAVFVPVGGGGLIAGVGAYLKR--IAPHIKI 249

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET   +   TSL+  K++  S + + A       I ++TF   Q+     V++    
Sbjct: 250 IGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFRVCQEVVDEVVLVNTDE 309

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   S+
Sbjct: 310 ICAAVKDVFEDTRSIVEPSGALSV 333

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 102/264 (38%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I K   +     Q+   V                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAKLDDS-----QRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P  T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN------IPPFD 205

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  +   N    K+  +   V              +  +A  I I
Sbjct: 206 HPYVIAGQGTVAMEILRQVRTAN----KIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKI 259

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET      + SL+ N++     + + A       I ++TF  AQ+     V++    
Sbjct: 260 IGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNTDE 319

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   S+
Sbjct: 320 ICAAVKDIFEDTRSIVEPSGALSV 343

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 102/264 (38%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I K   +     Q+   V                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAKLDDS-----QRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P  T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN------IPPFD 205

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  +   N    K+  +   V              +  +A  I +
Sbjct: 206 HPYVIAGQGTVAMEILRQVRTAN----KIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKV 259

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET      + SL+ N++     + S A       I ++TF  AQ+     V++    
Sbjct: 260 IGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQVVDEVVLVNTDE 319

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   S+
Sbjct: 320 ICAAVKDVFEDTRSIVEPSGALSV 343

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 105/264 (39%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I K   +     Q+   V                + L++P
Sbjct: 91  LKREDLLPVFSFKLRGAYNMIAKLDDS-----QRNQGVIACSAGNHAQGVAFAAKHLNIP 145

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P +T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 146 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN------IPPFD 199

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  +++ N    K+  +   V              +  +A  I I
Sbjct: 200 HPYVIAGQGTVAMEILRQVHNAN----KIGAVFVPVGGGGLVAGVGAYLKR--IAPHIKI 253

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET       TSLK  ++   S +   A       I ++TF  AQ+     V++    
Sbjct: 254 IGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEVVDEVVLVNTDE 313

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   S+
Sbjct: 314 ICAAVKDVFEDTRSIVEPSGALSV 337

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 104/264 (39%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I K   N     QK   V                + +++P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDEN-----QKNQGVIACSAGNHAQGVAYAARHMNIP 144

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P +T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN------IPPFD 198

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  +++      K+  +   V              +  +A  I I
Sbjct: 199 HPYVIAGQGTVAMEILRQVHNSL----KIGAVFVPVGGGGLIAGIGAYLKR--IAPHIKI 252

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           VGVET      + S+K  K+     + S A       I ++TF  +Q+     V++    
Sbjct: 253 VGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEVVDEIVLVNTDE 312

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   ++EP+   S+
Sbjct: 313 ICAAVKDIFEDTRSIIEPSGALSV 336

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 102/264 (38%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I K   +     Q+   V                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAKLDDS-----QRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P  T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN------IPPFD 205

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  +   N    K+  +   V              +  +A  I +
Sbjct: 206 HPYVIAGQGTVAMEILRQVRTAN----KIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKV 259

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET      + SL+ N++     + + A       I ++TF  AQ+     V++    
Sbjct: 260 IGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNTDE 319

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   S+
Sbjct: 320 ICAAVKDIFEDTRSIVEPSGALSV 343

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 104/264 (39%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I K         Q+   V                + L +P
Sbjct: 92  LKREDLLPVFSFKLRGAYNMIAKLDDT-----QRNQGVIACSAGNHAQGVAYAARHLDIP 146

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P +T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 147 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN------IPPFD 200

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  + + N    K+  +   V              +  +   I I
Sbjct: 201 HPYVIAGQGTVAMEILRQVYNSN----KIGAVFVPVGGGGLIAGVGAYLKR--VTPHIKI 254

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET      +TSL+ NK+   + + + A       I ++TF  A++     V++    
Sbjct: 255 IGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVAREVVDEIVLVNTDE 314

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   ++
Sbjct: 315 ICAAVKDVFEDTRSIVEPSGALAV 338

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/264 (21%), Positives = 102/264 (38%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I K         QK   V                  +++P
Sbjct: 88  LKREDLLPVFSFKLRGAYNMIAKLDET-----QKNAGVIACSAGNHAQGVAFSSNHMNIP 142

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P +T     + +   GA V++ G  + EA +        +  T+      + PFD
Sbjct: 143 ATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEAKLECARLAEERGMTD------IPPFD 196

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  + + +     +  + C+V              +  +A  I +
Sbjct: 197 HPYVIAGQGTIAMEILRQVQNGS----NIGAVFCAVGGGGLISGIGSYLKR--IAPHIKV 250

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET      + SLK  K+     + + A       I ++TF   Q      +++    
Sbjct: 251 IGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRLIGEETFRVCQDVVDEVILVNTDE 310

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   ++
Sbjct: 311 ICAAVKDVFEDTRSIVEPSGALAV 334

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 103/264 (39%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I K   +     QK   V                + +S+P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDDS-----QKNQGVIACSAGNHAQGVAFAAKHMSIP 144

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P +T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTRLSEERGLTN------IPPFD 198

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  + +      K+  +                  +  +A  I I
Sbjct: 199 HPYVIAGQGTVAMEILRQVRNSA----KIGAVFVPCGGGGLVAGIGAYLKR--IAPHIKI 252

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET      +TSLK  K+   + + + A       I ++TF  AQ      V++    
Sbjct: 253 IGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEVVLVGTDE 312

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   ++
Sbjct: 313 ICAAIKDIFEDTRGIVEPSGALAV 336

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/268 (21%), Positives = 113/268 (42%), Gaps = 25/268 (9%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I     +++ + QK   V                + L +P
Sbjct: 91  LKREDLLPVFSFKLRGAYNMI----SHLDDV-QKKCGVIACSAGNHAQGVAYSAKHLGIP 145

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHI---EPIY-V 151
            T+V+P +T     + +   GA V++ G ++  A          K++ + +   + +Y +
Sbjct: 146 ATIVMPVSTPSIKYQNVSRLGAEVVLYGDNFDAA----------KVECSRLSEEKGLYDI 195

Query: 152 HPFDNPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLAD 211
            PFD+P +  G  T+  EI+  + + +    K+  + C+V              +   A 
Sbjct: 196 PPFDHPYVIAGQGTIAMEILKQIQNSS----KIGAVFCAVGGGGLIAGVGAYIKR--AAP 249

Query: 212 KIPIVGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVI 271
            I ++GVET      +TS++ N +   S++   A       I +++F  A++     +++
Sbjct: 250 HIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGTSVRLIGEESFRVAREVVDEVILV 309

Query: 272 EDKNVIETCLKYTQDYNMVVEPACGASI 299
               +        +D   VVEP+   ++
Sbjct: 310 NTDEICAAIKDIFEDTRAVVEPSGALAV 337

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/280 (21%), Positives = 112/280 (40%), Gaps = 30/280 (10%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N+I     N+++  QK+  V                + L + 
Sbjct: 82  LKREDLLPVFSFKLRGAYNMI----SNLDEY-QKSAGVIACSAGNHAQGVAFSARELGIR 136

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIY----V 151
             +V+PT+T       + + GA V++ G  + EA          K +   +  ++    +
Sbjct: 137 AMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEA----------KAECARLAQLHKLTDI 186

Query: 152 HPFDNPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLAD 211
            PFD+P +  G  T+  EI+  +++ +    ++  + C V              +  +A 
Sbjct: 187 PPFDHPYVIAGQGTIATEILRQVHNAS----QIGAVFCGVGGGGLIAGIGSYLKR--IAP 240

Query: 212 KIPIVGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVI 271
            I I+GVET      +T+LK  ++     +   A       + ++TF  A+      V++
Sbjct: 241 HIKIIGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVARDVVDEVVLV 300

Query: 272 EDKNVIETCLKYTQDYNMVVEPA-----CGASIHLAYHTD 306
               +        +D   +VEP+      G   ++A H D
Sbjct: 301 NTDELCAAIKDIFEDTRAIVEPSGALGVAGLKKYIASHQD 340

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 102/264 (38%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K + L P  SFK RG  N++ K         QK   V                + L +P
Sbjct: 89  LKRDDLLPVFSFKLRGAYNMMAKLDDT-----QKNQGVIACSAGNHAQGVAYAAKHLKIP 143

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P +T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 144 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERGLTN------IPPFD 197

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  ++  +    K+  +   V              +  +A  I I
Sbjct: 198 HPYVIAGQGTVAMEILRQVHMSS----KIGAVFVPVGGGGLIAGVGTYLKR--IAPHIKI 251

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET       TSL+  K+     + S A       + ++TF  AQ+     V++    
Sbjct: 252 IGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEVVDEVVLVNTDE 311

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   ++
Sbjct: 312 ICAGIKDIFEDTRSIVEPSGALAV 335

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 98/267 (36%), Gaps = 17/267 (6%)

Query: 33  QFFVKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRL 92
           Q  +K E L P  SFK RG  N++ K      K G     V                + L
Sbjct: 88  QIQLKREDLLPVFSFKMRGAYNMVAKLDETQRKQG-----VIACSAGNHAQGVAYAAKHL 142

Query: 93  SLPCTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVH 152
            +P T+V+P +T     E +   G+ V++ G  +  +    +     +   N      + 
Sbjct: 143 GIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDSSKGECERLCEERGLVN------IP 196

Query: 153 PFDNPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADK 212
           PFD+P +  G  T+  EI+  +       N  K     V                 +A  
Sbjct: 197 PFDHPYVIAGQGTVAMEILRQVK------NSAKIGAVFVPVGGGGLVAGIGAYLKRIAPH 250

Query: 213 IPIVGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIE 272
           I IVGVET       TSL   K+ E + + + A       I ++TF  ++      V++ 
Sbjct: 251 IKIVGVETYDAATLKTSLDNGKRTELNTVGTFADGTAVKMIGEETFRVSKDVVDEIVLVN 310

Query: 273 DKNVIETCLKYTQDYNMVVEPACGASI 299
              +        +D   +VEP+   S+
Sbjct: 311 TDELCAAVKDIFEDTRSIVEPSGALSV 337

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 101/264 (38%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N++ K         QK   V                + L +P
Sbjct: 98  LKREDLLPVFSFKLRGAYNMMAKLDDT-----QKNQGVIACSAGNHAQGVAFAAKHLDIP 152

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
            T+V+P +T     + +   G+ V++ G  + EA          +  TN      + PFD
Sbjct: 153 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLSKERGLTN------IPPFD 206

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  ++  N    K+  +   V              +  +A  I I
Sbjct: 207 HPYVIAGQGTVAMEILRQVHIAN----KIGAVFVPVGGGGLVAGVGAYLKR--IAPHIKI 260

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET       TSL+  ++     + + A       I ++TF  +Q      V++    
Sbjct: 261 IGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEVVLVNTDE 320

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   ++
Sbjct: 321 ICAAVKDIFEDTRSIVEPSGALAV 344

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 97/264 (36%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N++ K A      GQ    V                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMMAKLAE-----GQGNKGVIACSAGNHAQGVAFASRHLNIP 137

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
             +V+P  T     + +   G  V++ G  + EA +        +  TN      + PFD
Sbjct: 138 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAKIECARISEERGLTN------IPPFD 191

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  ++      N  K     V                 +A  I I
Sbjct: 192 HPYVIAGQGTVAMEILRQVH------NASKIGAVFVPVGGGGLVAGVAAYLKRIAPHIKI 245

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           VGVET       TSL    +   + + + A       I ++TF   + +    V++    
Sbjct: 246 VGVETYDSATLKTSLDAGCRTPLTSVGTFADGTSVRMIGEETFRICEDFVDEVVLVNTDE 305

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   ++
Sbjct: 306 ICAAVKDIFEDTRSIVEPSGALAV 329

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/264 (21%), Positives = 96/264 (36%), Gaps = 17/264 (6%)

Query: 36  VKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRLSLP 95
           +K E L P  SFK RG  N++ K +       QK   V                + L++P
Sbjct: 94  LKREDLLPVFSFKLRGAYNMMAKLSE-----AQKNQGVIACSAGNHAQGVAFASRHLNIP 148

Query: 96  CTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFD 155
             +V+P  T     + +   G  V++ G  + EA          +  TN      + PFD
Sbjct: 149 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAKTECTRISEERGLTN------IPPFD 202

Query: 156 NPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADKIPI 215
           +P +  G  T+  EI+  ++      N  K     V                 +A  I I
Sbjct: 203 HPYVIAGQGTVAMEILRQVH------NAAKIGAVFVPVGGGGLVAGVAAYLKRIAPHIKI 256

Query: 216 VGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKN 275
           +GVET       TSL+   +   S + + A       I ++TF   Q      +++    
Sbjct: 257 IGVETYDSATLKTSLEAGTRTPLSTVGTFADGTSVRMIGEETFRICQDLVDDVILVNTDE 316

Query: 276 VIETCLKYTQDYNMVVEPACGASI 299
           +        +D   +VEP+   ++
Sbjct: 317 ICAAVKDIFEDTRSIVEPSGALAV 340

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/261 (19%), Positives = 95/261 (36%), Gaps = 20/261 (7%)

Query: 33  QFFVKYECLQPSGSFKSRGIGNLILKSAMNINKIGQKTPQVXXXXXXXXXXXXXXXCQRL 92
           + + K E  Q  G+FK RG  N +LK         Q+   V                + L
Sbjct: 38  EVYFKCENFQRIGAFKFRGAMNTLLKLTQE-----QRAAGVVAFSSGNHAQAIALSAKLL 92

Query: 93  SLPCTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEPIYVH 152
            +P T+V+P       V      GAN++    + ++ +   +     K  T       V 
Sbjct: 93  GVPATIVMPNDAPAAKVRATAGYGANIVRYDRYTEDREQIGRALAEEKGLT------LVP 146

Query: 153 PFDNPLIWEGHATMVDEIMDSLNDQNIPINKVKGIVCSVXXXXXXXXXXXXXXKYNLADK 212
           P+D+P +  G  T   E+++ + + ++           V                 L+ +
Sbjct: 147 PYDHPDVIAGQGTAAKELIEEVGELDLLF---------VPLGGGGLLSGSALAAKRLSPR 197

Query: 213 IPIVGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIE 272
             I+GVE +  +    SL+    +      +IA    T ++ + TFE         +   
Sbjct: 198 CEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGAQTQHLGQYTFEVIHANVADILTAS 257

Query: 273 DKNVIETCLKYTQDYNMVVEP 293
           D  ++++   + +   +VVEP
Sbjct: 258 DAELVDSMRFFAERMKIVVEP 278

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 60/319 (18%), Positives = 122/319 (38%), Gaps = 34/319 (10%)

Query: 6   NKTPLLRQFFQNXXXXXXXXXXXXXXPQFFVKYECLQPSGSFKSRGIGNLILKSAMNINK 65
           NKTP+L     N               Q + K E  Q  G+FK RG  N + K +     
Sbjct: 21  NKTPVLTSRMLNDRLGA----------QIYFKGENFQRVGAFKFRGAMNAVSKLSDE--- 67

Query: 66  IGQKTPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMVEKIKSTGANVIINGAH 125
             +++  V                + L++P T+V+P       V      GA++I    +
Sbjct: 68  --KRSKGVIAFSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAHIIRYNRY 125

Query: 126 WKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIPINKVK 185
            ++     +  I  ++   H   + + P+D+P +  G  T   E+++ +   +       
Sbjct: 126 TED-----REQIGRQLAAEHGFAL-IPPYDHPDVIAGQGTSAKELLEEVGQLD------- 172

Query: 186 GIVCSVXXXXXXXXXXXXXXKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSKITSIA 245
                V                +L+    I GVE +  +    S +    +  +   +IA
Sbjct: 173 --ALFVPLGGGGLLSGSALAARSLSPGCKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIA 230

Query: 246 TSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKY-TQDYNMVVEP-AC-GASIHLA 302
               T ++ + TF   ++     + + D+ +++ C+ +  +   +VVEP AC G +  L 
Sbjct: 231 DGAQTQHLGEYTFAIIRENVDDILTVSDQELVK-CMHFLAERMKVVVEPTACLGFAGALL 289

Query: 303 YHTDILEKSLGHKLNSDDI 321
              +++ K +G  L+  ++
Sbjct: 290 KKEELVGKKVGIILSGGNV 308

>NCAS0I01120 Chr9 complement(205511..205990) [480 bp, 159 aa] {ON}
           Anc_3.357 YPR067W
          Length = 159

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 47/105 (44%), Gaps = 13/105 (12%)

Query: 207 YNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSKITSIATSLGTANISKKTFEYAQKYKT 266
           Y  ++++  +GVE+ GCH F  +L L    +  + T   + +    I+ K+  Y      
Sbjct: 48  YKASNEVLKIGVESGGCHGFQYNLDLIPADQSQQETKRTSMMSLLRITIKSVVYVMPPDG 107

Query: 267 RSVVIED---KNVIETCLKYT----------QDYNMVVEPACGAS 298
             V+I++   K + +T L YT          +D N+     CG+S
Sbjct: 108 GKVIIDENSLKILNDTVLNYTTELIGSQFKIEDGNLKSSCGCGSS 152

>NDAI0J01760 Chr10 complement(432212..433558) [1347 bp, 448 aa] {ON}
           Anc_4.131 YLR321C
          Length = 448

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 45/91 (49%), Gaps = 11/91 (12%)

Query: 91  RLSLPCTVVVPTATKQRMVEKIKSTGANVIINGAHWKEADMFLKNSIMNKIDTNHIEP-- 148
           R+S+P   ++P++++Q      KS G  +I    + + A   +K+S    I+ + I P  
Sbjct: 168 RISIPTQTLLPSSSEQ------KSIGPIIIPIHLNIEHAGHVIKDSFTWNINDHSISPAE 221

Query: 149 ---IYVHPFDNPLIWEGHATMVDEIMDSLND 176
              IY    D+P     H+T+V  I D +N+
Sbjct: 222 FATIYCKDLDSPSNSSLHSTIVQSINDQINE 252

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 7/38 (18%)

Query: 138 MNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLN 175
           + K+ T+ I+ +Y+H       W  H T ++E+MDSL+
Sbjct: 137 LRKLQTDWIDILYIH-------WWDHMTSIEEVMDSLH 167

>KAFR0J01080 Chr10 (198475..199455) [981 bp, 326 aa] {ON} Anc_5.242
           YJL006C
          Length = 326

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 219 ETKGCHVFNTS-LKLN-KQIE-FSKITSI-ATSLGTANISKKTFEYAQKYKTRSVVIEDK 274
           ET+ C+   TS L L+ KQ+E   K+  I  TSL   NI+K   EY + +K R   IE +
Sbjct: 77  ETELCYTLATSCLILSCKQVETLKKVNDICTTSLKLRNITKLNQEYLENFKKRIFQIELR 136

Query: 275 NVIETC 280
            ++E+C
Sbjct: 137 -ILESC 141

>KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P42884 Saccharomyces
           cerevisiae YNL331C
          Length = 375

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 8/55 (14%)

Query: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLN 175
            +G H +   + +++S + K+ T+ I+ +YVH       W    T ++E+MDSL+
Sbjct: 121 FSGNHRRSLQLSVRDS-LRKLQTDWIDILYVH-------WWDQMTSIEEVMDSLH 167

>NCAS0B00590 Chr2 complement(88134..89003) [870 bp, 289 aa] {ON}
           Anc_8.743 YOR281C
          Length = 289

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 320 DIILVIACGGSSNTTHDLESLLLNMKA-DEKQN 351
           +++ ++  GG++ T  D E L+++MKA DEK N
Sbjct: 206 NMVTLLELGGNNTTVKDFEKLMVDMKAVDEKDN 238

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,086,382
Number of extensions: 1460368
Number of successful extensions: 4654
Number of sequences better than 10.0: 75
Number of HSP's gapped: 4666
Number of HSP's successfully gapped: 75
Length of query: 377
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 266
Effective length of database: 40,753,473
Effective search space: 10840423818
Effective search space used: 10840423818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)