Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A001101.2ON2112119461e-131
NCAS0B091401.2ON2052094681e-58
Kpol_2002.31.2ON2232153474e-40
KAFR0D007201.121ON2062103421e-39
KNAG0C001601.2ON2032073176e-36
TPHA0E040701.2ON2312233066e-34
TPHA0E036101.121ON2312233066e-34
Skud_3.1181.121ON2102083012e-33
Suva_3.1471.2ON2102082979e-33
YCR039C (MATALPHA2)1.121ON2102082979e-33
YCL067C (HMLALPHA2)1.2ON2102082979e-33
ZYRO0F15818g1.121ON2252232856e-31
ZYRO0F18568g1.2ON2252232856e-31
Suva_3.135singletonON119902691e-29
Suva_3.74singletonON119902691e-29
Suva_3.751.121ON119902691e-29
YCR096C (HMRA2)singletonOFF119902691e-29
Skud_102.1singletonON185902681e-28
Smik_95.1singletonON185902681e-28
Smik_3.1421.121ON228902701e-28
CAGL0B01265g1.121ON1862042496e-26
CAGL0B00264g1.2ON2102142421e-24
Ecym_11151.121ON230902291e-22
Ecym_10021.2ON230902291e-22
TBLA0A070501.121ON2612532223e-21
TBLA0A076001.2ON2302402194e-21
TDEL0C070001.2ON237762133e-20
KLLA0C00374g1.2ON223851941e-17
KLTH0F00396g1.2ON108601199e-08
Kwal_YGOB_matalpha21.121ON110451181e-07
Kwal_33.12995singletonOFF110451181e-07
Kwal_YGOB_HMalpha21.2ON110451181e-07
Kwal_33.matalpha2singletonOFF110451181e-07
Kwal_27.110926.170ON229601212e-07
Kpol_1036.566.170ON265621204e-07
NDAI0F021706.170ON383561206e-07
Smik_7.1816.170ON274651187e-07
TPHA0B025806.170ON264571152e-06
NCAS0D035706.170ON257521133e-06
NCAS0H011306.170ON280561143e-06
AFL049C6.170ON257621133e-06
Skud_7.1816.170ON274711125e-06
KAFR0G036506.170ON177671105e-06
SAKL0A05610g6.170ON320521125e-06
Ecym_22476.170ON349591117e-06
Suva_16.1326.170ON292781117e-06
Skud_16.1036.170ON295781117e-06
KLTH0H05236g6.170ON234521108e-06
Suva_7.1726.170ON270651101e-05
CAGL0C01551g6.170ON221591081e-05
YGL096W (TOS8)6.170ON276651072e-05
KNAG0M005006.170ON298521072e-05
YPL177C (CUP9)6.170ON306781072e-05
Smik_6.3746.170ON294781072e-05
KNAG0F022106.170ON324551072e-05
KLLA0B10450g6.170ON389521073e-05
ZYRO0G22044g6.170ON201651053e-05
TDEL0F018106.170ON256561053e-05
KAFR0A043706.170ON409631064e-05
NDAI0I013206.170ON409671055e-05
TBLA0C037406.170ON293521045e-05
CAGL0H02959g6.170ON25966966e-04
Skud_71.2singletonON4543868e-04
Suva_69.1singletonON3434710.079
AFR643C1.122ON10261680.80
ADL394Cna 1ON10261651.8
TPHA0C036202.337ON54882691.9
TPHA0D013708.693ON23860646.4
Kpol_1043.242.337ON52728647.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A00110
         (211 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...   369   e-131
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...   184   1e-58
Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...   138   4e-40
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...   136   1e-39
KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...   126   6e-36
TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...   122   6e-34
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...   122   6e-34
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...   120   2e-33
Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...   119   9e-33
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...   119   9e-33
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...   119   9e-33
ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...   114   6e-31
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...   114   6e-31
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...   108   1e-29
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   108   1e-29
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   108   1e-29
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...   108   1e-29
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)       107   1e-28
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)         107   1e-28
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...   108   1e-28
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...   100   6e-26
CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...    98   1e-24
Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...    93   1e-22
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...    93   1e-22
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...    90   3e-21
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...    89   4e-21
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...    87   3e-20
KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...    79   1e-17
KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...    50   9e-08
Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...    50   1e-07
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...    50   1e-07
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...    50   1e-07
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...    50   1e-07
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    51   2e-07
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    51   4e-07
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    51   6e-07
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    50   7e-07
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    49   2e-06
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    48   3e-06
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    49   3e-06
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    48   3e-06
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    48   5e-06
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    47   5e-06
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    48   5e-06
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    47   7e-06
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    47   7e-06
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    47   7e-06
KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {O...    47   8e-06
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    47   1e-05
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    46   1e-05
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    46   2e-05
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    46   2e-05
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    46   2e-05
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    46   2e-05
KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON...    46   2e-05
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    46   3e-05
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    45   3e-05
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    45   3e-05
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    45   4e-05
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    45   5e-05
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    45   5e-05
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    42   6e-04
Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)         38   8e-04
Suva_69.1 Chr69 complement(1..102) [102 bp, 34 aa] {ON} YCR039C ...    32   0.079
AFR643C Chr6 complement(1608340..1608648) [309 bp, 102 aa] {ON} ...    31   0.80 
ADL394C Chr4 complement(18058..18366) [309 bp, 102 aa] {ON} Non-...    30   1.8  
TPHA0C03620 Chr3 complement(785783..787429) [1647 bp, 548 aa] {O...    31   1.9  
TPHA0D01370 Chr4 complement(283224..283940) [717 bp, 238 aa] {ON...    29   6.4  
Kpol_1043.24 s1043 (47321..48904) [1584 bp, 527 aa] {ON} (47321....    29   7.6  

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score =  369 bits (946), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 184/211 (87%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIV     
Sbjct: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVSFLST 60

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKYVF 120
                    KDCSNIQLTYELSSMLGKVLKDMVLLNGT             LETNSKYVF
Sbjct: 61  LTQSTNLTSKDCSNIQLTYELSSMLGKVLKDMVLLNGTEEVEKKKVKEEEELETNSKYVF 120

Query: 121 NVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQ 180
           NVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQ
Sbjct: 121 NVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQ 180

Query: 181 IKNWISNRRRKEKLLSISPDIVEIINTQSCQ 211
           IKNWISNRRRKEKLLSISPDIVEIINTQSCQ
Sbjct: 181 IKNWISNRRRKEKLLSISPDIVEIINTQSCQ 211

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score =  184 bits (468), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 133/209 (63%), Gaps = 6/209 (2%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVD-GSYQIQLHNIVXXXX 59
           MNKIAI DLLNPP        L+SIN QL TICS FPT  EN+D  +YQ QL NI     
Sbjct: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTT-ENLDFKTYQEQLRNIAVTLS 59

Query: 60  XXXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKYV 119
                     ++ + +++TY++SS+L K+L +    N                E N K V
Sbjct: 60  SLTNQNELSSENKNVLRVTYQISSVLLKLLGE----NAHNKDQPKTPTSGSESERNPKLV 115

Query: 120 FNVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKV 179
           FN++T+  M P  N+P RGHRL KEKV+ LEHWY+ H+  PYL+  +L++LM+ET LSK+
Sbjct: 116 FNILTKKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKM 175

Query: 180 QIKNWISNRRRKEKLLSISPDIVEIINTQ 208
           QIKNW+SNRRRKEK LSI+P+IV+I+N Q
Sbjct: 176 QIKNWVSNRRRKEKSLSIAPEIVDILNKQ 204

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score =  138 bits (347), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 120/215 (55%), Gaps = 10/215 (4%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MNKI I+ LLNP     +   L  IN++L ++CSK P     ++    ++L  I+     
Sbjct: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNS---- 116
                     +   ++ TY+LS+ L  ++K + + N               L + S    
Sbjct: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS 120

Query: 117 ----KYVFNVITQDMMIPEKN--KPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVL 170
               ++VFN++TQDMM  +K   K +RGHRLPK+ V  LE WY+ +++ PYLD K++  L
Sbjct: 121 NDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISEL 180

Query: 171 MEETKLSKVQIKNWISNRRRKEKLLSISPDIVEII 205
           M+ T LSKVQIKNW+SNRRRKEK ++ISP++  ++
Sbjct: 181 MKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLL 215

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score =  136 bits (342), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 73/210 (34%), Positives = 117/210 (55%), Gaps = 5/210 (2%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MNKI I DLLN P        L  IN++L  +CSK P+++  ++  + ++L +I+     
Sbjct: 1   MNKIQIQDLLNSPRDVDTKQELRDINDKLFALCSKLPSSEALLEAEFHLELRDIMLNLSK 60

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKYVF 120
                    ++       ++L+  +  ++K M   +GT              +T    VF
Sbjct: 61  LQDTSRMGSEEKHLAYTAHQLTCTMITLIKGMKNFHGTGGHSYSSSKSESDDKT----VF 116

Query: 121 NVITQDMM-IPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKV 179
           NV+TQDMM +      +RGHR  KE V  LE WY AHI +PYL+ ++ + L+ +T LS+V
Sbjct: 117 NVVTQDMMNLNRTGISYRGHRFSKENVKVLERWYTAHIDRPYLNRQSTEYLISKTGLSRV 176

Query: 180 QIKNWISNRRRKEKLLSISPDIVEIINTQS 209
           QIKNW+SNRRRKEK + +SP++++++  +S
Sbjct: 177 QIKNWVSNRRRKEKSVHVSPELIQLLQKKS 206

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score =  126 bits (317), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 108/207 (52%), Gaps = 8/207 (3%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MN+I I DLLN      +  +  +IN+QL+ ICS FP    +  G  Q+QL  I+     
Sbjct: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKYVF 120
                       +  ++TY+ S ++  +LK                       + +++VF
Sbjct: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSF------EDFFFERKEYNDPATSENEFVF 114

Query: 121 NVITQDMMIPEKN--KPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSK 178
           +V+TQDMM   K   +P RGHR        LE WY  H +KPYLD ++L  L  +TKLSK
Sbjct: 115 SVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSK 174

Query: 179 VQIKNWISNRRRKEKLLSISPDIVEII 205
           +QI+NW+SNRRRKEK + +SP I +++
Sbjct: 175 MQIRNWVSNRRRKEKSIHVSPVIQDLL 201

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score =  122 bits (306), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 80/223 (35%), Positives = 117/223 (52%), Gaps = 18/223 (8%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MNKI I+ LLNP     +T  L  IN  L  +C+K P    ++  +   +L +I+     
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLN--------------GTXXXXXXXX 106
                    ++   ++ TY+L + L  ++K     N              GT        
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTSDNSETNS 120

Query: 107 X--XXXXLETNSKYVFNVITQDMM--IPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYL 162
                   + NS  VFNVITQDMM    + NK +RGHRLPK+ V  LE WY+ H + PYL
Sbjct: 121 SCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180

Query: 163 DSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSISPDIVEII 205
           +  N+K+LM +T LS++Q+KNWISNRRRKEK ++ISP++  ++
Sbjct: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score =  122 bits (306), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 80/223 (35%), Positives = 117/223 (52%), Gaps = 18/223 (8%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MNKI I+ LLNP     +T  L  IN  L  +C+K P    ++  +   +L +I+     
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLN--------------GTXXXXXXXX 106
                    ++   ++ TY+L + L  ++K     N              GT        
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTSDNSETNS 120

Query: 107 X--XXXXLETNSKYVFNVITQDMM--IPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYL 162
                   + NS  VFNVITQDMM    + NK +RGHRLPK+ V  LE WY+ H + PYL
Sbjct: 121 SCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180

Query: 163 DSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSISPDIVEII 205
           +  N+K+LM +T LS++Q+KNWISNRRRKEK ++ISP++  ++
Sbjct: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score =  120 bits (301), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 119/208 (57%), Gaps = 5/208 (2%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MNKI I DLLNP       SN+  IN +L +IC   P   E+V    +++L +I+     
Sbjct: 1   MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKYVF 120
                    ++   +Q T +L++ +  +LK+M  +                 ++    VF
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKN----KSADGLVF 116

Query: 121 NVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQ 180
           NV+TQDM I +  KP+RGHR  KE V  LE W+  +I+ PYLD+K L+ LM+ T LS++Q
Sbjct: 117 NVVTQDM-INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQ 175

Query: 181 IKNWISNRRRKEKLLSISPDIVEIINTQ 208
           IKNW+SNRRRKEK ++I+P++ ++++ +
Sbjct: 176 IKNWVSNRRRKEKTITIAPELADLLSGE 203

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score =  119 bits (297), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 119/208 (57%), Gaps = 5/208 (2%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MNKI I DLLNP       S++  IN +L +IC   P   E+V    +++L +I+     
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKYVF 120
                    ++   +Q T +L++ +  +LK+M  +                 ++    VF
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKN----KSADGLVF 116

Query: 121 NVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQ 180
           NV+TQDM I +  KP+RGHR  KE V  LE W+  +I+ PYLD+K L+ LM+ T LS++Q
Sbjct: 117 NVVTQDM-INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQ 175

Query: 181 IKNWISNRRRKEKLLSISPDIVEIINTQ 208
           IKNW+SNRRRKEK ++I+P++ ++++ +
Sbjct: 176 IKNWVSNRRRKEKTITIAPELADLLSGE 203

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score =  119 bits (297), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 119/208 (57%), Gaps = 5/208 (2%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MNKI I DLLNP       S++  IN +L +IC   P   E+V    +++L +I+     
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKYVF 120
                    ++   +Q T +L++ +  +LK+M  +                 ++    VF
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKN----KSADGLVF 116

Query: 121 NVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQ 180
           NV+TQDM I +  KP+RGHR  KE V  LE W+  +I+ PYLD+K L+ LM+ T LS++Q
Sbjct: 117 NVVTQDM-INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQ 175

Query: 181 IKNWISNRRRKEKLLSISPDIVEIINTQ 208
           IKNW+SNRRRKEK ++I+P++ ++++ +
Sbjct: 176 IKNWVSNRRRKEKTITIAPELADLLSGE 203

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score =  119 bits (297), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 119/208 (57%), Gaps = 5/208 (2%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MNKI I DLLNP       S++  IN +L +IC   P   E+V    +++L +I+     
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKYVF 120
                    ++   +Q T +L++ +  +LK+M  +                 ++    VF
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKN----KSADGLVF 116

Query: 121 NVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQ 180
           NV+TQDM I +  KP+RGHR  KE V  LE W+  +I+ PYLD+K L+ LM+ T LS++Q
Sbjct: 117 NVVTQDM-INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQ 175

Query: 181 IKNWISNRRRKEKLLSISPDIVEIINTQ 208
           IKNW+SNRRRKEK ++I+P++ ++++ +
Sbjct: 176 IKNWVSNRRRKEKTITIAPELADLLSGE 203

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  114 bits (285), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 112/223 (50%), Gaps = 28/223 (12%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MNKI I  LLNP         L +INN+L+ +CSK P+  E  +   + +L  I+     
Sbjct: 1   MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSENEQFEKD-KAELEKILPSLNI 59

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKY-- 118
                    +D   +   ++LSS+   +L ++  L                L +  KY  
Sbjct: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKS---------KRSQFLRSKPKYHL 110

Query: 119 --------------VFNVITQDMMIPEK--NKPHRGHRLPKEKVNRLEHWYLAHIQKPYL 162
                         VFN++TQD +   +  NK +RGHRLPK     LE W+  +I+ PYL
Sbjct: 111 PYAAALGNTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYL 170

Query: 163 DSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSISPDIVEII 205
            + ++K LM ETKLS  QIKNW+SNRRRKEK L+IS ++ E++
Sbjct: 171 QTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  114 bits (285), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 112/223 (50%), Gaps = 28/223 (12%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MNKI I  LLNP         L +INN+L+ +CSK P+  E  +   + +L  I+     
Sbjct: 1   MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSENEQFEKD-KAELEKILPSLNI 59

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKY-- 118
                    +D   +   ++LSS+   +L ++  L                L +  KY  
Sbjct: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKS---------KRSQFLRSKPKYHL 110

Query: 119 --------------VFNVITQDMMIPEK--NKPHRGHRLPKEKVNRLEHWYLAHIQKPYL 162
                         VFN++TQD +   +  NK +RGHRLPK     LE W+  +I+ PYL
Sbjct: 111 PYAAALGNTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYL 170

Query: 163 DSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSISPDIVEII 205
            + ++K LM ETKLS  QIKNW+SNRRRKEK L+IS ++ E++
Sbjct: 171 QTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
           YCR096C (REAL)
          Length = 119

 Score =  108 bits (269), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 70/90 (77%), Gaps = 1/90 (1%)

Query: 119 VFNVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSK 178
           VFNV+TQDM I +  KP+RGHR  KE V  LE W+  +I+ PYLD+K L+ LM+ T LS+
Sbjct: 24  VFNVVTQDM-INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSR 82

Query: 179 VQIKNWISNRRRKEKLLSISPDIVEIINTQ 208
           +QIKNW+SNRRRKEK ++I+P++ ++++ +
Sbjct: 83  IQIKNWVSNRRRKEKTITIAPELADLLSGE 112

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCR039C (REAL)
          Length = 119

 Score =  108 bits (269), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 70/90 (77%), Gaps = 1/90 (1%)

Query: 119 VFNVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSK 178
           VFNV+TQDM I +  KP+RGHR  KE V  LE W+  +I+ PYLD+K L+ LM+ T LS+
Sbjct: 24  VFNVVTQDM-INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSR 82

Query: 179 VQIKNWISNRRRKEKLLSISPDIVEIINTQ 208
           +QIKNW+SNRRRKEK ++I+P++ ++++ +
Sbjct: 83  IQIKNWVSNRRRKEKTITIAPELADLLSGE 112

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCL067C (REAL)
          Length = 119

 Score =  108 bits (269), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 70/90 (77%), Gaps = 1/90 (1%)

Query: 119 VFNVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSK 178
           VFNV+TQDM I +  KP+RGHR  KE V  LE W+  +I+ PYLD+K L+ LM+ T LS+
Sbjct: 24  VFNVVTQDM-INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSR 82

Query: 179 VQIKNWISNRRRKEKLLSISPDIVEIINTQ 208
           +QIKNW+SNRRRKEK ++I+P++ ++++ +
Sbjct: 83  IQIKNWVSNRRRKEKTITIAPELADLLSGE 112

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
           HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
           required along with a1p for inhibiting expression of the
           HO endonuclease in a/alpha HO/HO diploid cells with an
           active mating-type interconversion system
          Length = 119

 Score =  108 bits (269), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 70/90 (77%), Gaps = 1/90 (1%)

Query: 119 VFNVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSK 178
           VFNV+TQDM I +  KP+RGHR  KE V  LE W+  +I+ PYLD+K L+ LM+ T LS+
Sbjct: 24  VFNVVTQDM-INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSR 82

Query: 179 VQIKNWISNRRRKEKLLSISPDIVEIINTQ 208
           +QIKNW+SNRRRKEK ++I+P++ ++++ +
Sbjct: 83  IQIKNWVSNRRRKEKTITIAPELADLLSGE 112

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  107 bits (268), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 70/90 (77%), Gaps = 1/90 (1%)

Query: 119 VFNVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSK 178
           VFNV+TQDM I +  KP+RGHR  KE V  LE W+  +I+ PYLD+K L+ LM+ T LS+
Sbjct: 90  VFNVVTQDM-INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSR 148

Query: 179 VQIKNWISNRRRKEKLLSISPDIVEIINTQ 208
           +QIKNW+SNRRRKEK ++I+P++ ++++ +
Sbjct: 149 IQIKNWVSNRRRKEKTITIAPELADLLSGE 178

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  107 bits (268), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 70/90 (77%), Gaps = 1/90 (1%)

Query: 119 VFNVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSK 178
           VFNV+TQDM I +  KP+RGHR  KE V  LE W+  +I+ PYLD+K L+ LM+ T LS+
Sbjct: 90  VFNVVTQDM-INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSR 148

Query: 179 VQIKNWISNRRRKEKLLSISPDIVEIINTQ 208
           +QIKNW+SNRRRKEK ++I+P++ ++++ +
Sbjct: 149 IQIKNWVSNRRRKEKTITIAPELADLLSGE 178

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score =  108 bits (270), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 70/90 (77%), Gaps = 1/90 (1%)

Query: 119 VFNVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSK 178
           VFNV+TQDM I +  KP+RGHR  KE V  LE W+  +I+ PYLD+K L+ LM+ T LS+
Sbjct: 133 VFNVVTQDM-INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSR 191

Query: 179 VQIKNWISNRRRKEKLLSISPDIVEIINTQ 208
           +QIKNW+SNRRRKEK ++I+P++ ++++ +
Sbjct: 192 IQIKNWVSNRRRKEKTITIAPELADLLSGE 221

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score =  100 bits (249), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 104/204 (50%), Gaps = 41/204 (20%)

Query: 2   NKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXXX 61
           ++I+I+ LLNP     +   L  INNQL+++CS  P  ++++ G     L  +       
Sbjct: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLP-KRQSLPGPSSDILRFL------- 56

Query: 62  XXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKYVFN 121
                   ++   I+ TY LS++L K+ +  +                         VFN
Sbjct: 57  -SRNNLDPQEIGLIKTTYRLSTLLSKLREHEI-------------------------VFN 90

Query: 122 VITQDMMIPEKNKP------HRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETK 175
           V+T+D ++ +K  P      +RGHR  +E V  LE WY  HI  PYLD  + + L ++T 
Sbjct: 91  VVTKDHLL-KKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTN 149

Query: 176 LSKVQIKNWISNRRRKEKLLSISP 199
           LSK+QIKNW++NRRRK+K + ISP
Sbjct: 150 LSKIQIKNWVANRRRKQKSIYISP 173

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score = 97.8 bits (242), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 105/214 (49%), Gaps = 43/214 (20%)

Query: 2   NKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXXX 61
           ++I+I+ LLNP     +   L  INNQL+++CS  P  +     S  I            
Sbjct: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSSDI---------LRF 55

Query: 62  XXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKYVFN 121
                   ++   I+ TY LS++L K+ +  +                         VFN
Sbjct: 56  LSRNNLDPQEIGLIKTTYRLSTLLSKLREHEI-------------------------VFN 90

Query: 122 VITQDMMIPEKNKP------HRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETK 175
           V+T+D ++ +K  P      +RGHR  +E V  LE WY  HI  PYLD  + + L ++T 
Sbjct: 91  VVTKDHLL-KKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTN 149

Query: 176 LSKVQIKNWISNRRRKEKLLSISPDIVEIINTQS 209
           LSK+QIKNW++NRRRK+K + IS  + +I N +S
Sbjct: 150 LSKIQIKNWVANRRRKQKSIYIS--LFDIHNIES 181

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score = 92.8 bits (229), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 66/90 (73%), Gaps = 3/90 (3%)

Query: 119 VFNVITQDMMIPEK---NKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETK 175
           +FNV+TQDMM   +   +  ++GHRLPK+ V  LE WY  +I+ PYL+  ++++LM ET 
Sbjct: 139 IFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETG 198

Query: 176 LSKVQIKNWISNRRRKEKLLSISPDIVEII 205
            S+ Q+KNW++N+RRK+K  +ISP++ +++
Sbjct: 199 FSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score = 92.8 bits (229), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 66/90 (73%), Gaps = 3/90 (3%)

Query: 119 VFNVITQDMMIPEK---NKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETK 175
           +FNV+TQDMM   +   +  ++GHRLPK+ V  LE WY  +I+ PYL+  ++++LM ET 
Sbjct: 139 IFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETG 198

Query: 176 LSKVQIKNWISNRRRKEKLLSISPDIVEII 205
            S+ Q+KNW++N+RRK+K  +ISP++ +++
Sbjct: 199 FSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score = 90.1 bits (222), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 73/253 (28%), Positives = 111/253 (43%), Gaps = 62/253 (24%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MNKI I  LLNP  +  +   L ++N +L+++CS+ P+AK       + QL  I+     
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAK----SMEETQLSEILKFLTK 56

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKYVF 120
                    ++   +  T +LS++L  ++K+   L+                 T++  VF
Sbjct: 57  TIKHEPLGKEETELVTTTVQLSTVLSSLVKEARQLHRLHHSQ----------STHNPRVF 106

Query: 121 NVITQDMMI--------PEKNK-------------------------------------- 134
           NV+TQ MM         P  N                                       
Sbjct: 107 NVLTQHMMSNSNSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHT 166

Query: 135 -PHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEK 193
             HRGHRLPK  +  LE W+L +   PYL + +L+ L  ++ LSK Q+KNWISNRRRKE+
Sbjct: 167 PSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

Query: 194 -LLSISPDIVEII 205
             L IS +I  ++
Sbjct: 227 HSLKISNNIASLL 239

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score = 89.0 bits (219), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 104/240 (43%), Gaps = 61/240 (25%)

Query: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVXXXXX 60
           MNKI I  LLNP  +  +   L ++N +L+++CS+ P+AK       + QL  I+     
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAK----SMEETQLSEILKFLTK 56

Query: 61  XXXXXXXXXKDCSNIQLTYELSSMLGKVLKDMVLLNGTXXXXXXXXXXXXXLETNSKYVF 120
                    ++   +  T +LS++L  ++K+   L+                 T++  VF
Sbjct: 57  TIKHEPLGKEETELVTTTVQLSTVLSSLVKEARQLHRLHHSQ----------STHNPRVF 106

Query: 121 NVITQDMMI--------PEKNK-------------------------------------- 134
           NV+TQ MM         P  N                                       
Sbjct: 107 NVLTQHMMSNSNSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHT 166

Query: 135 -PHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEK 193
             HRGHRLPK  +  LE W+L +   PYL + +L+ L  ++ LSK Q+KNWISNRRRKE+
Sbjct: 167 PSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score = 86.7 bits (213), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 40/76 (52%), Positives = 55/76 (72%)

Query: 133 NKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
            K HRGHRLP EKV +LE W+  +I KPYL+ + L+ L+ ET LS +QIKNW+SNRRRK+
Sbjct: 153 GKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKK 212

Query: 193 KLLSISPDIVEIINTQ 208
           K   I+  I +++ T+
Sbjct: 213 KSAGIADTISDLLFTK 228

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score = 79.3 bits (194), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (64%)

Query: 122 VITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQI 181
           ++TQD+M    N+  +G R PK  +  LE+WY  + + PYL   +L  + + T L+K QI
Sbjct: 139 ILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQI 198

Query: 182 KNWISNRRRKEKLLSISPDIVEIIN 206
           KNW++NRRRK+K+  +S DI  I+N
Sbjct: 199 KNWLANRRRKDKITEVSSDIRNILN 223

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {ON}
           conserved hypothetical protein
          Length = 108

 Score = 50.4 bits (119), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 148 RLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSISPDIVEIINT 207
           RLE W+ ++IQ PY +   +  L + T LS  QI+NW+SNRRRK +  SI   +  I+N+
Sbjct: 49  RLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPILNS 108

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (66%)

Query: 149 LEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEK 193
           LE+W+  +   PYL  K + +L E T LS  QI+NW+SNRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
           (HMRA2) - Regulatory protein MATa2p (no known function);
           sequence is the same as the last 119 residues of
           MATalpha2p [contig 123] FULL
          Length = 110

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (66%)

Query: 149 LEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEK 193
           LE+W+  +   PYL  K + +L E T LS  QI+NW+SNRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
           ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (66%)

Query: 149 LEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEK 193
           LE+W+  +   PYL  K + +L E T LS  QI+NW+SNRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (66%)

Query: 149 LEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEK 193
           LE+W+  +   PYL  K + +L E T LS  QI+NW+SNRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 1/60 (1%)

Query: 133 NKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           +KP R + LPKE V+ L +W LAH+  PY   +  + L+ +T LSKVQ+ NW  N RR++
Sbjct: 118 SKPRRTN-LPKETVDILNNWLLAHLNYPYPSPQEKRELLIKTGLSKVQLSNWFINVRRRK 176

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 37/62 (59%), Gaps = 1/62 (1%)

Query: 141 LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSISPD 200
           LPK  V  L  W L H+Q PY   +  K L+++T L+K+Q+ NW  N RR+ K+ S   D
Sbjct: 163 LPKNSVQILNQWLLNHLQNPYPTPQEKKELLKQTGLTKIQLSNWFINVRRR-KIFSDYYD 221

Query: 201 IV 202
           IV
Sbjct: 222 IV 223

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 137 RGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           R   LPKE +  L  W L H+Q PY  S+  + L+ +T L+KVQ+ NW  N RR++
Sbjct: 266 RRSNLPKETIRILNSWLLNHLQNPYPTSQEKRDLLIKTGLTKVQLSNWFINVRRRK 321

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 4/65 (6%)

Query: 132 KNKPHRGH----RLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISN 187
           K K H+ H     LPK  V+ L  W L HI  PY   +  + L+ +T L+K+QI NW  N
Sbjct: 186 KEKKHKAHGKRTNLPKATVSILNKWLLEHINNPYPTVQEKRELLAKTGLTKLQISNWFIN 245

Query: 188 RRRKE 192
            RR++
Sbjct: 246 ARRRK 250

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 138 GHR--LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           G R  LPK+ V+ L  W L H+  PY   K  + L+E T LSK+Q+ NW  N RR++
Sbjct: 155 GKRSNLPKQSVDVLNKWLLNHLGNPYPTPKEKEELLELTGLSKIQLSNWFINVRRRK 211

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 141 LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           LP+  V  L  W L H+  PY + +  K+L+E T L+KVQ+ NW  N RR++
Sbjct: 187 LPRGTVEVLNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRRK 238

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 137 RGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           R   LPKE V  L  W L H+Q PY  S+  + L+ +T L+KVQ+ NW  N RR++
Sbjct: 129 RRSNLPKEMVQILNTWLLNHLQNPYPTSQEKRELLIKTGLTKVQLSNWFINVRRRK 184

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (54%)

Query: 131 EKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRR 190
           E  K HR   LPKE V+ L  W   H   PY   +  K L+++T L+ VQ+ NW  N RR
Sbjct: 128 ETKKQHRRSNLPKETVDILNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRR 187

Query: 191 KE 192
           ++
Sbjct: 188 RK 189

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 124 TQDMMIPEKNKPHRGHR--LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQI 181
           ++++ + EK     G R  LPK  V  L  W L HI  PY   +  + L+ +T L+K+QI
Sbjct: 180 SKELSVKEKRLKGHGKRSNLPKATVCILNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQI 239

Query: 182 KNWISNRRRKE 192
            NW  N RR++
Sbjct: 240 SNWFINARRRK 250

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 141 LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSISPD 200
           LPKE +  L  W L H+  PY  S+  + L+ +T L+K+Q+ NW  N RR+ K+ +   D
Sbjct: 76  LPKETIQILNAWLLNHLHNPYPTSQEKRDLLIKTGLTKIQLSNWFINVRRR-KIFNGYYD 134

Query: 201 IVEIINT 207
           + +  NT
Sbjct: 135 LAKRCNT 141

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 141 LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           LPKE V  L +W LAH+  PY   +  + L+ +T L+ VQ+ NW  N RR++
Sbjct: 213 LPKETVQILNNWLLAHLHNPYPSPQEKRELLLKTGLNPVQLSNWFINVRRRK 264

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 33/59 (55%)

Query: 134 KPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           K HR   LPKE V+ L  W   H   PY   +  K L+++T L+ VQ+ NW  N RR++
Sbjct: 223 KQHRRSNLPKETVDILNEWLRDHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRRK 281

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 6/78 (7%)

Query: 132 KNKPHRGHR--LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRR 189
           K K + G R  LPKE V  L  W L H+  PY   +  + L+ +T L+K+Q+ NW  N R
Sbjct: 144 KKKQNSGRRSNLPKETVQVLNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVR 203

Query: 190 RKEKLLSISPDIVEIINT 207
           R+ K+ S   D   ++N+
Sbjct: 204 RR-KIFS---DYYTLVNS 217

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 6/78 (7%)

Query: 132 KNKPHRGHR--LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRR 189
           K K + G R  LPKE V  L  W L H+  PY   +  + L+ +T L+K+Q+ NW  N R
Sbjct: 147 KRKQNSGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVR 206

Query: 190 RKEKLLSISPDIVEIINT 207
           R+ K+ S   D   ++N+
Sbjct: 207 RR-KIFS---DYYTLVNS 220

>KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 234

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 141 LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISN-RRRK 191
           LPKE V  L  W  +H+  PY   +  + L+ +T LSKVQ+ NW  N RRRK
Sbjct: 109 LPKETVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRRK 160

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 4/65 (6%)

Query: 132 KNKPHRGH----RLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISN 187
           K K ++GH     LP   V+ L  W L HI  PY   +  + L+ +T L+K+QI NW  N
Sbjct: 188 KEKRNKGHGKRSNLPGATVHILNKWLLEHINNPYPTLQEKRELLAQTGLTKLQISNWFIN 247

Query: 188 RRRKE 192
            RR++
Sbjct: 248 ARRRK 252

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%)

Query: 134 KPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           K  R   LPK+ +  L  W L HI  PY   +  + L+ +T L+K+Q+ NW  N RR++
Sbjct: 75  KSKRRSNLPKDTIQILNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSNWFINVRRRK 133

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 4/65 (6%)

Query: 132 KNKPHRGH----RLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISN 187
           K K H+ H     LPK  V+ L  W   H+  PY   +  + L+ +T L+K+QI NW  N
Sbjct: 188 KEKKHKAHGKRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFIN 247

Query: 188 RRRKE 192
            RR++
Sbjct: 248 ARRRK 252

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 141 LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           LPK+ V  L  W L H+  PY  S+  + L+ +T LSK+Q+ NW  N RR++
Sbjct: 183 LPKDTVLILNRWLLDHLHNPYPTSQEKRELLIKTGLSKIQLSNWFINVRRRK 234

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 6/78 (7%)

Query: 132 KNKPHRGHR--LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRR 189
           + K + G R  LPKE V  L  W L H+  PY   +  + L+ +T L+K+Q+ NW  N R
Sbjct: 158 RRKQNSGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVR 217

Query: 190 RKEKLLSISPDIVEIINT 207
           R+ K+ S   D   ++N+
Sbjct: 218 RR-KIFS---DYYTLVNS 231

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 6/78 (7%)

Query: 132 KNKPHRGHR--LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRR 189
           K K + G R  LPKE V  L  W L H+  PY   +  + L+ +T L+K+Q+ NW  N R
Sbjct: 146 KKKQNSGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVR 205

Query: 190 RKEKLLSISPDIVEIINT 207
           R+ K+ S   D   ++N+
Sbjct: 206 RR-KIFS---DYYTLVNS 219

>KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON}
           Anc_6.170 YPL177C
          Length = 324

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%)

Query: 141 LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEKLL 195
           LP+E V  L +W L H+  PY        L+ +T L+K+Q+ NW  N RR++  +
Sbjct: 246 LPRETVQMLNNWLLNHLHDPYPTPHEKLELLRQTGLTKIQLSNWFINVRRRKVFV 300

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%)

Query: 141 LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           LPKE +N L  W L ++  PY   +  + L+E+T L+ VQ+ NW  N RR++
Sbjct: 256 LPKEVINVLNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRRK 307

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 6/65 (9%)

Query: 133 NKPHRGHR------LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWIS 186
            K H+G R      LPKE V  L  W L H+  PY   +  + L+ +T L+K+Q+ NW  
Sbjct: 70  GKNHKGSRSGRRSNLPKETVQILNRWLLDHLGNPYPTPQEKRDLLIKTGLTKIQLSNWFI 129

Query: 187 NRRRK 191
           N RR+
Sbjct: 130 NVRRR 134

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 137 RGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           R   LPKE V  L  W L H++ PY   +  + L+ +T L+K+Q+ NW  N RR++
Sbjct: 132 RRSNLPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWFINVRRRK 187

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 132 KNKPHRGHR--LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRR 189
           K+K   G R  LPKE V  L +W + H+  PY  +     L+++T L+K+Q+ NW  N R
Sbjct: 264 KSKKGTGKRSNLPKETVQILNNWLVNHLGNPYPTAIEKNELLKQTGLTKIQLSNWFINVR 323

Query: 190 RKE 192
           R++
Sbjct: 324 RRK 326

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%)

Query: 126 DMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWI 185
           +M +  K    R   LP   V  L  W L H+  PY  ++  K L+++T L+K+Q+ NW 
Sbjct: 297 EMNMRRKKGSGRRSSLPITTVQILNEWLLDHLTNPYPTTQEKKELLKQTGLTKIQLSNWF 356

Query: 186 SNRRRKE 192
            N RR++
Sbjct: 357 INVRRRK 363

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%)

Query: 141 LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           LPKE V  L  W L H++ PY   K    L+  T L+K+Q+ NW  N RR++
Sbjct: 182 LPKETVQILNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWFINVRRRK 233

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 141 LPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSISPD 200
           LPKE V  L  W   HI  PY   +    L  +T L+K+Q+ NW  N RR++    +  D
Sbjct: 168 LPKETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRRK----VFAD 223

Query: 201 IVEIIN 206
             +I N
Sbjct: 224 YYDITN 229

>Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)
          Length = 45

 Score = 37.7 bits (86), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 24/43 (55%)

Query: 1  MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENV 43
          MNKI I DLLNP       SN+  IN +L +IC   P   E+V
Sbjct: 1  MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPKLPESV 43

>Suva_69.1 Chr69 complement(1..102) [102 bp, 34 aa] {ON} YCR039C
          (REAL)
          Length = 34

 Score = 32.0 bits (71), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%)

Query: 1  MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICS 34
          MNKI I DLLNP       S++  IN +L +IC 
Sbjct: 1  MNKIPIKDLLNPQITDEFKSSILDINKKLFSICC 34

>AFR643C Chr6 complement(1608340..1608648) [309 bp, 102 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR097W
           (HMRA1)
          Length = 102

 Score = 30.8 bits (68), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 133 NKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           +K  R   LPKE    LE  +    +K + ++K  + + E+  L+ +QI+ W +N+R + 
Sbjct: 39  DKQRRRTVLPKETKEFLESVFE---RKRWPNAKERRAIAEKCGLTPIQIRIWFTNKRMRS 95

Query: 193 K 193
           K
Sbjct: 96  K 96

>ADL394C Chr4 complement(18058..18366) [309 bp, 102 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCR097W
           (HMRA1)
          Length = 102

 Score = 29.6 bits (65), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 133 NKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192
           +K  R   LPKE    LE  +    +K   ++K  + + E+  L+ +QI+ W +N+R + 
Sbjct: 39  DKQRRRTVLPKETKEFLESVFE---RKRCPNAKERRAIAEKCGLTPIQIRIWFTNKRMRS 95

Query: 193 K 193
           K
Sbjct: 96  K 96

>TPHA0C03620 Chr3 complement(785783..787429) [1647 bp, 548 aa] {ON}
           Anc_2.337 YDL106C
          Length = 548

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 112 LETNSKYVFNVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLM 171
            ++N+  + N+   + M P K K  R      E ++ L+  +L +       SK  KVL 
Sbjct: 19  FQSNAPPMQNLTKNNDMDPSKQKRTRAR---GEALDVLKAEFLKNTNP---SSKRRKVLS 72

Query: 172 EETKLSKVQIKNWISNRRRKEK 193
           E T LS+ +I+ W  NRR K +
Sbjct: 73  EVTGLSEKKIRIWFQNRRAKMR 94

>TPHA0D01370 Chr4 complement(283224..283940) [717 bp, 238 aa] {ON}
           Anc_8.693 YPL166W
          Length = 238

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 129 IPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNR 188
           +PEK    R + L   K+ +L+H  L       +DSK  K++  E + + +QI  +ISN+
Sbjct: 65  VPEKYLKQRTYSLISSKLKKLDH--LKQKVNKIIDSKGSKIIDLEAQRTNLQISQYISNK 122

>Kpol_1043.24 s1043 (47321..48904) [1584 bp, 527 aa] {ON}
           (47321..48904) [1584 nt, 528 aa]
          Length = 527

 Score = 29.3 bits (64), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 164 SKNLKVLMEETKLSKVQIKNWISNRRRK 191
           SK  KVL E T LS+ +++ W  NRR K
Sbjct: 148 SKRRKVLSELTGLSEKKVRIWFQNRRAK 175

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,995,852
Number of extensions: 747789
Number of successful extensions: 2429
Number of sequences better than 10.0: 81
Number of HSP's gapped: 2438
Number of HSP's successfully gapped: 83
Length of query: 211
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 106
Effective length of database: 41,441,469
Effective search space: 4392795714
Effective search space used: 4392795714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)