Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0A001001.1ON1351356398e-87
NCAS0B091501.1ON1501001518e-13
CAGL0B01243g1.120ON143511212e-08
YCR040W (MATALPHA1)1.120ON1751051222e-08
YCL066W (HMLALPHA1)1.1ON1751051222e-08
CAGL0B00242g1.1ON184511214e-08
ZYRO0F18590g1.1ON200641172e-07
ZYRO0F15840g1.120ON200641172e-07
Smik_92.1singletonON1561051143e-07
TDEL0C070101.1ON205701135e-07
Skud_71.1singletonON155591073e-06
Skud_3.1191.120ON1741011073e-06
Suva_3.1481.1ON175611064e-06
Suva_69.2singletonON145541039e-06
KNAG0C001501.1ON14558897e-04
TPHA0E036201.120ON19563917e-04
TPHA0E040801.1ON19563917e-04
KAFR0D007101.120ON17253907e-04
Kpol_2002.21.1ON20961900.001
TBLA0A070401.120ON20161820.009
TBLA0A075901.1ON20161820.009
Skud_7.473.536ON28056760.074
Smik_7.423.536ON28091750.12
YGL224C (SDT1)3.536ON28056700.40
Suva_7.383.536ON28056690.66
KLLA0C00352g1.1ON26166661.5
NOTE: 3 genes in the same pillar as NDAI0A00100 were not hit in these BLAST results
LIST: KLTH0F00374g Kwal_YGOB_HMalpha1 Ecym_1003

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0A00100
         (135 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...   250   8e-87
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      63   8e-13
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...    51   2e-08
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...    52   2e-08
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...    52   2e-08
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...    51   4e-08
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...    50   2e-07
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...    50   2e-07
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...    49   3e-07
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....    48   5e-07
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...    46   3e-06
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...    46   3e-06
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...    45   4e-06
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)        44   9e-06
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    39   7e-04
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...    40   7e-04
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...    40   7e-04
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    39   7e-04
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...    39   0.001
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...    36   0.009
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...    36   0.009
Skud_7.47 Chr7 complement(83327..84169) [843 bp, 280 aa] {ON} YG...    34   0.074
Smik_7.42 Chr7 complement(72815..73657) [843 bp, 280 aa] {ON} YG...    33   0.12 
YGL224C Chr7 complement(78015..78857) [843 bp, 280 aa] {ON}  SDT...    32   0.40 
Suva_7.38 Chr7 complement(73061..73903) [843 bp, 280 aa] {ON} YG...    31   0.66 
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    30   1.5  

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score =  250 bits (639), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 120/135 (88%), Positives = 120/135 (88%)

Query: 1   MFQYYSSKEEAGGGSTTTKMVPPPPKWFLDSINFEHNPTTRLTYFQKESILRPYQSRCYA 60
           MFQYYSSKEEAGGGSTTTKMVPPPPKWFLDSINFEHNPTTRLTYFQKESILRPYQSRCYA
Sbjct: 1   MFQYYSSKEEAGGGSTTTKMVPPPPKWFLDSINFEHNPTTRLTYFQKESILRPYQSRCYA 60

Query: 61  KSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEGGIC 120
           KSINGFMLFRSYYSQYG               WNAHETDQLLWDQFAQQCNAIGHEGGIC
Sbjct: 61  KSINGFMLFRSYYSQYGKGLKQSLLSPLLSKLWNAHETDQLLWDQFAQQCNAIGHEGGIC 120

Query: 121 EDGTGICKVVSLFTP 135
           EDGTGICKVVSLFTP
Sbjct: 121 EDGTGICKVVSLFTP 135

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 62.8 bits (151), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 50/100 (50%), Gaps = 6/100 (6%)

Query: 21  VPPPPKWFLDSINFEHNPTTRLTYFQKESIL-RPYQSRCYAKSINGFMLFRSYYSQYGXX 79
           +P PP W L  +      T R+ Y  K+    R   +   +K INGF+LFRSYYS++G  
Sbjct: 54  IPQPPNWVLQELE-----TIRIIYPSKQKPKPRKQVTSNPSKPINGFILFRSYYSRWGYG 108

Query: 80  XXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEGGI 119
                        W + +TDQ LWD FA Q + +G E G+
Sbjct: 109 IKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTVGCEMGV 148

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 28/51 (54%)

Query: 61  KSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCN 111
           + +N FM FR+YY+Q G               WNA ETDQ +WD FAQQ N
Sbjct: 73  RPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFN 123

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score = 51.6 bits (122), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 44/105 (41%), Gaps = 10/105 (9%)

Query: 21  VPPPPKWFLDSINFEH----NPTTRLTYFQKESILRPYQSRCYAKSINGFMLFRSYYSQY 76
           +P P   FL+ I        +  T+   F K SI      +   K +N FM FR+YYSQ+
Sbjct: 53  IPVPSSRFLNKIQIHRIASGSQNTQFRQFNKTSI------KSSKKYLNSFMAFRAYYSQF 106

Query: 77  GXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEGGICE 121
           G               W+A +    +WD FAQQ N I    G  E
Sbjct: 107 GSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVE 151

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score = 51.6 bits (122), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 44/105 (41%), Gaps = 10/105 (9%)

Query: 21  VPPPPKWFLDSINFEH----NPTTRLTYFQKESILRPYQSRCYAKSINGFMLFRSYYSQY 76
           +P P   FL+ I        +  T+   F K SI      +   K +N FM FR+YYSQ+
Sbjct: 53  IPVPSSRFLNKIQIHRIASGSQNTQFRQFNKTSI------KSSKKYLNSFMAFRAYYSQF 106

Query: 77  GXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEGGICE 121
           G               W+A +    +WD FAQQ N I    G  E
Sbjct: 107 GSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVE 151

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score = 51.2 bits (121), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 28/51 (54%)

Query: 61  KSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCN 111
           + +N FM FR+YY+Q G               WNA ETDQ +WD FAQQ N
Sbjct: 114 RPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFN 164

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%)

Query: 58  CYAKSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEG 117
           C  K +N FM FR+Y SQ+G               W++H   Q +WD FAQQ N +  + 
Sbjct: 125 CSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKC 184

Query: 118 GICE 121
           G  E
Sbjct: 185 GFVE 188

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%)

Query: 58  CYAKSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEG 117
           C  K +N FM FR+Y SQ+G               W++H   Q +WD FAQQ N +  + 
Sbjct: 125 CSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKC 184

Query: 118 GICE 121
           G  E
Sbjct: 185 GFVE 188

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score = 48.5 bits (114), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 42/105 (40%), Gaps = 10/105 (9%)

Query: 21  VPPPPKWFLDSINFEH----NPTTRLTYFQKESILRPYQSRCYAKSINGFMLFRSYYSQY 76
           +P P   FL  I        N   +     K SI      +   K +N FM FR+YYSQ+
Sbjct: 53  IPIPSSRFLKKIQIHRIASGNQHIQCRQLNKTSI------KSTKKYLNSFMAFRAYYSQF 106

Query: 77  GXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEGGICE 121
           G               W+A +T   +WD FAQQ N I    G  E
Sbjct: 107 GSGVKQNILSSLLSEEWHADKTQHGIWDYFAQQYNFINPGFGFVE 151

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score = 48.1 bits (113), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%)

Query: 52  RPYQSRCYAKSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCN 111
           +P +     K +N FM FR+Y SQ+G               W++H   Q +WD FAQQ N
Sbjct: 126 KPARETASNKPLNSFMAFRAYNSQFGYGLKQNILSSLLASAWHSHPEQQGIWDTFAQQFN 185

Query: 112 AIGHEGGICE 121
            +  + G  E
Sbjct: 186 FVKPKCGFVE 195

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 28/59 (47%)

Query: 63  INGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEGGICE 121
           IN FM FR+YYSQ+G               W+A +    +WD FAQQ N I    G  E
Sbjct: 92  INSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVE 150

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 41/101 (40%), Gaps = 2/101 (1%)

Query: 21  VPPPPKWFLDSINFEHNPTTRLTYFQKESILRPYQSRCYAKSINGFMLFRSYYSQYGXXX 80
           +P P   FL  I      +   T   ++  L     +   K IN FM FR+YYSQ+G   
Sbjct: 52  IPAPASRFLKKIQIHRISSGNQTTQCRQ--LSKASIKSSKKHINSFMAFRAYYSQFGSGV 109

Query: 81  XXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEGGICE 121
                       W+A +    +WD FAQQ N I    G  E
Sbjct: 110 KQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVE 150

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 29/61 (47%)

Query: 61  KSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEGGIC 120
           K +N FM FR+YYSQ+G               W+A +    +WD FAQQ N I    G  
Sbjct: 91  KYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFV 150

Query: 121 E 121
           E
Sbjct: 151 E 151

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score = 44.3 bits (103), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%)

Query: 61  KSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIG 114
           K +N FM FR+YYSQ+G               W+A +    +WD FAQQ N I 
Sbjct: 91  KYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFIN 144

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 38.9 bits (89), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 26/58 (44%)

Query: 58  CYAKSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGH 115
           C   S+N F+ FR+YYSQ+                W ++++ Q  WD+  +Q   I  
Sbjct: 87  CKHGSLNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQYKQIDR 144

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score = 39.7 bits (91), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (47%)

Query: 59  YAKSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEGG 118
           + KS+N F+ FR+Y +Q+G               W++      +WD FAQQ N +  + G
Sbjct: 120 FKKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCG 179

Query: 119 ICE 121
             E
Sbjct: 180 FVE 182

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score = 39.7 bits (91), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (47%)

Query: 59  YAKSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEGG 118
           + KS+N F+ FR+Y +Q+G               W++      +WD FAQQ N +  + G
Sbjct: 120 FKKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCG 179

Query: 119 ICE 121
             E
Sbjct: 180 FVE 182

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 39.3 bits (90), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%)

Query: 58  CYAKSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQC 110
           C  +++N FM FRSYYSQY                W++   +Q  W    Q+C
Sbjct: 116 CQNRNLNPFMAFRSYYSQYAQGLKQIELSEVLAKAWHSDTKEQNYWISLTQKC 168

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%)

Query: 61  KSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEGGIC 120
           KS+NGFM FR+Y SQ+G               W++    Q  W   +QQ N +  + G  
Sbjct: 135 KSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKCGFV 194

Query: 121 E 121
           E
Sbjct: 195 E 195

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score = 36.2 bits (82), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 30/61 (49%)

Query: 61  KSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEGGIC 120
           + +NGF+ FR+Y SQ+G               W+ +   Q +W+ F+Q+ N +  + G  
Sbjct: 127 RVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFV 186

Query: 121 E 121
           E
Sbjct: 187 E 187

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score = 36.2 bits (82), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 30/61 (49%)

Query: 61  KSINGFMLFRSYYSQYGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQCNAIGHEGGIC 120
           + +NGF+ FR+Y SQ+G               W+ +   Q +W+ F+Q+ N +  + G  
Sbjct: 127 RVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFV 186

Query: 121 E 121
           E
Sbjct: 187 E 187

>Skud_7.47 Chr7 complement(83327..84169) [843 bp, 280 aa] {ON}
           YGL224C (REAL)
          Length = 280

 Score = 33.9 bits (76), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%)

Query: 22  PPPPKWFLDSINFEHNPTTRLTYFQKESILRPYQSRCYAKSINGFMLFRSYYSQYG 77
           P    +F D  N  +  +TR+    ++SILR +Q+     S +  +L  +YY QYG
Sbjct: 53  PNSKVFFFDIDNCLYKSSTRIHDLMQQSILRFFQTHLKLASEDAQVLNNTYYKQYG 108

>Smik_7.42 Chr7 complement(72815..73657) [843 bp, 280 aa] {ON}
           YGL224C (REAL)
          Length = 280

 Score = 33.5 bits (75), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 7/91 (7%)

Query: 22  PPPPK---WFLDSINFEHNPTTRLTYFQKESILRPYQSRCYAKSINGFMLFRSYYSQYGX 78
           PP P    +F D  N  +  +T++    ++SILR +Q+       +  +L  +YY QYG 
Sbjct: 50  PPDPNLKVFFFDIDNCLYKSSTKIHDLMQKSILRFFQTHLKLSPEDAHVLNNTYYKQYGL 109

Query: 79  XXXXXXXXXXXXXXWNAHETDQLLWDQFAQQ 109
                          NA E +QL+ D    Q
Sbjct: 110 AIRGLVMFHKV----NALEYNQLVDDSLPLQ 136

>YGL224C Chr7 complement(78015..78857) [843 bp, 280 aa] {ON}
           SDT1Pyrimidine nucleotidase; overexpression suppresses
           the 6-AU sensitivity of transcription elongation factor
           S-II, as well as resistance to other pyrimidine
           derivatives
          Length = 280

 Score = 31.6 bits (70), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%)

Query: 22  PPPPKWFLDSINFEHNPTTRLTYFQKESILRPYQSRCYAKSINGFMLFRSYYSQYG 77
           P    +F D  N  +  +TR+    ++SILR +Q+       +  +L  SYY +YG
Sbjct: 53  PNLKVFFFDIDNCLYKSSTRIHDLMQQSILRFFQTHLKLSPEDAHVLNNSYYKEYG 108

>Suva_7.38 Chr7 complement(73061..73903) [843 bp, 280 aa] {ON}
           YGL224C (REAL)
          Length = 280

 Score = 31.2 bits (69), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%)

Query: 22  PPPPKWFLDSINFEHNPTTRLTYFQKESILRPYQSRCYAKSINGFMLFRSYYSQYG 77
           P    +F D  N  +  +TR+    ++SI+R +Q+       +  +L  +YY QYG
Sbjct: 53  PASKVFFFDIDNCLYKSSTRIHDLMQQSIVRFFQTHLKLAPEDAQVLNNTYYKQYG 108

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 30.0 bits (66), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 28/66 (42%), Gaps = 3/66 (4%)

Query: 52  RPYQSRCYAKSINGFMLFRSYYSQ-YGXXXXXXXXXXXXXXXWNAHETDQLLWDQFAQQ- 109
           R  +++   K IN F+ FRSYYS+                  W   +  +  W+  AQ+ 
Sbjct: 95  RDVKTKTKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEY 154

Query: 110 -CNAIG 114
            C+A G
Sbjct: 155 NCDASG 160

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,628,124
Number of extensions: 459691
Number of successful extensions: 1029
Number of sequences better than 10.0: 29
Number of HSP's gapped: 1027
Number of HSP's successfully gapped: 29
Length of query: 135
Length of database: 53,481,399
Length adjustment: 97
Effective length of query: 38
Effective length of database: 42,358,797
Effective search space: 1609634286
Effective search space used: 1609634286
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)