Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0I019203.190ON1281285266e-70
KLTH0G16082g3.190ON1351222908e-34
KAFR0A012403.190ON1731122912e-33
Kwal_56.231123.190ON1351222837e-33
TDEL0H033703.190ON1531222752e-31
NDAI0A065203.190ON2061302766e-31
TBLA0A002603.190ON1841262731e-30
ZYRO0A04906g3.190ON1601222711e-30
Skud_4.2433.190ON1651122651e-29
Kpol_1045.683.190ON1761262651e-29
Smik_4.2243.190ON1651052614e-29
YDL008W (APC11)3.190ON1651122599e-29
Suva_4.2393.190ON1651052572e-28
KNAG0J012503.190ON2021272592e-28
Ecym_53123.190ON1481132552e-28
AER016C3.190ON1471132491e-27
SAKL0C10516g3.190ON144782473e-27
CAGL0I04576g3.190ON1491132465e-27
KLLA0E17711g3.190ON1621262381e-25
TPHA0H006403.190ON1801322373e-25
Kwal_55.220543.28ON1111141262e-09
NCAS0C044803.28ON1091091252e-09
Kpol_1014.163.28ON1071091201e-08
CAGL0E01567g3.28ON1021091182e-08
TDEL0A004703.28ON1181091174e-08
YOL133W (HRT1)3.28ON1211091174e-08
Suva_15.263.28ON1221091175e-08
Smik_15.203.28ON1211091175e-08
SAKL0C13178g3.28ON138701175e-08
Skud_15.203.28ON1211091166e-08
ZYRO0C03058g3.28ON1161091167e-08
TBLA0B087103.28ON1221091158e-08
NDAI0G038603.28ON1231091159e-08
KNAG0A012803.28ON1141091132e-07
KAFR0C017803.28ON118651122e-07
Ecym_20293.28ON1141091096e-07
KLTH0F19228g3.28ON1101141087e-07
ADL181W3.28ON1081021071e-06
TPHA0P014703.28ON111651061e-06
KLLA0E07151g3.28ON110651001e-05
NDAI0K007108.799ON159160943e-04
Kpol_480.258.799ON157160934e-04
Suva_13.4328.799ON155965926e-04
YMR247C (RKR1)8.799ON156265926e-04
Skud_13.4198.799ON156465926e-04
Ecym_72442.542ON53254917e-04
Smik_13.4608.799ON156665918e-04
KNAG0J005408.799ON156165918e-04
SAKL0B06226g8.799ON155760900.001
ZYRO0F12760g8.799ON155565880.002
NCAS0C006808.799ON156465880.002
TPHA0I005908.799ON159160880.002
KAFR0B036208.799ON156060870.003
TDEL0B009808.799ON155960860.004
Kwal_55.21206singletonON27560840.005
KLTH0E13992g8.799ON155065850.005
Kwal_27.123278.799ON157465850.005
KNAG0C056602.542ON50763840.007
Kpol_1072.552.157ON42046830.008
Ecym_74188.799ON154762830.009
ABL058C8.799ON154662820.013
Ecym_54453.405ON32153810.013
KLLA0C14344g8.799ON151860810.016
TBLA0F032803.405ON55545810.017
AGL079C2.542ON50646810.018
KLLA0F25740g2.542ON51747790.034
KLLA0C05874g6.45ON55358780.035
CAGL0L01947g2.545ON75765780.037
Suva_11.1892.545ON75839780.039
ZYRO0G18260g1.190ON86255780.041
KLTH0F18502gsingletonON26760770.042
KNAG0A070902.545ON76261780.043
Skud_11.1922.545ON75839780.043
Ecym_72412.545ON75865770.051
CAGL0H02651g8.799ON154455770.053
Kwal_26.80992.545ON75039770.053
SAKL0A09812g2.545ON75139770.055
Smik_11.2132.545ON75939770.059
ZYRO0E05632g2.545ON76539770.059
KLTH0D07216g2.545ON74739770.063
CAGL0B05049g1.389ON147046770.064
Kpol_1002.72.545ON75439770.064
Skud_8.352.542ON58547760.068
Smik_8.322.542ON58547760.068
YHL010C (ETP1)2.542ON58547760.068
Suva_8.422.542ON58547760.069
KAFR0B014602.545ON76139760.071
TBLA0I019603.279ON18470750.073
TDEL0B063402.545ON76235760.081
CAGL0K02563g2.542ON58659760.082
Kpol_1002.82.542ON55862750.090
YKL034W (TUL1)2.545ON75839750.093
KAFR0A019902.542ON56046750.11
KLLA0F25674g2.545ON75739750.11
Ecym_26583.279ON15944730.12
TPHA0C042602.545ON75739740.12
SAKL0D03058g3.279ON15556730.12
ZYRO0B02244g2.542ON56346740.13
TBLA0I014902.545ON75039740.14
TDEL0A031802.542ON56746730.17
NCAS0A047602.545ON76134730.17
Suva_15.223.22ON133655730.18
TBLA0G023102.542ON67474730.21
TBLA0D040208.288ON117853730.21
NCAS0A04680singletonON27456720.22
KAFR0I020901.389ON146643730.23
KLLA0C15697g3.405ON30476720.23
AFR275W2.545ON75339720.23
TBLA0B005606.45ON49229720.26
NCAS0A125502.542ON57246720.28
NDAI0B018202.542ON62546710.40
TPHA0F018402.157ON52153700.47
NDAI0K018102.545ON76239700.47
Kpol_505.182.157ON58547700.49
KLTH0D07150g2.542ON54047700.50
KAFR0F007402.157ON51032700.52
NCAS0A113503.405ON42863690.56
Kwal_27.104198.808ON30039690.56
KAFR0D016708.808ON35747690.56
NDAI0G052001.389ON158633700.58
ZYRO0G13376g8.808ON44572690.63
SAKL0E04488g2.411ON112757690.65
SAKL0B08976g3.405ON32247690.66
Kwal_56.225226.45ON51329690.68
TPHA0C042502.542ON55647690.71
KNAG0H035102.157ON55138690.72
KLTH0C05258g3.279ON15244670.79
SAKL0A09746g2.542ON54847680.83
Skud_8.1762.157ON41345680.86
TPHA0B036501.389ON157644680.94
TBLA0B026708.808ON47839671.0
Smik_8.1932.157ON41645671.0
Kpol_1035.506.45ON60129671.0
Kwal_27.105463.279ON10444651.1
SAKL0E10824g2.157ON47538671.1
SAKL0E01958g6.45ON52429671.1
CAGL0E02299g6.45ON54529671.2
Smik_15.163.22ON132655671.2
KAFR0B055808.288ON112041671.3
Kwal_26.80902.542ON52047671.3
SAKL0H16390g8.288ON114037671.3
ZYRO0C07194g6.45ON55829671.3
NCAS0B069902.157ON52139661.4
Ecym_30486.45ON67029661.4
TBLA0H002303.22ON133342661.4
AGR034W3.279ON15952651.5
KAFR0A052406.45ON55329661.5
ZYRO0E06996g3.279ON17243651.6
Suva_15.1596.45ON55029661.7
Smik_15.1576.45ON55029661.7
YOL013C (HRD1)6.45ON55129661.7
NCAS0A082803.279ON11851641.7
KLTH0E09834g2.157ON47938661.8
NDAI0F027702.157ON55445651.9
ABR104W3.405ON32827651.9
Kwal_47.179042.157ON47038652.0
ZYRO0C17424g3.405ON27347652.1
NCAS0G025202.157ON51838652.2
NCAS0D020106.45ON51029652.2
YOL138C (RTC1)3.22ON134155652.5
NCAS0D045406.332ON46933642.6
YHR115C (DMA1)2.157ON41645642.6
KNAG0A074303.405ON10231622.7
KNAG0I020902.157ON42732642.7
TDEL0G042506.45ON51727642.8
TBLA0B012602.157ON88532642.9
KAFR0I028603.22ON136561643.0
AGR067W8.288ON112536643.2
KLLA0F18458g3.279ON14033623.3
TDEL0C054203.405ON9345613.4
Ecym_54282.157ON47438633.6
ACR267C2.157ON46738633.7
KAFR0C004603.279ON15775623.8
TDEL0E010204.268ON66744633.9
Ecym_42808.288ON113231634.1
Skud_15.163.22ON133255634.2
Smik_2.1963.279ON18535624.6
ZYRO0B16258g2.157ON57930624.8
Suva_4.3023.279ON15035614.9
CAGL0L03960g2.157ON60338624.9
KLTH0C04664g8.808ON30635625.0
Skud_2.1863.279ON17835615.2
TDEL0F02870na 1ON26037625.3
NCAS0A025504.268ON71244625.5
KLLA0F23892g2.157ON51845625.7
YBR062C3.279ON18035616.0
TDEL0B052002.157ON52430616.2
KNAG0J008503.279ON16227606.3
Skud_16.3793.405ON28830616.4
CAGL0D00638g4.268ON69344616.9
CAGL0H10274g3.279ON17535607.4
NDAI0A074503.279ON17327598.8
Smik_16.3333.405ON29027609.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0I01920
         (128 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.19...   207   6e-70
KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some ...   116   8e-34
KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.19...   116   2e-33
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...   113   7e-33
TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON...   110   2e-31
NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3....   110   6e-31
TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...   109   1e-30
ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {O...   108   1e-30
Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W (...   106   1e-29
Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {...   106   1e-29
Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W (...   105   4e-29
YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Cataly...   104   9e-29
Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W (...   103   2e-28
KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {O...   104   2e-28
Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON} ...   102   2e-28
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...   100   1e-27
SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar...   100   3e-27
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...    99   5e-27
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...    96   1e-25
TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.19...    96   3e-25
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    53   2e-09
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       53   2e-09
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    51   1e-08
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    50   2e-08
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    50   4e-08
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    50   4e-08
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    50   5e-08
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    50   5e-08
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    50   5e-08
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    49   6e-08
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    49   7e-08
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    49   8e-08
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    49   9e-08
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    48   2e-07
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    48   2e-07
Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to A...    47   6e-07
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    46   7e-07
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    46   1e-06
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    45   1e-06
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    43   1e-05
NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8...    41   3e-04
Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON} (57636.....    40   4e-04
Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] ...    40   6e-04
YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}...    40   6e-04
Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] ...    40   6e-04
Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}...    40   7e-04
Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] ...    40   8e-04
KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.7...    40   8e-04
SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} simil...    39   0.001
ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa...    39   0.002
NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8....    39   0.002
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    39   0.002
KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {...    38   0.003
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    38   0.004
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    37   0.005
KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} sim...    37   0.005
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    37   0.005
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    37   0.007
Kpol_1072.55 s1072 (126281..127543) [1263 bp, 420 aa] {ON} (1262...    37   0.008
Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar ...    37   0.009
ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON} ...    36   0.013
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    36   0.013
KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} sim...    36   0.016
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    36   0.017
AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON} S...    36   0.018
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    35   0.034
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...    35   0.035
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    35   0.037
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    35   0.039
ZYRO0G18260g Chr7 (1506002..1508590) [2589 bp, 862 aa] {ON} simi...    35   0.041
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    34   0.042
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    35   0.043
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    35   0.043
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    34   0.051
CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} simil...    34   0.053
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    34   0.053
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    34   0.055
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    34   0.059
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    34   0.059
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    34   0.063
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    34   0.064
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    34   0.064
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    34   0.068
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    34   0.068
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    34   0.068
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    34   0.069
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    34   0.071
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    33   0.073
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    34   0.081
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    34   0.082
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    33   0.090
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    33   0.093
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    33   0.11 
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    33   0.11 
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    33   0.12 
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    33   0.12 
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    33   0.12 
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    33   0.13 
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    33   0.14 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    33   0.17 
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    33   0.17 
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    33   0.18 
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    33   0.21 
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    33   0.21 
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      32   0.22 
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    33   0.23 
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    32   0.23 
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    32   0.23 
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...    32   0.26 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    32   0.28 
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     32   0.40 
TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {O...    32   0.47 
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    32   0.47 
Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}...    32   0.49 
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    32   0.50 
KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.1...    32   0.52 
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    31   0.56 
Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W...    31   0.56 
KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa] {O...    31   0.56 
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    32   0.58 
ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]...    31   0.63 
SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} simil...    31   0.65 
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    31   0.66 
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...    31   0.68 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    31   0.71 
KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {O...    31   0.72 
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    30   0.79 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    31   0.83 
Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON...    31   0.86 
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    31   0.94 
TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.8...    30   1.0  
Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON...    30   1.0  
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...    30   1.0  
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    30   1.1  
SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {...    30   1.1  
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...    30   1.1  
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...    30   1.2  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    30   1.2  
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    30   1.3  
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    30   1.3  
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    30   1.3  
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...    30   1.3  
NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa] ...    30   1.4  
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...    30   1.4  
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    30   1.4  
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    30   1.5  
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...    30   1.5  
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    30   1.6  
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...    30   1.7  
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...    30   1.7  
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...    30   1.7  
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    29   1.7  
KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {...    30   1.8  
NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {O...    30   1.9  
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    30   1.9  
Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {...    30   2.0  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    30   2.1  
NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.1...    30   2.2  
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...    30   2.2  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    30   2.5  
NCAS0D04540 Chr4 (861304..862713) [1410 bp, 469 aa] {ON} Anc_6.3...    29   2.6  
YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}  ...    29   2.6  
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    28   2.7  
KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {O...    29   2.7  
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...    29   2.8  
TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.1...    29   2.9  
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    29   3.0  
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    29   3.2  
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    28   3.3  
TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}...    28   3.4  
Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}...    29   3.6  
ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON} S...    29   3.7  
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    28   3.8  
TDEL0E01020 Chr5 complement(208284..210287) [2004 bp, 667 aa] {O...    29   3.9  
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    29   4.1  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    29   4.2  
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    28   4.6  
ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]...    28   4.8  
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    28   4.9  
CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa] ...    28   4.9  
KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some si...    28   5.0  
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    28   5.2  
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      28   5.3  
NCAS0A02550 Chr1 complement(484341..486479) [2139 bp, 712 aa] {O...    28   5.5  
KLLA0F23892g Chr6 complement(2229493..2231049) [1557 bp, 518 aa]...    28   5.7  
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    28   6.0  
TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.1...    28   6.2  
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    28   6.3  
Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa] {O...    28   6.4  
CAGL0D00638g Chr4 complement(80947..83028) [2082 bp, 693 aa] {ON...    28   6.9  
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    28   7.4  
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    27   8.8  
Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {O...    28   9.4  

>NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.190
           YDL008W
          Length = 128

 Score =  207 bits (526), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 104/128 (81%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSC 60
           MKLEVREVYPVFEWSWDITS                        VCGICRAGYNAVCPSC
Sbjct: 1   MKLEVREVYPVFEWSWDITSETEQQQNHEPEEQPEDDDDDDDDEVCGICRAGYNAVCPSC 60

Query: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGATVTLP 120
           SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGATVTLP
Sbjct: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGATVTLP 120

Query: 121 QLGDPDST 128
           QLGDPDST
Sbjct: 121 QLGDPDST 128

>KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some
           similarities with uniprot|Q12157 Saccharomyces
           cerevisiae YDL008W APC11 Catalytic core subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 135

 Score =  116 bits (290), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 65/122 (53%), Gaps = 12/122 (9%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSC 60
           M+LE ++VYPVF WSWDI                          +CGICR  YN  CP C
Sbjct: 1   MQLEFKKVYPVFSWSWDIPGDDDADREIGDED------------LCGICRVSYNGTCPGC 48

Query: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGATVTLP 120
            +PG  CP+V+G C H FHVHC+  WLAT  A+G CPMCRQ F+L     +N G    L 
Sbjct: 49  KYPGDNCPLVIGECNHNFHVHCIQQWLATPTAKGLCPMCRQQFSLKRGVAINEGQVEKLA 108

Query: 121 QL 122
            L
Sbjct: 109 NL 110

>KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.190
           YDL008W
          Length = 173

 Score =  116 bits (291), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 63/112 (56%), Gaps = 2/112 (1%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSC 60
           MK+ V+++YPV+ WSWDI +                        VCGICRA YN  CPSC
Sbjct: 1   MKVTVKKIYPVYAWSWDIVTRKGEQKSDVYSVLDKYRSEKDD--VCGICRASYNGTCPSC 58

Query: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVN 112
             PG  CP++VG+C H FH HC+  WL T  ++G CPMCRQ F LD    +N
Sbjct: 59  KIPGTMCPLIVGSCNHNFHYHCIFRWLNTLNSKGLCPMCRQEFKLDKKLVIN 110

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score =  113 bits (283), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 65/122 (53%), Gaps = 12/122 (9%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSC 60
           MK+E ++VYPVF WSWDI                          +CGICR  YN  CP C
Sbjct: 1   MKIEFKKVYPVFSWSWDIPGDDNADKEIGDED------------LCGICRVSYNGTCPGC 48

Query: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGATVTLP 120
             PG  CP+V+G C H FHVHC+  WL TA A+G CPMCRQ F+L     +N     +L 
Sbjct: 49  RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLA 108

Query: 121 QL 122
           +L
Sbjct: 109 KL 110

>TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON}
           Anc_3.190 YDL008W
          Length = 153

 Score =  110 bits (275), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 63/122 (51%), Gaps = 7/122 (5%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSC 60
           MK+++REV+ VF W+W I                          VCGICRA YNA CP C
Sbjct: 1   MKVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDD-------VCGICRASYNATCPGC 53

Query: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGATVTLP 120
             PG  CP+VVG C H FHVHC+  WL TA +RG CPMCRQ F L     +N        
Sbjct: 54  KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQ 113

Query: 121 QL 122
           +L
Sbjct: 114 EL 115

>NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3.190
           YDL008W
          Length = 206

 Score =  110 bits (276), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 64/130 (49%), Gaps = 13/130 (10%)

Query: 1   MKLEVREVYPVFEWSWDI-------TSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGY 53
           MK+EV+ +YP+  WSWD+        S                        VCGICRA Y
Sbjct: 1   MKIEVQNIYPLVAWSWDMPKNLDDPDSDEPDNANDSYGIRRRAPNKNAVDDVCGICRASY 60

Query: 54  NAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNR 113
           N  CP+C  PG  CP+V+G C H FH HC+  WL T  ++G CPMCRQ F L P      
Sbjct: 61  NGTCPNCKFPGTDCPLVLGRCNHNFHFHCIYQWLKTLTSKGLCPMCRQKFRLKP------ 114

Query: 114 GATVTLPQLG 123
            ATV    LG
Sbjct: 115 NATVNTDHLG 124

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score =  109 bits (273), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 62/126 (49%), Gaps = 4/126 (3%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXX----XXXXXXXXXXXXXVCGICRAGYNAV 56
           MK+EV+ +YPVF W WDI +                            VCGICR  YN  
Sbjct: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60

Query: 57  CPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGAT 116
           CP+C  PG  CP+VVG C H FHVHC+  WL T  ++G CPMCRQ F L     +N+   
Sbjct: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120

Query: 117 VTLPQL 122
                L
Sbjct: 121 DVFKSL 126

>ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {ON}
           similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 160

 Score =  108 bits (271), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 63/122 (51%), Gaps = 16/122 (13%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSC 60
           MK+++ EV+ VF W+W I                          VCGICRA YNA CPSC
Sbjct: 1   MKVDIEEVHSVFAWTWHIPKDNKDGSLEADDDDD----------VCGICRASYNATCPSC 50

Query: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGATVTLP 120
            +PG  C +VVG C H FHVHC+  WL T  ++G CPMCRQ F L       RG  +   
Sbjct: 51  KYPGDECSLVVGECNHNFHVHCIYRWLDTTTSKGLCPMCRQLFQL------KRGLAINDS 104

Query: 121 QL 122
           QL
Sbjct: 105 QL 106

>Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  106 bits (265), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 61/112 (54%), Gaps = 5/112 (4%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSC 60
           MK+++ EV+ VF WSW I S                        VCGICRA YN  CPSC
Sbjct: 1   MKVKINEVHSVFAWSWHIPSISDEVIGNEVPNENDEDED-----VCGICRASYNGTCPSC 55

Query: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVN 112
            +PG  CP+V+G C H FH HC+  WL T+ ++G CPMCRQ F L     +N
Sbjct: 56  KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAIN 107

>Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {ON}
           complement(160586..161116) [531 nt, 177 aa]
          Length = 176

 Score =  106 bits (265), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 65/126 (51%), Gaps = 4/126 (3%)

Query: 1   MKLEVREVYPVFEWSWDI----TSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAV 56
           MK+EV++V+ VF WSW I     +                        VCGICRA +N  
Sbjct: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60

Query: 57  CPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGAT 116
           CP+C  PG  CP+V+G CQH FHVHC+  WL T+ +RG CPMCRQ F L     +N    
Sbjct: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120

Query: 117 VTLPQL 122
               +L
Sbjct: 121 ERFREL 126

>Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  105 bits (261), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 57/105 (54%), Gaps = 5/105 (4%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSC 60
           MK+++ EV+ VF W+W I S                        VCGICRA YN  CPSC
Sbjct: 1   MKVKINEVHSVFAWTWQIPSISDEKVTNDKLNDNDENED-----VCGICRASYNGTCPSC 55

Query: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
             PG  CP+V+G C H FH HC+  WL T  ++G CPMCRQ F L
Sbjct: 56  KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100

>YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Catalytic
           core subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; contains a RING-H2 domain that is required
           for activity
          Length = 165

 Score =  104 bits (259), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 59/112 (52%), Gaps = 5/112 (4%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSC 60
           MK+++ EV+ VF WSW I S                        VCGICRA YN  CPSC
Sbjct: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDED-----VCGICRASYNGTCPSC 55

Query: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVN 112
             PG  CP+V+G C H FH HC+  WL T  ++G CPMCRQ F L     +N
Sbjct: 56  KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAIN 107

>Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  103 bits (257), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 57/105 (54%), Gaps = 5/105 (4%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSC 60
           MK+++ +V+ VF WSW I                          VCGICRA YN  CPSC
Sbjct: 1   MKVKINQVHSVFAWSWHIPRISDENETNEVTNENDDDED-----VCGICRASYNGTCPSC 55

Query: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
             PG  CP+V+G C H FH HC+  WL T+ ++G CPMCRQ F L
Sbjct: 56  KFPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQVFQL 100

>KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {ON}
           Anc_3.190 YDL008W
          Length = 202

 Score =  104 bits (259), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 62/127 (48%), Gaps = 14/127 (11%)

Query: 1   MKLEVREVYPVFEWSWD--------------ITSXXXXXXXXXXXXXXXXXXXXXXXXVC 46
           MKL+++ V PVF WSWD              + +                        VC
Sbjct: 1   MKLDIKRVNPVFTWSWDTRDPAAAKDRQYPFLYNYYPVDVEKAHLENGNAVDGDEDEDVC 60

Query: 47  GICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALD 106
           GICRA YN  CPSC  PG +CP+V G C H FH HC+  WL T  ++G CPMCRQ F L+
Sbjct: 61  GICRASYNGTCPSCKIPGDSCPLVAGLCHHHFHYHCIFRWLDTNTSKGLCPMCRQQFQLN 120

Query: 107 PLRRVNR 113
               +NR
Sbjct: 121 SKLPINR 127

>Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON}
           similar to Ashbya gossypii AER016C
          Length = 148

 Score =  102 bits (255), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 47/113 (41%), Positives = 62/113 (54%), Gaps = 8/113 (7%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSC 60
           M+L+++ V  V  W WD+                          VCGICRA YN  CP+C
Sbjct: 1   MQLQIKNVQCVASWYWDVPKELKRDLHEGEDEDDED--------VCGICRASYNGTCPNC 52

Query: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNR 113
             PG TCP++VG+C H FHVHC+  WL T+ ++G CPMCRQ F+L    R+N 
Sbjct: 53  KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINE 105

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score =  100 bits (249), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 60/113 (53%), Gaps = 8/113 (7%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSC 60
           M+L++  +  V  W WD+                          VCGICR  YN  CP+C
Sbjct: 1   MQLQINNIQCVASWYWDVPKELKRDSPVYEDEDEED--------VCGICRGSYNGTCPNC 52

Query: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNR 113
             PG TCP++VG+C H FHVHC+  WL T+ ++G CPMCRQ F+L    R+N 
Sbjct: 53  KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLREGIRINE 105

>SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008W APC11
           Catalytic core subunit of the Anaphase- Promoting
           Complex/Cyclosome (APC/C) which is a ubiquitin- protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 144

 Score = 99.8 bits (247), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 45/78 (57%), Positives = 51/78 (65%), Gaps = 6/78 (7%)

Query: 45  VCGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFA 104
           VCGICR  YN  CPSC +PG  CP+VVG C H FHVHC+V WL TA +RG CPMCRQ F+
Sbjct: 35  VCGICRVSYNGTCPSCKYPGDECPLVVGECNHNFHVHCIVQWLDTATSRGLCPMCRQLFS 94

Query: 105 LDPLRRVNRGATVTLPQL 122
           L       RG  +   QL
Sbjct: 95  L------KRGVAINDSQL 106

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score = 99.4 bits (246), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 62/113 (54%), Gaps = 9/113 (7%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSC 60
           M++E+ EV+ VF W WDI                          VCGICRA Y+A CP+C
Sbjct: 1   MRIELTEVHGVFNWVWDIPKNEDRLDESMADEDED---------VCGICRASYHAPCPNC 51

Query: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNR 113
            +PG +C +V+G C H FHVHC+  W+ T  ++G CPMCRQ F L    ++N 
Sbjct: 52  RYPGESCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCRQKFQLLQRTKINE 104

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score = 96.3 bits (238), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 62/126 (49%), Gaps = 13/126 (10%)

Query: 1   MKLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXX-------------VCG 47
           M++EV +V  V  W+WDI                                       VCG
Sbjct: 1   MRIEVTDVSLVSTWAWDIPKDLSKGKHGVADQTVHMEKWEDIQNEDEDAENDEEEYEVCG 60

Query: 48  ICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDP 107
           ICR  Y+A CPSC +PG  CP+V+G C H FHVHC+  WL+T  ++G CP+CRQ F L P
Sbjct: 61  ICRNRYDATCPSCDYPGSGCPIVLGLCNHNFHVHCIKQWLSTETSKGLCPLCRQGFQLRP 120

Query: 108 LRRVNR 113
              +N+
Sbjct: 121 NVLINK 126

>TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.190
           YDL008W
          Length = 180

 Score = 95.9 bits (237), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 61/132 (46%), Gaps = 10/132 (7%)

Query: 1   MKLEVREVYPVFEWSWDI----------TSXXXXXXXXXXXXXXXXXXXXXXXXVCGICR 50
           MK++++ V  VF W W I           +                         CGICR
Sbjct: 1   MKVQIKNVNGVFAWGWQIPKHDQKVKKDHNNSIVSGSDVDHQEQNSDDEDDEEDFCGICR 60

Query: 51  AGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRR 110
           A +   CP+C  P   CP+V+G C+H FHVHC+  WL T A+RG CPMCRQ F L     
Sbjct: 61  ASFIRACPNCKFPSDGCPIVIGKCKHNFHVHCIFEWLETEASRGLCPMCRQVFELRKGVV 120

Query: 111 VNRGATVTLPQL 122
           +N    VT  +L
Sbjct: 121 INDLHYVTFKEL 132

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 53.1 bits (126), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 44/114 (38%), Gaps = 31/114 (27%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           K EV++   V  WSWDI                           C ICR      C  C 
Sbjct: 24  KFEVKKWTAVAFWSWDIAVEN-----------------------CAICRNHIMEPCIQCQ 60

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRR 110
              +T     C    GTC HAFH+HC+  WL T   R ACP+  QP++     R
Sbjct: 61  PTAMTDTDNECVAAWGTCNHAFHLHCINKWLQT---RNACPLDNQPWSFAKYGR 111

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 52.8 bits (125), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 43/109 (39%), Gaps = 31/109 (28%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           K E+++   V  WSWDI                           C ICR      C  C 
Sbjct: 22  KFEIKKWTAVAFWSWDIAVDN-----------------------CAICRNHIMEPCIECQ 58

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
              +T     C    GTC HAFH+HC+  W+ T   R ACP+  QP+ L
Sbjct: 59  PKAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWQL 104

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 50.8 bits (120), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 43/109 (39%), Gaps = 31/109 (28%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           + E+++   V  WSWDI                           C ICR      C  C 
Sbjct: 20  RFEIKKWTAVAFWSWDIAVDN-----------------------CAICRNHIMEPCIECQ 56

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
              +T     C    GTC HAFH+HC+  W+ T   R ACP+  QP+ L
Sbjct: 57  PNAMTETDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWQL 102

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 50.1 bits (118), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 43/109 (39%), Gaps = 31/109 (28%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           K ++++   V  WSWDI                           C ICR      C  C 
Sbjct: 15  KFQIKKWTAVAFWSWDIAVDN-----------------------CAICRNHIMEPCIECQ 51

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
              +T     C    GTC HAFH+HC+  W+ T   R ACP+  QP+ L
Sbjct: 52  PKAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWHL 97

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 49.7 bits (117), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 43/109 (39%), Gaps = 31/109 (28%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           + E+++   V  WSWDI                           C ICR      C  C 
Sbjct: 31  RFEIKKWTAVAFWSWDIAVDN-----------------------CAICRNHIMEPCIECQ 67

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
              +T     C    GTC HAFH+HC+  W+ T   R ACP+  QP+ L
Sbjct: 68  PLAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWHL 113

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 49.7 bits (117), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 42/109 (38%), Gaps = 31/109 (28%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           + E+++   V  WSWDI                           C ICR      C  C 
Sbjct: 34  RFEIKKWTAVAFWSWDIAVDN-----------------------CAICRNHIMEPCIECQ 70

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
              +T     C    G C HAFH+HC+  W+ T   R ACP+  QP+ L
Sbjct: 71  PKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 116

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 49.7 bits (117), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 42/109 (38%), Gaps = 31/109 (28%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           + E+++   V  WSWDI                           C ICR      C  C 
Sbjct: 35  RFEIKKWTAVAFWSWDIAVDN-----------------------CAICRNHIMEPCIECQ 71

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
              +T     C    G C HAFH+HC+  W+ T   R ACP+  QP+ L
Sbjct: 72  PKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 117

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 49.7 bits (117), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 42/109 (38%), Gaps = 31/109 (28%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           + E+++   V  WSWDI                           C ICR      C  C 
Sbjct: 34  RFEIKKWTAVAFWSWDIAVDN-----------------------CAICRNHIMEPCIECQ 70

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
              +T     C    G C HAFH+HC+  W+ T   R ACP+  QP+ L
Sbjct: 71  PKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 116

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 49.7 bits (117), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 32/70 (45%), Gaps = 8/70 (11%)

Query: 46  CGICRAGYNAVCPSCSHPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           C ICR      C  C    +T     C    GTC HAFH+HC+  WL T   R ACP+  
Sbjct: 72  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQT---RNACPLDN 128

Query: 101 QPFALDPLRR 110
           QP+      R
Sbjct: 129 QPWQFAKYGR 138

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 49.3 bits (116), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 42/109 (38%), Gaps = 31/109 (28%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           + E+++   V  WSWDI                           C ICR      C  C 
Sbjct: 34  RFEIKKWTAVAFWSWDIAVDN-----------------------CAICRNHIMEPCIECQ 70

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
              +T     C    G C HAFH+HC+  W+ T   R ACP+  QP+ L
Sbjct: 71  PKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 116

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 49.3 bits (116), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 42/109 (38%), Gaps = 31/109 (28%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           K E+++   V  WSWDI                           C ICR      C  C 
Sbjct: 29  KFEIKKWTAVAFWSWDIAVDN-----------------------CAICRNHIMEPCIECQ 65

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
              +T     C    G C HAFH+HC+  W+ T   R ACP+  QP+ L
Sbjct: 66  PMAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 111

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 48.9 bits (115), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 43/109 (39%), Gaps = 31/109 (28%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           + +V++   V  WSWDI                           C ICR      C  C 
Sbjct: 35  RFQVKKWTAVAFWSWDIAVDN-----------------------CAICRNHIMEPCIECQ 71

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
              +T     C    GTC HAFH+HC+  W+ T   R ACP+  QP+ L
Sbjct: 72  PKAMTDTDTDCVAAWGTCNHAFHLHCINKWIKT---REACPLDNQPWQL 117

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 48.9 bits (115), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 42/109 (38%), Gaps = 31/109 (28%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           + E+++   V  WSWDI                           C ICR      C  C 
Sbjct: 36  RFEIKKWTAVAFWSWDIAVDN-----------------------CAICRNHIMEPCIECQ 72

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
              +T     C    G C HAFH+HC+  W+ T   R ACP+  QP+ L
Sbjct: 73  PKAMTDTDNECVAAWGVCNHAFHLHCINKWIQT---RDACPLDNQPWQL 118

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 48.1 bits (113), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 42/109 (38%), Gaps = 31/109 (28%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           K ++++   V  WSWDI                           C ICR      C  C 
Sbjct: 27  KFQIKKWTAVAFWSWDIAVDN-----------------------CAICRNHIMEPCIECQ 63

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
              +T     C    G C HAFH+HC+  W+ T   R ACP+  QP+ L
Sbjct: 64  PKAMTDTDNECVAAWGACGHAFHLHCINKWIKT---RDACPLDNQPWQL 109

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 31/65 (47%), Gaps = 8/65 (12%)

Query: 46  CGICRAGYNAVCPSC-----SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           C ICR      C  C     + P   C    G C HAFH+HC+  W+ T   R ACP+  
Sbjct: 52  CAICRNHIMEPCIECQPKAMTDPDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDN 108

Query: 101 QPFAL 105
           QP+ L
Sbjct: 109 QPWQL 113

>Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to
           Ashbya gossypii ADL181W
          Length = 114

 Score = 46.6 bits (109), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 41/109 (37%), Gaps = 31/109 (28%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           K ++++   V  WSWDI                           C ICR      C  C 
Sbjct: 27  KFQIKKWTAVAFWSWDIAVEN-----------------------CAICRNHIMEPCIQCQ 63

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
              +T     C    GTC HAFH+HC+  WL T   R ACP+  + +  
Sbjct: 64  PNAMTDTDNECVAAWGTCNHAFHLHCINKWLLT---RNACPLDNKTWQF 109

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 46.2 bits (108), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 41/114 (35%), Gaps = 31/114 (27%)

Query: 2   KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
           + EV++   V  WSWDI                           C ICR      C  C 
Sbjct: 23  RFEVKKWTAVAFWSWDIAVEN-----------------------CAICRNHIMEPCIQCQ 59

Query: 62  HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRR 110
              +T     C    G C HAFH+HC+  WL T   R ACP+  Q +      R
Sbjct: 60  PTAMTDTDNECVAAWGACNHAFHLHCINKWLQT---RNACPLDNQTWQFAKYGR 110

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 39/102 (38%), Gaps = 31/102 (30%)

Query: 2  KLEVREVYPVFEWSWDITSXXXXXXXXXXXXXXXXXXXXXXXXVCGICRAGYNAVCPSCS 61
          K ++++   V  WSWDI                           C ICR      C  C 
Sbjct: 21 KFQIKKWIAVAFWSWDIAVEN-----------------------CAICRNHIMEPCIQCQ 57

Query: 62 HPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPM 98
             +T     C    GTC HAFH+HC+  WL T   R ACP+
Sbjct: 58 PNAMTDTENECVAAWGTCNHAFHLHCINKWLLT---RNACPL 96

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 45.4 bits (106), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 31/65 (47%), Gaps = 8/65 (12%)

Query: 46  CGICRAGYNAVCPSCSHPGVT-----CPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           C ICR      C  C    +T     C V    C HAFH+HC+  W+ T   R ACP+  
Sbjct: 45  CAICRNHIMEPCIECQPMAMTETDNECVVAWAACNHAFHLHCINKWIKT---RDACPLDN 101

Query: 101 QPFAL 105
           QP+ L
Sbjct: 102 QPWQL 106

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 8/65 (12%)

Query: 46  CGICRAGYNAVCPSCSHPGV-----TCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           C ICR      C +C           C    G C HAFH+HC+  W+ +   R  CP+  
Sbjct: 44  CAICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIKS---RNVCPLDN 100

Query: 101 QPFAL 105
           +P+ L
Sbjct: 101 KPWKL 105

>NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 7/60 (11%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
            C IC +  +AV      P  TCP    TC++ FH  C+  W  + +    CP+CR   AL
Sbjct: 1537 CAICYSVLHAV--DRKLPTKTCP----TCKNKFHGACLYKWFKS-SGNNTCPLCRSEIAL 1589

>Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON}
            (57636..62351) [4716 nt, 1572 aa]
          Length = 1571

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 7/60 (11%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
            C IC +  +AV      P  TCP    TC++ FH  C+  W   ++    CPMCR   A+
Sbjct: 1517 CAICYSILHAV--DRKLPTKTCP----TCRNKFHGACLYKWF-RSSGNNTCPMCRSEIAI 1569

>Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] {ON}
            YMR247C (REAL)
          Length = 1559

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
            C IC +  +AV      P  TCP    TC++ FH  C+  W   ++    CP+CR     
Sbjct: 1505 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRSEI-- 1555

Query: 106  DPLRR 110
             P RR
Sbjct: 1556 -PFRR 1559

>YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}
            RKR1RING domain E3 ubiquitin ligase; involved in the
            ubiquitin-mediated degradation of non-stop proteins;
            functional connections to chromatin modification; nuclear
            protein that also co-localizes with ribosomes; homolog of
            mouse Listerin, whose mutation has been reported to cause
            neurodegeneration in mice
          Length = 1562

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
            C IC +  +AV      P  TCP    TC++ FH  C+  W   ++    CP+CR     
Sbjct: 1508 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRSEI-- 1558

Query: 106  DPLRR 110
             P RR
Sbjct: 1559 -PFRR 1562

>Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] {ON}
            YMR247C (REAL)
          Length = 1564

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
            C IC +  +AV      P  TCP    TC++ FH  C+  W   ++    CP+CR     
Sbjct: 1510 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRSEI-- 1560

Query: 106  DPLRR 110
             P RR
Sbjct: 1561 -PFRR 1564

>Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AGL079C
          Length = 532

 Score = 39.7 bits (91), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 7/54 (12%)

Query: 57  CPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           CP C       T  ++   CQH FH  C+  W       G CP+CR   A +PL
Sbjct: 235 CPVCLERMDSDTTGLITTACQHTFHCQCLDQWKG-----GRCPVCRYSNAKEPL 283

>Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] {ON}
            YMR247C (REAL)
          Length = 1566

 Score = 39.7 bits (91), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
            C IC +  +AV      P  TCP    TC++ FH  C+  W   ++    CP+CR     
Sbjct: 1512 CAICYSILHAV--DRKLPSKTCP----TCKNRFHGACLYKWF-RSSGNNTCPLCRSEI-- 1562

Query: 106  DPLRR 110
             P RR
Sbjct: 1563 -PFRR 1566

>KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.799
            YMR247C
          Length = 1561

 Score = 39.7 bits (91), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
            C IC +  +AV      P  TCP    TC++ FH  C+  W   ++    CP+CR     
Sbjct: 1507 CAICYSILHAV--DRKLPNKTCP----TCKNRFHGACLYKWF-RSSGNNTCPLCRNEI-- 1557

Query: 106  DPLRR 110
             P RR
Sbjct: 1558 -PFRR 1561

>SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1557

 Score = 39.3 bits (90), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 9/60 (15%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQ--PF 103
            C IC +  +AV      P  TCP    TC + FH  C+  W   ++    CPMCR   PF
Sbjct: 1503 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGACLYKWF-RSSGNNTCPMCRSEIPF 1555

>ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa]
            {ON} similar to uniprot|Q04781 Saccharomyces cerevisiae
            YMR247C Hypothetical ORF
          Length = 1555

 Score = 38.5 bits (88), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 10/65 (15%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
            C IC +  +AV      P  TCP    TC + FH  C+  W   ++    CP+CR     
Sbjct: 1501 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGSCLYKWF-RSSGNNTCPLCRGEI-- 1551

Query: 106  DPLRR 110
             P RR
Sbjct: 1552 -PFRR 1555

>NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8.799
            YMR247C
          Length = 1564

 Score = 38.5 bits (88), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
            C IC +  +AV      P  TCP    TC++ FH  C+  W   ++    CP+CR     
Sbjct: 1510 CAICYSILHAV--DRKLPTKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRSEI-- 1560

Query: 106  DPLRR 110
             PL R
Sbjct: 1561 -PLHR 1564

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 38.5 bits (88), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 7/60 (11%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
            C IC +  +AV      P   CP    TC + FH  C+  W   ++    CP+CR   AL
Sbjct: 1537 CAICYSTLHAV--DRKLPTKVCP----TCNNKFHGSCLYKWF-RSSNNNTCPLCRSEIAL 1589

>KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {ON}
            Anc_8.799 YMR247C
          Length = 1560

 Score = 38.1 bits (87), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQ--PF 103
            C IC +  +A+      P  TCP    TC++ FH  C+  W   ++    CP+CR   PF
Sbjct: 1506 CAICYSILHAI--DRKLPSKTCP----TCKNRFHGACLYKWF-RSSGNNTCPLCRSEIPF 1558

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 37.7 bits (86), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 9/60 (15%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQ--PF 103
            C IC +  +AV      P  TCP    TC + FH  C+  W   ++    CP+CR   PF
Sbjct: 1505 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGACLYKWF-RSSGNNTCPLCRSEIPF 1557

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 12/60 (20%)

Query: 46  CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
           C IC+  +N +   C         ++G C H FH +C+  W+   +A   CP+C++ ++L
Sbjct: 120 CAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWICRNSA--CCPLCKRSYSL 167

>KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1550

 Score = 37.4 bits (85), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 10/65 (15%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
            C IC +  +AV      P   CP    TC + FH  C+  W   ++    CP+CR     
Sbjct: 1496 CAICYSILHAV--DRKLPSKVCP----TCNNRFHGACLYKWF-RSSGNNTCPLCRSEI-- 1546

Query: 106  DPLRR 110
             P RR
Sbjct: 1547 -PFRR 1550

>Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR247C
            - Hypothetical ORF [contig 20] FULL
          Length = 1574

 Score = 37.4 bits (85), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 10/65 (15%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
            C IC +  +AV      P   CP    TC + FH  C+  W   ++    CP+CR     
Sbjct: 1520 CAICYSILHAV--DRKLPSKVCP----TCNNRFHGACLYKWF-RSSGNNTCPLCRSEI-- 1570

Query: 106  DPLRR 110
             P RR
Sbjct: 1571 -PFRR 1574

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 37.0 bits (84), Expect = 0.007,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 27/63 (42%), Gaps = 10/63 (15%)

Query: 57  CPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR-QPFAL--DPLRRV 111
           CP C       T  ++   CQH FH  C+  W         CP+CR   F L  D L R 
Sbjct: 171 CPVCLERMDSETTGLITIPCQHTFHCQCLNRW-----KNSKCPVCRYSSFRLSRDTLMRT 225

Query: 112 NRG 114
           +RG
Sbjct: 226 SRG 228

>Kpol_1072.55 s1072 (126281..127543) [1263 bp, 420 aa] {ON}
           (126281..127543) [1263 nt, 421 aa]
          Length = 420

 Score = 36.6 bits (83), Expect = 0.008,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 56  VCPSC-SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           +C  C ++  +  PV +  C H +H +C++P + T   +  CP CR
Sbjct: 343 ICSICLNNIAIQQPVFISHCFHFWHFNCIMPIIQTTYPQFNCPNCR 388

>Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar to
            Ashbya gossypii ABL058C
          Length = 1547

 Score = 36.6 bits (83), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 14/62 (22%)

Query: 55   AVCPSCSHP------GVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
            A+C S  HP         CP    TC + FH  C+  W   ++   +CP+CR      P 
Sbjct: 1494 AICYSILHPVDRKLPTKVCP----TCNNRFHGACLYKWF-RSSGNNSCPLCRSEI---PF 1545

Query: 109  RR 110
            RR
Sbjct: 1546 RR 1547

>ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR247C
          Length = 1546

 Score = 36.2 bits (82), Expect = 0.013,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 26/62 (41%), Gaps = 14/62 (22%)

Query: 55   AVCPSCSH------PGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
            A+C S  H      P   CP    TC + FH  C+  W  + +    CP+CR      P 
Sbjct: 1493 AICYSILHVVDRKLPSKVCP----TCSNRFHGACLYKWFKS-SGNNTCPLCRGEI---PF 1544

Query: 109  RR 110
            RR
Sbjct: 1545 RR 1546

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 35.8 bits (81), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQPFA--LDPLRRVNRGATVTLPQLGD 124
           CQH FH+ C+  W  +  +   CP CR      +D    VN   T+ L  + D
Sbjct: 26  CQHEFHLSCIRKWYHSRISDRTCPNCRVEIRELIDMDHNVNINLTLQLDLIFD 78

>KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1518

 Score = 35.8 bits (81), Expect = 0.016,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 7/60 (11%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
            C IC    +A+      P   CP    TC + FH  C+  W  + +    CP+CR  F L
Sbjct: 1464 CAICYYVLHAI--DRKLPTKVCP----TCNNRFHGACLYKWFKS-SGNNTCPLCRGEFNL 1516

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {ON}
           Anc_3.405 YPR093C
          Length = 555

 Score = 35.8 bits (81), Expect = 0.017,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 57  CPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQ 101
           CP C          +  CQH FH +C+  W  T+ +   CP+CR+
Sbjct: 5   CPICLEDITDILGSLKVCQHNFHFNCIRQWHLTSKSL-ECPVCRR 48

>AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL010C
          Length = 506

 Score = 35.8 bits (81), Expect = 0.018,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 7/46 (15%)

Query: 57  CPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           CP C       T  ++   CQH FH  C+  W       G CP+CR
Sbjct: 212 CPVCLERMDSDTTGLITTACQHTFHCQCLDKW-----KDGRCPVCR 252

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 35.0 bits (79), Expect = 0.034,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 7/47 (14%)

Query: 56  VCPSCSHP--GVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           +CP C          +V   CQH FH  C+  W       G CP+CR
Sbjct: 214 MCPVCLEKLDSEVTGLVTTPCQHTFHCKCLDQW-----KNGNCPVCR 255

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score = 34.7 bits (78), Expect = 0.035,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 6/58 (10%)

Query: 45  VCGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQP 102
           +C +C   +    PS         V +  C HA H+ C+  W+A +     CP+CR P
Sbjct: 352 ICIVCMEDF---LPSHQRKSDGKKVKILPCTHALHLSCLKNWIARSP---TCPICRLP 403

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 34.7 bits (78), Expect = 0.037,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 7/65 (10%)

Query: 46  CGICRAGYNAVCPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPF 103
           C IC A +         +H       ++  C H FH  C+  W++    +  CP+CR P 
Sbjct: 698 CAICMAEFPVYVEELPETHQVDKDSYMITPCDHMFHTSCLESWMSY---KLQCPVCRSP- 753

Query: 104 ALDPL 108
            L PL
Sbjct: 754 -LPPL 757

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 34.7 bits (78), Expect = 0.039,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           +V  C H FH  C+  W++    +  CP+CR P  L PL
Sbjct: 725 MVTPCNHVFHTSCLENWMSY---KLQCPVCRSP--LPPL 758

>ZYRO0G18260g Chr7 (1506002..1508590) [2589 bp, 862 aa] {ON} similar
           to uniprot|P21268 Saccharomyces cerevisiae YJL157C FAR1
           Cyclin-dependent kinase inhibitor that mediates cell
           cycle arrest in response to pheromone also forms a
           complex with Cdc24p Ste4p and Ste18p that may specify
           the direction of polarized growth during mating
           potential Cdc28p substrate
          Length = 862

 Score = 34.7 bits (78), Expect = 0.041,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 7/55 (12%)

Query: 46  CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           C +C  G N++      PG T  VV  TC HA H  C +    +    G  P CR
Sbjct: 212 CSMCAEGMNSI-----FPGET--VVQMTCSHASHYECYLAMYESHYREGKWPQCR 259

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 34.3 bits (77), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 12/60 (20%)

Query: 46  CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
           C IC+  +N +            + V  C H FH HC+  W+   +A   CP+C++ ++L
Sbjct: 110 CVICQEQFNELNN----------IRVLGCSHIFHSHCIDRWICRNSA--CCPLCKRSYSL 157

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 34.7 bits (78), Expect = 0.043,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 7/61 (11%)

Query: 46  CGICRAG---YNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQP 102
           C IC +G   Y    P  +H       +V  C H FH  C+  W++    +  CP+CR P
Sbjct: 703 CSICMSGIPLYVDDKPE-THKVDQYSYMVTPCNHIFHTECLENWMSY---KLQCPVCRTP 758

Query: 103 F 103
            
Sbjct: 759 L 759

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 34.7 bits (78), Expect = 0.043,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           +V  C H FH  C+  W++    +  CP+CR P  L PL
Sbjct: 725 MVTPCDHVFHTSCLENWMSY---KLQCPVCRSP--LPPL 758

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 34.3 bits (77), Expect = 0.051,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 27/65 (41%), Gaps = 7/65 (10%)

Query: 46  CGICRAGYNAVCPSCSHPGVTCP--VVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPF 103
           C IC +              T P   +V  C H FH  C+  W++    +  CP+CR P 
Sbjct: 699 CAICMSEVAIYVEDIPETHKTNPNEYMVTPCAHVFHTECLENWMSY---KLQCPVCRAP- 754

Query: 104 ALDPL 108
            L PL
Sbjct: 755 -LPPL 758

>CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247c
          Length = 1544

 Score = 34.3 bits (77), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
            C IC +  +AV      P  TC     TC++ FH  C+  W   ++    CP+CR
Sbjct: 1490 CAICYSILHAV--DRKLPTKTC----STCKNKFHGACLYKWF-RSSGNNTCPLCR 1537

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 34.3 bits (77), Expect = 0.053,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           ++  C H FH  C+  W++    +  CP+CR P  L PL
Sbjct: 717 MITPCSHIFHTQCLESWMSY---KLQCPVCRAP--LPPL 750

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 34.3 bits (77), Expect = 0.055,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           +V  C H FH  C+  W++    +  CP+CR P  L PL
Sbjct: 718 MVTPCGHIFHTQCLESWMSY---KLQCPVCRAP--LPPL 751

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 34.3 bits (77), Expect = 0.059,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           +V  C H FH  C+  W++    +  CP+CR P  L PL
Sbjct: 726 MVTPCNHVFHTPCLENWMSY---KLQCPVCRSP--LPPL 759

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 34.3 bits (77), Expect = 0.059,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           +V  C H FH  C+  W++    +  CP+CR P  L PL
Sbjct: 732 MVTPCAHIFHTQCLENWMSY---KLQCPVCRSP--LPPL 765

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 34.3 bits (77), Expect = 0.063,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           ++  C H FH  C+  W++    +  CP+CR P  L PL
Sbjct: 714 MITPCSHIFHTQCLESWMSY---KLQCPVCRAP--LPPL 747

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 34.3 bits (77), Expect = 0.064,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 5/46 (10%)

Query: 57   CPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQP 102
            C  C  P     +V   C H F   C+  WL     R  CP+C+ P
Sbjct: 1164 CSICLQPITNGAMV--NCGHLFCTSCIFSWLKN---RKTCPLCKHP 1204

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 34.3 bits (77), Expect = 0.064,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           ++  C H FH  C+  W+     +  CP+CR P  L PL
Sbjct: 721 MITPCNHVFHTQCLENWMGY---KLQCPVCRAP--LPPL 754

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 33.9 bits (76), Expect = 0.068,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 7/47 (14%)

Query: 57  CPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQ 101
           CP C       T  +V   CQH FH  C+  W         CP+CR 
Sbjct: 240 CPVCLERMDSETTGLVTIPCQHTFHCQCLNKW-----KNSRCPVCRH 281

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 33.9 bits (76), Expect = 0.068,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 7/47 (14%)

Query: 57  CPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQ 101
           CP C       T  +V   CQH FH  C+  W         CP+CR 
Sbjct: 240 CPVCLERMDSETTGLVTIPCQHTFHCQCLNKW-----KNSRCPVCRH 281

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 33.9 bits (76), Expect = 0.068,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 7/47 (14%)

Query: 57  CPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQ 101
           CP C       T  +V   CQH FH  C+  W         CP+CR 
Sbjct: 240 CPVCLERMDSETTGLVTIPCQHTFHCQCLNKW-----KNSRCPVCRH 281

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 33.9 bits (76), Expect = 0.069,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 7/47 (14%)

Query: 57  CPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQ 101
           CP C       T  +V   CQH FH  C+  W         CP+CR 
Sbjct: 240 CPVCLERMDSETSGLVTIPCQHTFHCQCLNKW-----KNSRCPVCRH 281

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 33.9 bits (76), Expect = 0.071,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           +V  C H FH  C+  W++    +  CP+CR P  L PL
Sbjct: 728 MVTPCNHIFHTSCLENWMSY---KLQCPVCRAP--LPPL 761

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 33.5 bits (75), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 19/70 (27%)

Query: 45  VCGICRAGYNAVCPSCSHPGVTCPVVVG--TCQHAFHVHCVVPWLATAAARGACPMCR-- 100
           +C ICR         C       P+++    C+H F + C+  WL   +   +CP+CR  
Sbjct: 114 ICSICR---------CKFFDDDYPLIIELPNCKHYFDLECITLWLQKNS---SCPICRND 161

Query: 101 ---QPFALDP 107
              + F +D 
Sbjct: 162 VLEKKFKIDD 171

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 33.9 bits (76), Expect = 0.081,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 5/35 (14%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           C H FH  C+  W++    +  CP+CR P  L PL
Sbjct: 733 CGHVFHTQCLENWMSY---KLQCPVCRSP--LPPL 762

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 33.9 bits (76), Expect = 0.082,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 10/59 (16%)

Query: 57  CPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR-QPFAL--DPLRR 110
           CP C       T  ++   CQH FH  C+  W         CP+CR   F L  D LR+
Sbjct: 247 CPVCLERMDSETTGLITIPCQHTFHCQCLDKW-----KNSKCPVCRLSSFRLSRDTLRK 300

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 33.5 bits (75), Expect = 0.090,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 26/62 (41%), Gaps = 12/62 (19%)

Query: 57  CPSCSH---PGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQP---FALDPLRR 110
           CP C      G T  + +  CQH FH  C+  W         CP+CR     F+ + L R
Sbjct: 235 CPVCLERLDDGTTGLITI-PCQHTFHCQCLDKW-----KNSKCPVCRYSNLKFSREALLR 288

Query: 111 VN 112
            N
Sbjct: 289 QN 290

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 33.5 bits (75), Expect = 0.093,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           +V  C H FH  C+  W+     +  CP+CR P  L PL
Sbjct: 725 MVTPCNHVFHTSCLENWMNY---KLQCPVCRSP--LPPL 758

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 33.5 bits (75), Expect = 0.11,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 7/46 (15%)

Query: 57  CPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           CP C       T  ++   CQH FH  C+  W         CP+CR
Sbjct: 241 CPVCLERMDSETTGLITIPCQHTFHCQCLDKW-----KNSQCPVCR 281

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 33.5 bits (75), Expect = 0.11,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           ++  C H FH  C+  W++    +  CP+CR P  L PL
Sbjct: 724 MITPCSHIFHTECLENWMSY---KLQCPVCRAP--LPPL 757

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 32.7 bits (73), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 5/44 (11%)

Query: 60  CSHPGVTCPVVVG--TCQHAFHVHCVVPWLATAAARGACPMCRQ 101
           C +   + P+VV    C H F + C+  WL+ ++    CPMCR 
Sbjct: 95  CVYLEDSYPLVVKLPNCNHKFDLQCITLWLSKSS---TCPMCRN 135

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 33.1 bits (74), Expect = 0.12,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           +V  C H FH  C+  W+     +  CP+CR P  L PL
Sbjct: 724 MVTPCNHIFHTACLENWMGY---KLQCPVCRAP--LPPL 757

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 32.7 bits (73), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 10/56 (17%)

Query: 46  CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQ 101
           C IC + YN       +P V   V +  C H F + C+ PWL   +    CP+CR 
Sbjct: 86  CSICCSKYNED----DYPLV---VELPHCSHRFDLECLTPWLLKNS---TCPLCRD 131

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 33.1 bits (74), Expect = 0.13,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 7/46 (15%)

Query: 57  CPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           CP C       T  ++   CQH FH  C+  W         CP+CR
Sbjct: 234 CPVCLERMDSDTTGLITIPCQHTFHCQCLDKW-----KNSKCPVCR 274

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 33.1 bits (74), Expect = 0.14,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           ++  C H FH  C+  W++    +  CP+CR P  L PL
Sbjct: 717 MITPCNHIFHTTCLENWMSY---KLQCPVCRAP--LPPL 750

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 32.7 bits (73), Expect = 0.17,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 7/46 (15%)

Query: 57  CPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           CP C       T  ++   CQH FH  C+  W         CP+CR
Sbjct: 234 CPVCLERMDSDTTGLITIPCQHTFHCQCLDKW-----KNSRCPVCR 274

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 32.7 bits (73), Expect = 0.17,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 3/34 (8%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPF 103
           +V  C H FH  C+  W+     +  CP+CR P 
Sbjct: 728 MVTPCDHIFHTDCLENWMGY---KLQCPVCRTPL 758

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 32.7 bits (73), Expect = 0.18,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 4/55 (7%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAAR---GACP 97
            C  C+   N++C  C  P     +V+  C H  H  C+  W      R   G CP
Sbjct: 1278 CDSCKK-RNSLCVLCERPLKKLTMVLLPCGHEGHFQCIQEWFLNEKERECPGGCP 1331

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 32.7 bits (73), Expect = 0.21,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 14/74 (18%)

Query: 57  CPSCSH---PGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNR 113
           CP C       +T  + +  CQH FH  C+  W         CP+CR  F+     R++R
Sbjct: 283 CPVCLERMDSSITGLITI-PCQHTFHCQCLNKW-----KNSKCPICR--FS---TLRISR 331

Query: 114 GATVTLPQLGDPDS 127
              +   Q+   DS
Sbjct: 332 DLVINKKQVNIKDS 345

>TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] {ON}
            Anc_8.288 YDR128W
          Length = 1178

 Score = 32.7 bits (73), Expect = 0.21,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 19/53 (35%), Gaps = 6/53 (11%)

Query: 57   CPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPM---CRQPFALD 106
            C  C+HP      + G CQH  H  C   W    +    CP    C  P   D
Sbjct: 1127 CVYCNHPADRSVFICGNCQHIMHPKCAQVWWKVDS---ECPSGCGCHCPDVFD 1176

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 32.3 bits (72), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 10/56 (17%)

Query: 46  CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQ 101
           C ICR  Y+    +     +TC   +  C H FH  C+  WL        CP+CR 
Sbjct: 210 CPICRIAYSDDFET----EITC---LPNCSHHFHFECIKLWL---QKNSLCPLCRD 255

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 32.7 bits (73), Expect = 0.23,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 11/43 (25%)

Query: 67   CPVVVGT--------CQHAFHVHCVVPWLATAAARGACPMCRQ 101
            CP+ + T        C H F  HC+  WL     +  CP+C++
Sbjct: 1151 CPICLNTIYMGSIIKCGHFFCKHCIFSWLKN---KSVCPICKK 1190

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 32.3 bits (72), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 30/76 (39%), Gaps = 13/76 (17%)

Query: 45  VCGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFA 104
           +CGIC    N      +  G   P     C+H +HV C+  W    +    CP CR+   
Sbjct: 4   ICGICLESMNE-----TDQGELLP-----CEHRYHVSCIRKW-HLYSNDFKCPTCRKESK 52

Query: 105 LDPLRRVNRGATVTLP 120
              LRR +    + L 
Sbjct: 53  --SLRRKHDDIEIDLK 66

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 32.3 bits (72), Expect = 0.23,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           +V  C H FH  C+  W++    +  CP+CR P  L PL
Sbjct: 720 MVTPCSHLFHTGCLENWMSY---KLQCPVCRAP--LPPL 753

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score = 32.3 bits (72), Expect = 0.26,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 3/29 (10%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQP 102
           C H  H++C+  W+  +     CPMCR P
Sbjct: 352 CGHILHMNCLKNWMERSQ---TCPMCRLP 377

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 32.3 bits (72), Expect = 0.28,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 7/46 (15%)

Query: 57  CPSCSHP--GVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           CP C       T  ++   CQH FH  C+  W         CP+CR
Sbjct: 238 CPVCLEQLDCETTGLITIPCQHTFHCQCLDKW-----KNSRCPVCR 278

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 32.0 bits (71), Expect = 0.40,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 7/46 (15%)

Query: 57  CPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           CP C       T  ++   CQH FH  C+  W         CP+CR
Sbjct: 268 CPVCLERMDSETTGLITIPCQHTFHCSCLDKW-----NDSRCPVCR 308

>TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {ON}
           Anc_2.157 YHR115C
          Length = 521

 Score = 31.6 bits (70), Expect = 0.47,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 4/53 (7%)

Query: 55  AVCPSCSHPGVTCPVV-VGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALD 106
           ++C S   P   C  + +  C H++H HC+   +  +  +  CP CR    L+
Sbjct: 414 SICLSAIKP---CQAIFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRSSCDLE 463

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 31.6 bits (70), Expect = 0.47,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 5/39 (12%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPL 108
           +V  C H FH  C+  W+     +  CP+CR   +L PL
Sbjct: 729 MVTPCNHIFHTECLENWMGY---KLQCPVCRS--SLPPL 762

>Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}
           complement(48530..50287) [1758 nt, 586 aa]
          Length = 585

 Score = 31.6 bits (70), Expect = 0.49,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 4/47 (8%)

Query: 55  AVCPSCSHPGVTCPVV-VGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           ++C S   P   C  + +  C H++H HC+   +  +  +  CP CR
Sbjct: 503 SICLSAIKP---CQAIFISPCSHSWHFHCIRRLVMMSYPQFVCPNCR 546

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 31.6 bits (70), Expect = 0.50,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 17/47 (36%)

Query: 66  TCPV--------VVG----TCQHAFHVHCVVPWLATAAARGACPMCR 100
           TCPV        V G     CQH FH  C+  W         CP+CR
Sbjct: 246 TCPVCLERLDSEVTGLATIPCQHTFHCQCLNKW-----KDSRCPVCR 287

>KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.157
           YHR115C
          Length = 510

 Score = 31.6 bits (70), Expect = 0.52,   Method: Composition-based stats.
 Identities = 9/32 (28%), Positives = 17/32 (53%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           + +  C H++H HC+   +  +  +  CP CR
Sbjct: 416 IFISPCSHSWHFHCIRRLVMVSYPQFVCPNCR 447

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
           {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 31.2 bits (69), Expect = 0.56,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 5/63 (7%)

Query: 56  VCPSCSHPGVTCPVVVGT---CQHAFHVHCVVPWLATAAARGACPMCR-QPFALDPLRRV 111
           +CP C        ++ G    C H +H  C+  W    +    CP+CR QP  +  L R 
Sbjct: 11  ICPICFDDLNDTDILQGKLKPCNHKYHYDCIRRWHGY-SDNSDCPLCRCQPKTMIVLSRN 69

Query: 112 NRG 114
           + G
Sbjct: 70  HNG 72

>Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W -
           Hypothetical ORF [contig 36] FULL
          Length = 300

 Score = 31.2 bits (69), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 1/39 (2%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARG-ACPMCRQPFALDP 107
           V+ TC H +   C+  WL +  A    CP CR P    P
Sbjct: 5   VMTTCGHNYCYDCISNWLVSNNANELTCPQCRSPLKEQP 43

>KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa] {ON}
           Anc_8.808 YOL054W
          Length = 357

 Score = 31.2 bits (69), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 62  HPGVTCPVVVGTCQHAFHVHCVVPWLATAAARG-ACPMCRQPFALDP 107
           H  ++ P++V  C H +   C++ W      R   CP CR    ++P
Sbjct: 37  HEILSIPMMVTPCGHTYCYECLLTWFKNNENRELNCPDCRVSIEVEP 83

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 31.6 bits (70), Expect = 0.58,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 3/33 (9%)

Query: 74   CQHAFHVHCVVPWLATAAARGACPMCRQPFALD 106
            C H F   C+  WL T   R  CP+C+   +LD
Sbjct: 1282 CGHFFCEDCIYDWLQT---RTICPICKHKASLD 1311

>ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]
           {ON} some similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 445

 Score = 31.2 bits (69), Expect = 0.63,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 3/72 (4%)

Query: 56  VCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDP-LRRVNRG 114
           +C  C H  +  PV+   C H +   C+  W  + +   +CP CR   +  P L  V + 
Sbjct: 29  ICSIC-HDLMFVPVMT-QCGHNYCYDCLSSWFDSNSNELSCPQCRASISDPPSLNSVLQQ 86

Query: 115 ATVTLPQLGDPD 126
             V + +L  PD
Sbjct: 87  WLVHIIELVGPD 98

>SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032W RAD5
           Single-stranded DNA-dependent ATPase involved in
           postreplication repair contains RING finger domain
          Length = 1127

 Score = 31.2 bits (69), Expect = 0.65,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARG---ACPMCRQPFALDPLRRVN---RGATVTL 119
           V+   C HAF  HC++ ++     +     CP CR+  ++DP R +    RG  V++
Sbjct: 888 VIFTECAHAFCEHCLLEYIDFQTQKKLELKCPNCRE--SIDPKRLLTLKERGGEVSV 942

>SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 322

 Score = 31.2 bits (69), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 3/47 (6%)

Query: 73  TCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGATVTL 119
           TCQH +H+ C+  W    +    CP CR     + L  V    T+ L
Sbjct: 22  TCQHEYHLECIREW-HNHSQDFKCPTCR--VESNKLLDVENNVTINL 65

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score = 31.2 bits (69), Expect = 0.68,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQP 102
           C H  H+ C+  W+  +     CP+CR P
Sbjct: 341 CNHCLHLGCLKSWMERSQ---TCPICRVP 366

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 31.2 bits (69), Expect = 0.71,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 18/47 (38%), Gaps = 7/47 (14%)

Query: 57  CPSC--SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQ 101
           CP C      +   ++   C H FH  C+  W         CP+CR 
Sbjct: 241 CPVCLEKMDSLVTGLITIPCSHTFHCQCLDKW-----KNSKCPVCRH 282

>KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {ON}
           Anc_2.157 YHR115C
          Length = 551

 Score = 31.2 bits (69), Expect = 0.72,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 19/38 (50%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALD 106
           + +  C H++H HCV   +  +  +  CP CR    L+
Sbjct: 464 IFISPCSHSWHFHCVRRLVMLSYPQFVCPNCRSACDLE 501

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 30.4 bits (67), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 5/44 (11%)

Query: 60  CSHPGVTCPVVVGT--CQHAFHVHCVVPWLATAAARGACPMCRQ 101
           C +   T P+VV    C H F + CV  WL+ +     CP+CR 
Sbjct: 88  CGYLDDTHPLVVKLPHCSHRFDLECVAVWLSKSR---TCPLCRD 128

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 30.8 bits (68), Expect = 0.83,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 9/47 (19%)

Query: 57  CPSCSH---PGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           CP C       +T  + +  CQH FH  C+  W         CP+CR
Sbjct: 237 CPVCLERMDSDITGLITI-PCQHTFHCQCLDKW-----KDSRCPVCR 277

>Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON}
           YHR115C (REAL)
          Length = 413

 Score = 30.8 bits (68), Expect = 0.86,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 1/45 (2%)

Query: 57  CPSCSHPGVTCPVV-VGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           C  C +    C  + +  C H++H HCV   +  +  +  CP CR
Sbjct: 322 CSICLNKIKPCQAIFISPCAHSWHFHCVRRLVIMSYPQFMCPNCR 366

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 30.8 bits (68), Expect = 0.94,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 11/44 (25%)

Query: 66   TCPVVVG--------TCQHAFHVHCVVPWLATAAARGACPMCRQ 101
            TCP+ +G        +C H F  +C+  WL   +    CP+C++
Sbjct: 1270 TCPICLGLIHTGSMISCGHFFCNNCIFSWLKLNS---NCPLCKR 1310

>TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.808
           YOL054W
          Length = 478

 Score = 30.4 bits (67), Expect = 1.0,   Method: Composition-based stats.
 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARG-ACPMCRQPFALDP 107
           +V  C H+F   C+  W +++   G +CP CR      P
Sbjct: 41  MVTPCGHSFCYGCLCSWFSSSNVDGLSCPHCRTSITSAP 79

>Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON}
           YHR115C (REAL)
          Length = 416

 Score = 30.4 bits (67), Expect = 1.0,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 1/45 (2%)

Query: 57  CPSCSHPGVTCPVV-VGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           C  C +    C  + +  C H++H HCV   +  +  +  CP CR
Sbjct: 327 CSICLNKIKPCQAIFISPCAHSWHFHCVRRLVIMSYPQFMCPNCR 371

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score = 30.4 bits (67), Expect = 1.0,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 16/29 (55%), Gaps = 3/29 (10%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQP 102
           C H  H++C+  W+  +     CP+CR P
Sbjct: 371 CGHILHLNCLKNWMERSQ---TCPICRLP 396

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 5/44 (11%)

Query: 60  CSHPGVTCPVVVGT--CQHAFHVHCVVPWLATAAARGACPMCRQ 101
           C++     P+VV    C H F + CV  WL+ +     CP+CR 
Sbjct: 40  CNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSR---TCPLCRD 80

>SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q75BK4 Ashbya gossypii ACR267C
           ACR267Cp and some similarites with YNL116W
           uniprot|P53924 Saccharomyces cerevisiae YNL116W DMA2
           Protein involved in regulating spindle position and
           orientation functionally redundant with Dma1p homolog of
           S. pombe Dma1 and H. sapiens Chfr
          Length = 475

 Score = 30.4 bits (67), Expect = 1.1,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 19/38 (50%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALD 106
           + +  C H++H  CV   + T+  +  CP CR    L+
Sbjct: 402 IFISPCSHSWHYQCVRRLVMTSYPQFVCPNCRSSCDLE 439

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score = 30.4 bits (67), Expect = 1.1,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQP 102
           C H  H+ C+  W+  +     CP+CR P
Sbjct: 337 CGHILHLSCLKSWMERSQ---TCPICRLP 362

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score = 30.4 bits (67), Expect = 1.2,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQP 102
           C H  H+ C+  W+  +     CP+CR P
Sbjct: 377 CGHVLHLSCLKNWMERSQ---TCPICRLP 402

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 30.4 bits (67), Expect = 1.2,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 4/55 (7%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAAR---GACP 97
            C  C+   N +C  C  P     +V+  C H  H  C+  W          G CP
Sbjct: 1268 CDSCKKK-NTLCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLNENEHECPGGCP 1321

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_8.288
            YDR128W
          Length = 1120

 Score = 30.4 bits (67), Expect = 1.3,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 16/41 (39%), Gaps = 3/41 (7%)

Query: 57   CPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACP 97
            C  C+        + G+CQH  H  C   W  T    G CP
Sbjct: 1069 CNYCNLKVKGTAFICGSCQHILHSSCAKEWWTTG---GECP 1106

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 30.4 bits (67), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 17/47 (36%)

Query: 66  TCPV--------VVG----TCQHAFHVHCVVPWLATAAARGACPMCR 100
           TCPV        V G     CQH FH  C+  W         CP+CR
Sbjct: 226 TCPVCLERLDSEVTGLATIPCQHTFHCVCLNKW-----GDNRCPVCR 267

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
            {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128W Hypothetical ORF
          Length = 1140

 Score = 30.4 bits (67), Expect = 1.3,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 2/37 (5%)

Query: 56   VCPSCSHPGVTCP--VVVGTCQHAFHVHCVVPWLATA 90
            V  +CS+ G+      V G CQH  H  C   W A A
Sbjct: 1086 VSQNCSYCGLKADRIFVCGNCQHIMHASCASEWWAIA 1122

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score = 30.4 bits (67), Expect = 1.3,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQP 102
           C H  H+ C+  W+  +     CP+CR P
Sbjct: 367 CGHVLHLFCLKNWMERSQ---TCPICRLP 392

>NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa]
           {ON} Anc_2.157 YHR115C
          Length = 521

 Score = 30.0 bits (66), Expect = 1.4,   Method: Composition-based stats.
 Identities = 11/39 (28%), Positives = 17/39 (43%)

Query: 68  PVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALD 106
           P+ +  C H +H  CV   +        CP C+  F L+
Sbjct: 357 PIFISPCSHHWHYKCVKDLITVEYPFFFCPTCKNQFDLE 395

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score = 30.0 bits (66), Expect = 1.4,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 3/29 (10%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQP 102
           C H  H  C+  W+  A     CP+CR P
Sbjct: 363 CGHMLHFGCLKSWMQRAQ---TCPICRFP 388

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1333

 Score = 30.0 bits (66), Expect = 1.4,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 16/42 (38%), Gaps = 1/42 (2%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWL 87
            C  CR   N +C  C  P     + +  C H FH  C   W 
Sbjct: 1275 CDSCRKP-NTLCVICEQPMKKLAICLLECGHEFHFECGQQWF 1315

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 29.6 bits (65), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 5/52 (9%)

Query: 51  AGYNAVCPSCSHPGVTCPVVVG--TCQHAFHVHCVVPWLATAAARGACPMCR 100
            G N     C +     P+VV    C H F + CV  WL+ +     CPMCR
Sbjct: 86  EGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRST---TCPMCR 134

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score = 30.0 bits (66), Expect = 1.5,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQP 102
           C H  H+ C+  W+  +     CP+CR P
Sbjct: 392 CGHMLHLSCLKNWMERSQ---TCPICRLP 417

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 5/43 (11%)

Query: 60  CSHPGVTCPVVVGT--CQHAFHVHCVVPWLATAAARGACPMCR 100
           C++     P+V     C H F + C+  WL+ +    +CP+CR
Sbjct: 108 CTYKEDDHPLVAELPHCNHKFDLECISVWLSKST---SCPLCR 147

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 30.0 bits (66), Expect = 1.7,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQP 102
           C H  H+ C+  W+  +     CP+CR P
Sbjct: 375 CGHILHLSCLKNWMERSQ---TCPICRLP 400

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 30.0 bits (66), Expect = 1.7,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQP 102
           C H  H+ C+  W+  +     CP+CR P
Sbjct: 376 CGHILHLSCLKNWMERSQ---TCPICRLP 401

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score = 30.0 bits (66), Expect = 1.7,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQP 102
           C H  H+ C+  W+  +     CP+CR P
Sbjct: 377 CGHILHLSCLKNWMERSQ---TCPICRLP 402

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 29.3 bits (64), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 7/51 (13%)

Query: 54  NAVCPSC----SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           N  CP C    S       V +  C H F + C+  WL+ +     CP+CR
Sbjct: 46  NDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSV---TCPLCR 93

>KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {ON}
           some similarities with uniprot|P53924 Saccharomyces
           cerevisiae YNL116W DMA2 Protein involved in regulating
           spindle position and orientation functionally redundant
           with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 479

 Score = 30.0 bits (66), Expect = 1.8,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 18/38 (47%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALD 106
           + +  C H++H  CV   + T   +  CP CR    L+
Sbjct: 411 IFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLE 448

>NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {ON}
           Anc_2.157 YHR115C
          Length = 554

 Score = 29.6 bits (65), Expect = 1.9,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 19/45 (42%), Gaps = 1/45 (2%)

Query: 57  CPSCSHPGVTCPVV-VGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           C  C      C  + +  C H++H HC+   +     +  CP CR
Sbjct: 471 CSICLSKIKACQAIFISPCAHSWHFHCIRRLVMLTYPQFVCPNCR 515

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 29.6 bits (65), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 15/27 (55%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCR 100
           C H +H+ C+  W    +   +CP+CR
Sbjct: 35  CGHEYHLACIRKWFHLHSGNRSCPVCR 61

>Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {ON}
           YNL116W - Hypothetical ORF [contig 204] FULL
          Length = 470

 Score = 29.6 bits (65), Expect = 2.0,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 18/38 (47%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALD 106
           + +  C H++H  CV   + T   +  CP CR    L+
Sbjct: 402 IFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLE 439

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
           {ON} weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 273

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 4/47 (8%)

Query: 57  CPSCSHPGVTCPVVVGT---CQHAFHVHCVVPWLATAAARGACPMCR 100
           CP C     T    +GT   C H FH  C+  W    A    CP+CR
Sbjct: 5   CPICLDDDRTNIESIGTLQPCNHKFHRDCLRRW-HLYAHDLVCPICR 50

>NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.157
           YHR115C
          Length = 518

 Score = 29.6 bits (65), Expect = 2.2,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 19/38 (50%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALD 106
           + +  C H++H HC+   +  +  +  CP CR    L+
Sbjct: 442 IFISPCAHSWHFHCIRRLVMLSYPQFVCPNCRSACDLE 479

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score = 29.6 bits (65), Expect = 2.2,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQP 102
           C H  H+ C+  W+  +     CP+CR P
Sbjct: 375 CGHFLHLSCLKNWMERSQ---TCPICRLP 400

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 29.6 bits (65), Expect = 2.5,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 4/55 (7%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAAR---GACP 97
            C  C+   N  C  C  P     +V+  C H  H  C+  W      +   G CP
Sbjct: 1283 CDSCKKK-NTSCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLDENEQECPGGCP 1336

>NCAS0D04540 Chr4 (861304..862713) [1410 bp, 469 aa] {ON} Anc_6.332
           YCR066W
          Length = 469

 Score = 29.3 bits (64), Expect = 2.6,   Method: Composition-based stats.
 Identities = 11/33 (33%), Positives = 18/33 (54%)

Query: 93  RGACPMCRQPFALDPLRRVNRGATVTLPQLGDP 125
           +  CP+C++ F +  L R +    +TL  LG P
Sbjct: 187 QAQCPICQEAFPIQVLERSHLDECLTLQSLGKP 219

>YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}
           DMA1Ubiquitin-protein ligase (E3); controls septin
           dynamics and the spindle position checkpoint (SPOC)
           along with functionally redundant ligase Dma2p by
           regulating the recruitment of Elm1p to the bud neck;
           regulates levels of the translation initiation factor
           eIF2 subunit Gcd11p, as well as abundance, localization,
           and ubiquitination of Cdk inhibitory kinase Swe1p;
           ortholog of human RNF8 protein, with sequence similarity
           to human Chfr; contains FHA and RING finger domains
          Length = 416

 Score = 29.3 bits (64), Expect = 2.6,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 1/45 (2%)

Query: 57  CPSCSHPGVTCPVV-VGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           C  C +    C  + +  C H++H HCV   +     +  CP CR
Sbjct: 327 CSICLNKIKPCQAIFISPCAHSWHFHCVRRLVIMNYPQFMCPNCR 371

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {ON}
           Anc_3.405 YPR093C
          Length = 102

 Score = 28.5 bits (62), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 14/31 (45%), Gaps = 3/31 (9%)

Query: 74  CQHAFHVHCVVPWLATAAA---RGACPMCRQ 101
           C H FH  C+  W  T      R  CP CR+
Sbjct: 29  CHHKFHSDCIRKWHTTTTGEIRRPLCPFCRE 59

>KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {ON}
           Anc_2.157 YHR115C
          Length = 427

 Score = 29.3 bits (64), Expect = 2.7,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 15/32 (46%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105
           C H +H  C+ P++        CP CR  F L
Sbjct: 357 CSHCWHSACIQPYMNKDVPLFTCPNCRCIFDL 388

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score = 29.3 bits (64), Expect = 2.8,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCR 100
           C H  H++C+  W+  +     CP+CR
Sbjct: 347 CGHVLHLYCLKNWMERSQ---TCPICR 370

>TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.157
           YHR115C
          Length = 885

 Score = 29.3 bits (64), Expect = 2.9,   Method: Composition-based stats.
 Identities = 9/32 (28%), Positives = 16/32 (50%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           + +  C H++H HC+   +     +  CP CR
Sbjct: 782 IFISPCSHSWHFHCIRRLVMLQYPQFVCPNCR 813

>KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3.22
            YOL138C
          Length = 1365

 Score = 29.3 bits (64), Expect = 3.0,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 23/61 (37%), Gaps = 3/61 (4%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACP-MCRQPFA 104
            C  C+   N++C  C  P     + +  C H  H  C   W     A  +CP  C  P  
Sbjct: 1307 CDSCKKP-NSLCVLCEEPMKKMTISLLACGHEGHFDCFKKWF-IQEAMDSCPGGCTHPIN 1364

Query: 105  L 105
            L
Sbjct: 1365 L 1365

>AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR128W
          Length = 1125

 Score = 29.3 bits (64), Expect = 3.2,   Method: Composition-based stats.
 Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 54   NAVCPSCSHPGVTCP---VVVGTCQHAFHVHCVVPW 86
            +A+  SC++ G+       + G+CQH  H  C   W
Sbjct: 1067 SAITHSCAYCGLQAKKRIFLCGSCQHVLHASCAAEW 1102

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 28.5 bits (62), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 14/33 (42%), Gaps = 3/33 (9%)

Query: 71  VGTCQHAFHVHCVVPWLATAAARGACPMCRQPF 103
           V  C H F + C+  WL        CPMCR   
Sbjct: 89  VPRCNHKFDLECLSIWLQN---NHTCPMCRDDL 118

>TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}
           Anc_3.405 YPR093C
          Length = 93

 Score = 28.1 bits (61), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 1/45 (2%)

Query: 56  VCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           +C  C   G      +  C+H FH  C+  W  T A    CP CR
Sbjct: 8   MCAICLEEGHEEFGELHPCRHKFHKECIRRW-HTGAIDLKCPTCR 51

>Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ACR267C
          Length = 474

 Score = 28.9 bits (63), Expect = 3.6,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 18/38 (47%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALD 106
           + +  C H++H  C+   + T   +  CP CR    L+
Sbjct: 390 IFISPCSHSWHYQCIRRLVMTQYPQFVCPNCRSSCDLE 427

>ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL116W and
           YHR115C
          Length = 467

 Score = 28.9 bits (63), Expect = 3.7,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 18/38 (47%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALD 106
           + +  C H++H  C+   + T   +  CP CR    L+
Sbjct: 381 IFISPCSHSWHYQCIRRLVMTQYPQFICPNCRSSCDLE 418

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 28.5 bits (62), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 32/75 (42%), Gaps = 18/75 (24%)

Query: 45  VCGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFA 104
           +C IC   +        +P V   + +  C H F + C+  WL++ +    CP+CR    
Sbjct: 86  LCSICFENFRED----EYPLV---IELPHCSHKFDLQCISVWLSSNS---TCPVCRD--- 132

Query: 105 LDPLRRVNRGATVTL 119
                +VN  A + +
Sbjct: 133 -----KVNHNAKLDI 142

>TDEL0E01020 Chr5 complement(208284..210287) [2004 bp, 667 aa] {ON}
           Anc_4.268 YDL074C
          Length = 667

 Score = 28.9 bits (63), Expect = 3.9,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVN 112
           + + TC H F  +C    LA+   +  CP C +PF+ + L  ++
Sbjct: 625 MAIKTCGHVFCDNCCKERLASRMRK--CPSCNKPFSSNDLLSIH 666

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
            similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 28.9 bits (63), Expect = 4.1,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 59   SCSHPGVTCP---VVVGTCQHAFHVHCVVPW 86
            +C++ G+      +V G CQH  H  C V W
Sbjct: 1080 NCTYCGLKTKRRILVCGNCQHILHASCAVEW 1110

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
            YOL138C (REAL)
          Length = 1332

 Score = 28.9 bits (63), Expect = 4.2,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 19/55 (34%), Gaps = 4/55 (7%)

Query: 46   CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAAR---GACP 97
            C  C+   N  C  C  P     +V+  C H  H  C+  W          G CP
Sbjct: 1274 CDSCKKK-NTPCILCERPLKKLTMVILPCGHEGHFQCIQEWFLDEKEHECPGGCP 1327

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 28.5 bits (62), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 5/35 (14%)

Query: 68  PVVVGT--CQHAFHVHCVVPWLATAAARGACPMCR 100
           P+VV    C H F + C+  WL+ +     CP+CR
Sbjct: 127 PLVVELPHCHHKFDLECLSVWLSRST---TCPLCR 158

>ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116W DMA2 Protein involved in regulating spindle
           position and orientation functionally redundant with
           Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 579

 Score = 28.5 bits (62), Expect = 4.8,   Method: Composition-based stats.
 Identities = 9/30 (30%), Positives = 16/30 (53%)

Query: 71  VGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           +  C H++H  C+   + T+  +  CP CR
Sbjct: 508 ISPCSHSWHFQCIRRLVMTSYPQFVCPNCR 537

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 28.1 bits (61), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 5/35 (14%)

Query: 68  PVVVGT--CQHAFHVHCVVPWLATAAARGACPMCR 100
           P+VV    C H F + C+  WL+ +     CP+CR
Sbjct: 92  PLVVELPHCHHKFDLECLSVWLSRST---TCPLCR 123

>CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116w
          Length = 603

 Score = 28.5 bits (62), Expect = 4.9,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 17/38 (44%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALD 106
           + +  C H +H  CV   +  A  +  CP CR    L+
Sbjct: 528 IFISPCAHTWHFRCVRRLVMLAYPQFVCPNCRSTCDLE 565

>KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some
           similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 306

 Score = 28.5 bits (62), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%)

Query: 70  VVGTCQHAFHVHCVVPWLATAAARG-ACPMCRQPF 103
           V+ +C H +   C+  WL +  A    CP CR P 
Sbjct: 5   VMTSCGHNYCYECISNWLVSNNANELTCPQCRSPL 39

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 28.1 bits (61), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 5/35 (14%)

Query: 68  PVVVGT--CQHAFHVHCVVPWLATAAARGACPMCR 100
           P+VV    C H F + C+  WL+ +     CP+CR
Sbjct: 120 PLVVELPHCNHRFDLECLSVWLSRST---TCPLCR 151

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 28.5 bits (62), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 6/37 (16%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGA-----CPMCR 100
           +V+  CQH FH  C+  W +    RG      CP+CR
Sbjct: 180 IVMIPCQHYFHAGCLKEWFS-PQRRGKRRPLVCPLCR 215

>NCAS0A02550 Chr1 complement(484341..486479) [2139 bp, 712 aa] {ON}
           Anc_4.268 YDL074C
          Length = 712

 Score = 28.5 bits (62), Expect = 5.5,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 2/44 (4%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVN 112
           + + TC H F   C    LA    +  CP C  PF+ + L  V+
Sbjct: 670 MAIKTCGHVFCEECCKERLAARMRK--CPTCNNPFSANDLLLVH 711

>KLLA0F23892g Chr6 complement(2229493..2231049) [1557 bp, 518 aa]
           {ON} some similarities with uniprot|P53924 Saccharomyces
           cerevisiae YNL116W DMA2 Protein involved in regulating
           spindle position and orientation functionally redundant
           with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 518

 Score = 28.5 bits (62), Expect = 5.7,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 19/45 (42%), Gaps = 1/45 (2%)

Query: 57  CPSCSHPGVTCPVV-VGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           C  C      C  V +  C H++H  C+   ++    +  CP CR
Sbjct: 392 CSICLSKIKACQAVFIAPCSHSWHFKCIRQLVSKTYPQFVCPNCR 436

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 28.1 bits (61), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 5/35 (14%)

Query: 68  PVVVGT--CQHAFHVHCVVPWLATAAARGACPMCR 100
           P+VV    C H F + C+  WL+ +     CP+CR
Sbjct: 122 PLVVELPHCHHKFDLECLSVWLSRST---TCPLCR 153

>TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.157
           YHR115C
          Length = 524

 Score = 28.1 bits (61), Expect = 6.2,   Method: Composition-based stats.
 Identities = 9/30 (30%), Positives = 15/30 (50%)

Query: 71  VGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           +  C H +H  C+   + T+  +  CP CR
Sbjct: 451 ISPCSHCWHFQCIRRLVMTSYPQFVCPNCR 480

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 27.7 bits (60), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 3/27 (11%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCR 100
           C H F + C+  WL+       CPMCR
Sbjct: 113 CGHIFDLQCISMWLSNQV---TCPMCR 136

>Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa] {ON}
           YPR093C (REAL)
          Length = 288

 Score = 28.1 bits (61), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 71  VGTCQHAFHVHCVVPWLATAAARGACPMCR 100
           +  C+H FH++C+  W    +    CP+CR
Sbjct: 20  LDICKHKFHLNCIREW-HKYSIDLKCPICR 48

>CAGL0D00638g Chr4 complement(80947..83028) [2082 bp, 693 aa] {ON}
           similar to uniprot|Q07457 Saccharomyces cerevisiae
           YDL074c BRE1
          Length = 693

 Score = 28.1 bits (61), Expect = 6.9,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 2/44 (4%)

Query: 69  VVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVN 112
           + + TC H F   C    LA    +  CP C +PF+ + L  V+
Sbjct: 651 MAIRTCGHVFCEDCCKERLAARMRK--CPTCNKPFSSNDLLMVH 692

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 27.7 bits (60), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 5/35 (14%)

Query: 68  PVVVGT--CQHAFHVHCVVPWLATAAARGACPMCR 100
           P+VV    C H F   CV  WL        CPMCR
Sbjct: 117 PLVVELPHCGHKFDFECVSMWLTKNT---TCPMCR 148

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 27.3 bits (59), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCR 100
           C H F + C+  WL+ +     CP+CR
Sbjct: 125 CGHRFDLECISVWLSKS---DTCPLCR 148

>Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 27.7 bits (60), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 74  CQHAFHVHCVVPWLATAAARGACPMCR 100
           C+H FH++C+  W    +    CP+CR
Sbjct: 23  CRHQFHLNCIREW-HKYSIDLKCPICR 48

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.138    0.498 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,205,730
Number of extensions: 262311
Number of successful extensions: 996
Number of sequences better than 10.0: 205
Number of HSP's gapped: 948
Number of HSP's successfully gapped: 208
Length of query: 128
Length of database: 53,481,399
Length adjustment: 96
Effective length of query: 32
Effective length of database: 42,473,463
Effective search space: 1359150816
Effective search space used: 1359150816
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)