Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0I019003.187ON93931779e-18
YDL012C3.187ON107231136e-08
Suva_4.2373.187ON103231119e-08
KAFR0C008803.187ON121241111e-07
ZYRO0A04972g3.187ON122241111e-07
Skud_4.2413.187ON106921083e-07
CAGL0I04510g3.187ON116241066e-07
Klac_YGOB_Anc_3.1873.187ON119241041e-06
TDEL0D043403.187ON120231041e-06
Smik_2.1353.187ON127241042e-06
Skud_2.1283.187ON127241032e-06
SAKL0C08008g3.187ON145231024e-06
KLTH0E15840g3.187ON11324996e-06
Kwal_YGOB_Anc_3.1873.187ON11224997e-06
Suva_2.1443.187ON11924981e-05
KNAG0K012853.187ON12624971e-05
TBLA0B016803.187ON4024922e-05
CAGL0K01903g3.187ON10124935e-05
Kpol_1036.513.187ON7924838e-04
Ecym_52633.187ON12422830.001
AER212W3.187ON11322780.008
Smik_4.2223.187ON6320700.047
NOTE: 2 genes in the same pillar as NCAS0I01900 were not hit in these BLAST results
LIST: TBLA0F00730 YBR016W

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0I01900
         (93 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0I01900 Chr9 (349882..350163) [282 bp, 93 aa] {ON} Anc_3.187...    73   9e-18
YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp, ...    48   6e-08
Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312 b...    47   9e-08
KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa...    47   1e-07
ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122 a...    47   1e-07
Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321 b...    46   3e-07
CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351...    45   6e-07
Klac_YGOB_Anc_3.187 Chr3 complement(406964..407278,407429..40747...    45   1e-06
TDEL0D04340 Chr4 (792565..792609,792675..792992) [363 bp, 120 aa...    45   1e-06
Smik_2.135 Chr2 (250473..250856) [384 bp, 127 aa] {ON} YBR016W (...    45   2e-06
Skud_2.128 Chr2 (243786..244169) [384 bp, 127 aa] {ON} YBR016W (...    44   2e-06
SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438...    44   4e-06
KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp, 1...    43   6e-06
Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273) [3...    43   7e-06
Suva_2.144 Chr2 (249704..250063) [360 bp, 119 aa] {ON} YBR016W (...    42   1e-05
KNAG0K01285 Chr11 complement(253589..253930,254081..254119) [381...    42   1e-05
TBLA0B01680 Chr2 complement(375921..376043) [123 bp, 40 aa] {ON}...    40   2e-05
CAGL0K01903g Chr11 complement(169669..169974) [306 bp, 101 aa] {...    40   5e-05
Kpol_1036.51 s1036 (140002..140004,140137..140373) [240 bp, 79 a...    37   8e-04
Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp...    37   0.001
AER212W Chr5 (1027712..1027753,1027805..1028104) [342 bp, 113 aa...    35   0.008
Smik_4.222 Chr4 complement(413282..413401,413405..413416,413420....    32   0.047

>NCAS0I01900 Chr9 (349882..350163) [282 bp, 93 aa] {ON} Anc_3.187
          YBR016W
          Length = 93

 Score = 72.8 bits (177), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 44/93 (47%)

Query: 1  MQYSRPSVPPPGHESQGTRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
          MQYSRPSVPPPGHESQGTRG                                        
Sbjct: 1  MQYSRPSVPPPGHESQGTRGYPPQQQQPPQYYQQPPQQQYYQPQQQPQYYQQQQQPQPQP 60

Query: 61 XXXXXXXXXRGNEDCLTGCLAGLCICCTLDMLM 93
                   RGNEDCLTGCLAGLCICCTLDMLM
Sbjct: 61 VYVQQQAPQRGNEDCLTGCLAGLCICCTLDMLM 93

>YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp, 107
           aa] {ON} Tail-anchored plasma membrane protein
           containing a conserved CYSTM module, possibly involved
           in response to stress; may contribute to non-homologous
           end-joining (NHEJ) based on ydl012c htz1 double null
           phenotype
          Length = 107

 Score = 48.1 bits (113), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 20/23 (86%), Positives = 21/23 (91%)

Query: 71  GNEDCLTGCLAGLCICCTLDMLM 93
           GNEDCL GCLAGLC+CCTLDML 
Sbjct: 85  GNEDCLAGCLAGLCLCCTLDMLF 107

>Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312 bp,
           103 aa] {ON} YDL012C (REAL)
          Length = 103

 Score = 47.4 bits (111), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 20/23 (86%), Positives = 23/23 (100%)

Query: 71  GNEDCLTGCLAGLCICCTLDMLM 93
           GN+DCLTGCLAGLC+CCTLDML+
Sbjct: 81  GNQDCLTGCLAGLCLCCTLDMLI 103

>KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa]
           {ON} Anc_3.187 YDL012C
          Length = 121

 Score = 47.4 bits (111), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (87%)

Query: 70  RGNEDCLTGCLAGLCICCTLDMLM 93
           RGNEDCLT CLA +CICCTLDML 
Sbjct: 98  RGNEDCLTACLAAMCICCTLDMLF 121

 Score = 29.3 bits (64), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 10/19 (52%), Positives = 14/19 (73%)

Query: 2  QYSRPSVPPPGHESQGTRG 20
          QY+RPS PPP  + Q ++G
Sbjct: 13 QYNRPSAPPPQQQGQSSKG 31

>ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122 aa]
           {ON} weakly similar to uniprot|P38216 Saccharomyces
           cerevisiae YBR016W
          Length = 122

 Score = 47.4 bits (111), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (87%)

Query: 70  RGNEDCLTGCLAGLCICCTLDMLM 93
           RGNEDCLT CLA LC+CCTLDML 
Sbjct: 99  RGNEDCLTACLAVLCVCCTLDMLF 122

>Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321 bp,
           106 aa] {ON} YDL012C (REAL)
          Length = 106

 Score = 46.2 bits (108), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 36/92 (39%), Gaps = 2/92 (2%)

Query: 3   YSRPSVPPPGHESQGTRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 62
           YSRP+ PPPG+E+ G RG                                          
Sbjct: 16  YSRPTAPPPGYET-GARGYAPAQGQQQYYPQQQQQYYQQQPQYYQQQQPQPYQQHPQQPI 74

Query: 63  XXXXX-XXRGNEDCLTGCLAGLCICCTLDMLM 93
                    GN DCLTGCLAGLC+CCTLDML 
Sbjct: 75  YVQQQPASTGNGDCLTGCLAGLCLCCTLDMLF 106

>CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351
           bp, 116 aa] {ON} similar to uniprot|P38216 Saccharomyces
           cerevisiae YBR016w and similar to uniprot|Q12489
           Saccharomyces cerevisiae YDL012c
          Length = 116

 Score = 45.4 bits (106), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (87%)

Query: 70  RGNEDCLTGCLAGLCICCTLDMLM 93
           RGN+DC+T CLA LCICCTLD+L 
Sbjct: 93  RGNDDCMTACLAALCICCTLDLLF 116

>Klac_YGOB_Anc_3.187 Chr3 complement(406964..407278,407429..407473)
           [360 bp, 119 aa] {ON} ANNOTATED BY YGOB -
          Length = 119

 Score = 44.7 bits (104), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%)

Query: 70  RGNEDCLTGCLAGLCICCTLDMLM 93
           R N DCLT CLAG+C+CCTLDML 
Sbjct: 96  RNNSDCLTACLAGMCLCCTLDMLF 119

>TDEL0D04340 Chr4 (792565..792609,792675..792992) [363 bp, 120 aa]
           {ON} Anc_3.187 YDL012C
          Length = 120

 Score = 44.7 bits (104), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (86%)

Query: 71  GNEDCLTGCLAGLCICCTLDMLM 93
           GN+DCLT CLA +CICCTLDML 
Sbjct: 98  GNQDCLTACLAAMCICCTLDMLF 120

 Score = 26.9 bits (58), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 8/11 (72%), Positives = 11/11 (100%)

Query: 3  YSRPSVPPPGH 13
          Y+RP++PPPGH
Sbjct: 16 YNRPNIPPPGH 26

>Smik_2.135 Chr2 (250473..250856) [384 bp, 127 aa] {ON} YBR016W
           (REAL)
          Length = 127

 Score = 44.7 bits (104), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 17/24 (70%), Positives = 20/24 (83%)

Query: 70  RGNEDCLTGCLAGLCICCTLDMLM 93
           +GNE C+T CLA LCICCT+DML 
Sbjct: 104 KGNEGCITACLAALCICCTMDMLF 127

>Skud_2.128 Chr2 (243786..244169) [384 bp, 127 aa] {ON} YBR016W
           (REAL)
          Length = 127

 Score = 44.3 bits (103), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 17/24 (70%), Positives = 20/24 (83%)

Query: 70  RGNEDCLTGCLAGLCICCTLDMLM 93
           +GNE C+T CLA LCICCT+DML 
Sbjct: 104 KGNEGCITACLAALCICCTMDMLF 127

>SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438
           bp, 145 aa] {ON} similar to uniprot|Q12489 Saccharomyces
           cerevisiae YDL012C Plasma membrane protein of unknown
           function
          Length = 145

 Score = 43.9 bits (102), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 20/23 (86%)

Query: 71  GNEDCLTGCLAGLCICCTLDMLM 93
            N+DCLT CLAG+C+CCTLDML 
Sbjct: 123 NNQDCLTACLAGMCLCCTLDMLF 145

>KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp, 113
           aa] {ON} similar to uniprot|Q12489 Saccharomyces
           cerevisiae YDL012C Plasma membrane protein of unknown
           function
          Length = 113

 Score = 42.7 bits (99), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 17/24 (70%), Positives = 19/24 (79%)

Query: 70  RGNEDCLTGCLAGLCICCTLDMLM 93
             N DCLT CLAG+C+CCTLDML 
Sbjct: 90  NNNSDCLTACLAGMCLCCTLDMLF 113

>Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273) [339
           bp, 112 aa] {ON} ANNOTATED BY YGOB -
          Length = 112

 Score = 42.7 bits (99), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 17/24 (70%), Positives = 19/24 (79%)

Query: 70  RGNEDCLTGCLAGLCICCTLDMLM 93
             N DCLT CLAG+C+CCTLDML 
Sbjct: 89  NNNSDCLTACLAGMCLCCTLDMLF 112

 Score = 26.6 bits (57), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 15/19 (78%), Gaps = 1/19 (5%)

Query: 2  QYSRPSVPPPGHESQGTRG 20
          QY+ PS PPPGH+ Q +RG
Sbjct: 16 QYTSPSGPPPGHQ-QDSRG 33

>Suva_2.144 Chr2 (249704..250063) [360 bp, 119 aa] {ON} YBR016W
           (REAL)
          Length = 119

 Score = 42.4 bits (98), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/24 (70%), Positives = 20/24 (83%)

Query: 70  RGNEDCLTGCLAGLCICCTLDMLM 93
           +GNE C+T CLA LCICCT+DML 
Sbjct: 96  KGNEGCMTACLAALCICCTMDMLF 119

>KNAG0K01285 Chr11 complement(253589..253930,254081..254119) [381
           bp, 126 aa] {ON}
          Length = 126

 Score = 42.0 bits (97), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 20/24 (83%)

Query: 70  RGNEDCLTGCLAGLCICCTLDMLM 93
           RGN+DC+T CLA LC+CC ++M+ 
Sbjct: 103 RGNDDCMTACLAALCVCCAMNMIF 126

>TBLA0B01680 Chr2 complement(375921..376043) [123 bp, 40 aa] {ON}
          Anc_3.187 YDL012C
          Length = 40

 Score = 40.0 bits (92), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%)

Query: 70 RGNEDCLTGCLAGLCICCTLDMLM 93
            N+DC+T CLA LC+CCTLDML 
Sbjct: 17 SNNDDCMTACLAALCVCCTLDMLF 40

>CAGL0K01903g Chr11 complement(169669..169974) [306 bp, 101 aa] {ON}
           no similarity
          Length = 101

 Score = 40.4 bits (93), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%)

Query: 70  RGNEDCLTGCLAGLCICCTLDMLM 93
            GNEDCL  CLA +CIC TLD+L+
Sbjct: 78  NGNEDCLMACLAAMCICLTLDLLI 101

>Kpol_1036.51 s1036 (140002..140004,140137..140373) [240 bp, 79
          aa] {ON} (140002..140004,140137..140373) [240 nt, 80
          aa]
          Length = 79

 Score = 36.6 bits (83), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 19/24 (79%)

Query: 70 RGNEDCLTGCLAGLCICCTLDMLM 93
          RGNEDC+T CLA LC+  TL++ +
Sbjct: 56 RGNEDCMTACLAALCVLFTLNLFI 79

>Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp,
           124 aa] {ON} similar to Ashbya gossypii AER212W
          Length = 124

 Score = 36.6 bits (83), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/22 (63%), Positives = 16/22 (72%)

Query: 72  NEDCLTGCLAGLCICCTLDMLM 93
            + CL  CLAG C+CCTLDML 
Sbjct: 103 KDSCLMACLAGACLCCTLDMLF 124

>AER212W Chr5 (1027712..1027753,1027805..1028104) [342 bp, 113 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL012C and YBR016W; 1-intron
          Length = 113

 Score = 34.7 bits (78), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (72%)

Query: 72  NEDCLTGCLAGLCICCTLDMLM 93
           N+ CL  CL G+C+C TLDML 
Sbjct: 92  NDSCLVACLGGMCLCYTLDMLF 113

>Smik_4.222 Chr4
          complement(413282..413401,413405..413416,
          413420..413476) [189 bp, 63 aa] {ON} YDL012C (REAL)
          Length = 63

 Score = 31.6 bits (70), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%), Gaps = 1/20 (5%)

Query: 1  MQYSRPSVPPPGHESQGTRG 20
           QYSRP+ PPPG+E+ G+RG
Sbjct: 41 FQYSRPTAPPPGYET-GSRG 59

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.141    0.487 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 4,928,947
Number of extensions: 55120
Number of successful extensions: 193
Number of sequences better than 10.0: 25
Number of HSP's gapped: 193
Number of HSP's successfully gapped: 33
Length of query: 93
Length of database: 53,481,399
Length adjustment: 64
Effective length of query: 29
Effective length of database: 46,142,775
Effective search space: 1338140475
Effective search space used: 1338140475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)