Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H025605.528ON58758718020.0
NDAI0C010605.528ON6372264158e-43
Kpol_1023.975.528ON5913453512e-34
CAGL0H04631g5.528ON588643309e-32
Smik_13.1445.528ON639633231e-30
Suva_13.1555.528ON645633222e-30
Skud_13.1475.528ON665633212e-30
YML007W (YAP1)5.528ON650633202e-30
KAFR0C054005.528ON481643092e-29
TDEL0A039205.528ON4661733082e-29
KNAG0B036805.528ON482643056e-29
SAKL0G04950g5.528ON567643078e-29
KLTH0G03784g5.528ON569643032e-28
Kwal_47.186315.528ON584643023e-28
KLLA0A01760g5.528ON583632962e-27
ZYRO0D12584g5.528ON579632855e-26
TBLA0G009305.528ON608662695e-24
Kpol_1004.225.528ON475642542e-22
TPHA0K005205.528ON560642472e-21
TPHA0D023405.528ON506632427e-21
NCAS0F011005.528ON475841946e-15
TBLA0D016405.528ON599591876e-14
Ecym_40645.528ON426981642e-11
ADR195C5.528ON288701498e-10
NDAI0H016105.528ON519611464e-09
YDR423C (CAD1)5.528ON409571411e-08
KNAG0C032105.528ON3841031402e-08
CAGL0F03069g5.528ON486851384e-08
KAFR0E032905.528ON2651061265e-07
Smik_4.6985.528ON393531286e-07
Suva_2.600singletonOFF382531242e-06
YPR199C (ARR1)na 1ON29447780.61
ZYRO0B01100g2.493ON25646705.3
NOTE: 1 genes in the same pillar as NCAS0H02560 were not hit in these BLAST results
LIST: Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H02560
         (587 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...   698   0.0  
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...   164   8e-43
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...   139   2e-34
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...   131   9e-32
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...   129   1e-30
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...   128   2e-30
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...   128   2e-30
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...   127   2e-30
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...   123   2e-29
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...   123   2e-29
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...   122   6e-29
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...   122   8e-29
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...   121   2e-28
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...   120   3e-28
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...   118   2e-27
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...   114   5e-26
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...   108   5e-24
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...   102   2e-22
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....   100   2e-21
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...    98   7e-21
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    79   6e-15
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    77   6e-14
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    68   2e-11
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    62   8e-10
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    61   4e-09
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    59   1e-08
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    59   2e-08
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    58   4e-08
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    53   5e-07
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    54   6e-07
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    52   2e-06
YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}  ...    35   0.61 
ZYRO0B01100g Chr2 (92729..93499) [771 bp, 256 aa] {ON} some simi...    32   5.3  

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/587 (64%), Positives = 379/587 (64%)

Query: 1   MSTTTAKRPLELDPNSRLQFAQSKEQQQELERYSTEDAGSRKKQEVSGTSNAAATTNMTK 60
           MSTTTAKRPLELDPNSRLQFAQSKEQQQELERYSTEDAGSRKKQEVSGTSNAAATTNMTK
Sbjct: 1   MSTTTAKRPLELDPNSRLQFAQSKEQQQELERYSTEDAGSRKKQEVSGTSNAAATTNMTK 60

Query: 61  KQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLIT 120
           KQLDIEAKNKRTAQNRAAQRAF              VNNLTKIQKQNEIESEFLRGQLIT
Sbjct: 61  KQLDIEAKNKRTAQNRAAQRAFRERKERKMKELEEKVNNLTKIQKQNEIESEFLRGQLIT 120

Query: 121 LVNELKKYRDPNPNESKVLEYLSQHNGNNKDFTFQFPETSNLNKKVTIPSPDGSFERQQQ 180
           LVNELKKYRDPNPNESKVLEYLSQHNGNNKDFTFQFPETSNLNKKVTIPSPDGSFERQQQ
Sbjct: 121 LVNELKKYRDPNPNESKVLEYLSQHNGNNKDFTFQFPETSNLNKKVTIPSPDGSFERQQQ 180

Query: 181 KKPXXXXXXXXXXXXXXXLMQTIXXXXXXXXXXXXXXXXXXXXXXXXXXXSLEWXXXXXX 240
           KKP               LMQTI                           SLEW      
Sbjct: 181 KKPSTSSISSNDDSSSSNLMQTINTPSMSTTTSVSSNQNQNLTGTTNNKTSLEWFDNMFN 240

Query: 241 XXXXXXQQXXXXXXXXXXXXXXXXXXXXXXXXQLDDPNLITNNFDVTDKFDEQVSDFCGK 300
                 QQ                        QLDDPNLITNNFDVTDKFDEQVSDFCGK
Sbjct: 241 NDDLFNQQLLSLSNTANANKNTTTTATNTSLLQLDDPNLITNNFDVTDKFDEQVSDFCGK 300

Query: 301 MNMACGTRYDPVPXXXXXXXXXXXXXXXXXXXXXXXXXIANQSXXXXXXXXXXXXXXXXX 360
           MNMACGTRYDPVP                         IANQS                 
Sbjct: 301 MNMACGTRYDPVPKSKSNTSTPQNNNSSLLSPPSNSKQIANQSNLFNLNTPPNLNITNTF 360

Query: 361 DFNSPLDSPQQQNQAFGQLGMPNSPQFLSAFELPTENXXXXXXXXXXXXXXXXXXTLPFI 420
           DFNSPLDSPQQQNQAFGQLGMPNSPQFLSAFELPTEN                  TLPFI
Sbjct: 361 DFNSPLDSPQQQNQAFGQLGMPNSPQFLSAFELPTENSIQKQPQQQQPMASKKSPTLPFI 420

Query: 421 NSSLAFPTDDIFXXXXXXXXXXXXXXGPLFNESSSLLSDFIRNEXXXXXXXXXXXXXXXX 480
           NSSLAFPTDDIF              GPLFNESSSLLSDFIRNE                
Sbjct: 421 NSSLAFPTDDIFNNTISNNNNNSNTNGPLFNESSSLLSDFIRNEDGNVSDSDNDADSDFD 480

Query: 481 XXLINKNLINQEISNPVLXXXXXXXXXXXXXXXXXXXXXXXXFIVPSRDGGLLRCSEIWD 540
             LINKNLINQEISNPVL                        FIVPSRDGGLLRCSEIWD
Sbjct: 481 NDLINKNLINQEISNPVLAPAPTSVPASTAATAAPEDEDDDEFIVPSRDGGLLRCSEIWD 540

Query: 541 RISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALTKHMS 587
           RISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALTKHMS
Sbjct: 541 RISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALTKHMS 587

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score =  164 bits (415), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 116/226 (51%), Gaps = 26/226 (11%)

Query: 373 NQAFGQLG-MPNSPQFLSA-FELPTENXXXXXXXXXXXXXXXXXXTLPFINSSLAFPTDD 430
           N  FGQLG M +SPQF +    LP EN                  +LPFIN +LAFP DD
Sbjct: 427 NMNFGQLGFMMDSPQFQNIDLSLPIENDKFSASNFKKP-------SLPFINPTLAFPNDD 479

Query: 431 IFXXXXXXXXXXXXXXGPLFNESSSLLSDFIRNEXXXXXXXXXXXXXXX---------XX 481
           +F                  ++ S LLS F+ N+                          
Sbjct: 480 LFNKNNSNNDNNNNTTT--THDESDLLSQFLANDYSNTISTNNLMNSDDDEDEDDDDYEK 537

Query: 482 XLINKNLINQEISNPVLXXXXXXXXXXXXXXXXXXXXXXXXFIVPSRDGGLLRCSEIWDR 541
            L+  NLIN+E S                            FIVPSRDGGLLRCSEIWDR
Sbjct: 538 KLVANNLINEEPS------STNKNNNLTSTSKEQENNDFDDFIVPSRDGGLLRCSEIWDR 591

Query: 542 ISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALTKHMS 587
           I+AHPKYS+LDIDGLCSELMTKAKCSERGVVVNAEDVQ+ALTKHMS
Sbjct: 592 ITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALTKHMS 637

 Score =  112 bits (280), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 91/148 (61%), Gaps = 6/148 (4%)

Query: 1   MSTTTAKRPLELDPNSRLQFAQSKEQQQELER--YSTEDAGSR--KKQEVSGTSNAAATT 56
           + TTT KR L+L    + Q  Q + Q     R   STE+A +   KKQ++   +N   + 
Sbjct: 4   VGTTTGKRQLDLIDQQQQQQQQFETQNANNTRPKDSTENATTNPMKKQDLDNKTNTEQSN 63

Query: 57  NMTKKQ--LDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFL 114
             +KK+  LD EA+NKRTAQNRAAQRAF              V NLTKIQKQNEIESEFL
Sbjct: 64  GNSKKKQLLDPEARNKRTAQNRAAQRAFRERKERKMKELEEKVANLTKIQKQNEIESEFL 123

Query: 115 RGQLITLVNELKKYRDPNPNESKVLEYL 142
           R QLITLVNELKKY+  N N SKVL Y+
Sbjct: 124 RSQLITLVNELKKYKPNNENASKVLNYI 151

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 29/40 (72%), Positives = 36/40 (90%)

Query: 274 LDDPNLITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313
           ++D NLI+N+FD  DKFDEQVSDFCGKM+MACGTR +P+P
Sbjct: 302 IEDSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIP 341

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score =  139 bits (351), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 106/345 (30%), Positives = 141/345 (40%), Gaps = 71/345 (20%)

Query: 276 DPNLITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVPXXXXXXXXXXXXXXXXXXXXXX 335
           D +L +N+F+  D FD+QVS FC KMN ACGT+ +PVP                      
Sbjct: 285 DSDLFSNDFNFDDHFDQQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTT 344

Query: 336 XXXIANQSXXXXXXXXXXXX--XXXXXDFNSPLDSPQ----QQNQAFGQLGM-------- 381
               +N S                   DF + LD P       N  FGQLG         
Sbjct: 345 PNESSNDSSLSIAKFDDPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGFHGLSNDIT 404

Query: 382 -----PNSPQFLS-----AFELPTE-----NXXXXXXXXXXXXXXXXXXTLPFINSSLAF 426
                 N   F+S        +PT      N                   LPFI++S+AF
Sbjct: 405 FNSNDSNWNDFISLKTDSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLPFIDTSIAF 464

Query: 427 PTD----DIFXXXXXXXXXXXXXXGPLFNESSSLLSDFIRNEXXXXXXXXXXXXXXXXXX 482
           P      D F                 FNES ++  D +  E                  
Sbjct: 465 PETKADFDAFDNQMFFRDDG-------FNESLNISDDIVGAESDDEQDNNNDND------ 511

Query: 483 LINKNLINQEISNPVLXXXXXXXXXXXXXXXXXXXXXXXXFIVPSRDGGLLRCSEIWDRI 542
           LI+KNL+ +E+                              ++P+ DG LL+CSE+WDRI
Sbjct: 512 LISKNLVCEEV-------------------------KEHDMVIPTSDGKLLKCSEVWDRI 546

Query: 543 SAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALTKHMS 587
           +AHP+YSD+DIDGLC ELM  AKCS++GVVV+++DVQ AL+ HMS
Sbjct: 547 TAHPRYSDIDIDGLCQELMHNAKCSDKGVVVDSKDVQKALSNHMS 591

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 88/175 (50%), Gaps = 35/175 (20%)

Query: 1   MSTTTAKRPLELDPNSRLQFAQSKEQQQELERYSTEDAGSRKKQEVSGTSNAAATTNMTK 60
           M++ T KRPL+                + L   S  D  S      S   +A+   N  K
Sbjct: 1   MTSVTVKRPLD----------------ESLTALSPNDNNS-SILNASTDVDASTVANANK 43

Query: 61  KQL------DIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFL 114
           K++      D E KNKRTAQNRAAQRAF              V+ L K+++QN++ESEFL
Sbjct: 44  KKVGRKLLGDHEVKNKRTAQNRAAQRAFRERKERKMKELEDKVHELEKVKQQNDVESEFL 103

Query: 115 RGQLITLVNELKKYRDPNPNESKVLEYLSQHNGNN------------KDFTFQFP 157
           R QL  +++ELKKYR    ++ KVLEYL++H  N             +DF+F++P
Sbjct: 104 RNQLTLMIDELKKYRPEKSSDIKVLEYLAKHEENGSTEKIKKNIQRKEDFSFEYP 158

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score =  131 bits (330), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 55/64 (85%), Positives = 61/64 (95%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           +VPSRD GLLRCSEIWDRI+AHPKYSD+DIDGLCSELM KAKCSERGVV+NA+DVQ+AL 
Sbjct: 525 VVPSRDDGLLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAKCSERGVVINADDVQVALN 584

Query: 584 KHMS 587
           KHMS
Sbjct: 585 KHMS 588

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 55/98 (56%)

Query: 48  GTSNAAATTNMTKKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQN 107
           G   ++A+     ++LD E + KR AQNRAAQ+AF              V +L  + K N
Sbjct: 8   GAQKSSASRKKRYQELDPETRMKRVAQNRAAQKAFRERKERKMKELERKVVDLENLTKLN 67

Query: 108 EIESEFLRGQLITLVNELKKYRDPNPNESKVLEYLSQH 145
           E+E+ FLR QL  LV EL+KYR     + KVL+YL +H
Sbjct: 68  EVETNFLRDQLSILVKELRKYRPETKQDHKVLKYLEKH 105

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 22/30 (73%)

Query: 284 FDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313
            D  + FDEQVS+FC K+N ACGT+  P+P
Sbjct: 239 IDFNNFFDEQVSEFCTKLNQACGTKACPIP 268

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score =  129 bits (323), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 52/63 (82%), Positives = 59/63 (93%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           +VPS++G LLRCSEIWDRI+ HPKYSD+D+DGLCSELM KAKCSERGVV+NAEDVQLAL 
Sbjct: 576 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 635

Query: 584 KHM 586
           KHM
Sbjct: 636 KHM 638

 Score =  109 bits (273), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 105/206 (50%), Gaps = 36/206 (17%)

Query: 1   MSTTTAKRPLELDPNSRL-QFAQSKEQQQELERYSTEDAGSRKKQEVSGTSNAAATTNMT 59
           MS +TAKR L+L  +  L +F  SK   +E+E   T + G+R   +          T+  
Sbjct: 1   MSVSTAKRSLDLVSSGSLAEFDDSKPHHEEIENEHTSN-GTRDNDDNEQPKRKGTKTSK- 58

Query: 60  KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLI 119
           K+ LD E K KRTAQNRAAQRAF              V +L  IQ+QNE+E+ FLR QL+
Sbjct: 59  KQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLV 118

Query: 120 TLVNELKKYRDPNPNESKVLEYLSQH-----------NGNNK------------------ 150
           TLVNELKKYR    N+SKVLEYL++            N NN                   
Sbjct: 119 TLVNELKKYRPETRNDSKVLEYLAKRDPNLHSSSIKANHNNSRPIITPNDEIQENVKQKM 178

Query: 151 DFTFQFP----ETSNLNKKVTIPSPD 172
           +FTFQ+P       N NK+  +PSP+
Sbjct: 179 NFTFQYPLDNDSDENKNKERQLPSPN 204

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/38 (57%), Positives = 29/38 (76%)

Query: 276 DPNLITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313
           D NL +N+F+  ++FDEQVS+FC KMN  CGTR  P+P
Sbjct: 279 DSNLFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIP 316

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score =  128 bits (322), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 52/63 (82%), Positives = 59/63 (93%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           +VPS++G LLRCSEIWDRI+ HPKYSD+D+DGLCSELM KAKCSERGVV+NAEDVQLAL 
Sbjct: 582 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 641

Query: 584 KHM 586
           KHM
Sbjct: 642 KHM 644

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 61/89 (68%)

Query: 60  KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLI 119
           K+ LD E K KRTAQNRAAQRAF              V++L  IQ++NE+E+ FLR QL+
Sbjct: 59  KQDLDPETKLKRTAQNRAAQRAFRERKERKMKELEKKVHSLESIQQENEVEATFLRDQLV 118

Query: 120 TLVNELKKYRDPNPNESKVLEYLSQHNGN 148
           TLV+ELKKYR    N+SKVLEYL++ + N
Sbjct: 119 TLVSELKKYRPETRNDSKVLEYLARRDPN 147

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (78%)

Query: 276 DPNLITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313
           D N+ +N+F+  ++FDEQVS+FC KMN ACGT+  P+P
Sbjct: 284 DSNMFSNDFNFENQFDEQVSEFCSKMNQACGTKQCPIP 321

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score =  128 bits (321), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 52/63 (82%), Positives = 59/63 (93%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           +VPS++G LLRCSEIWDRI+ HPKYSD+D+DGLCSELM KAKCSERGVV+NAEDVQLAL 
Sbjct: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661

Query: 584 KHM 586
           KHM
Sbjct: 662 KHM 664

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 82/149 (55%), Gaps = 3/149 (2%)

Query: 1   MSTTTAKRPLEL-DPNSRLQFAQSKEQQQELERYSTEDAGSRKKQEVSGTSNAAATTNMT 59
           MS +TAKR L+L  P S  +F  S     E+E     D  S +  + +       T    
Sbjct: 1   MSVSTAKRSLDLASPGSLAEFDDSAAHHDEIENEHRHD--STRDDDDNEQPKKKGTKISK 58

Query: 60  KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLI 119
           K+ LD E K KRTAQNRAAQRAF              V  L  IQ+QNE+E+ FLR QL+
Sbjct: 59  KQDLDPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQGLENIQQQNEVEATFLRDQLV 118

Query: 120 TLVNELKKYRDPNPNESKVLEYLSQHNGN 148
           TLVNELKKYR    N+SKVLEYL+  + N
Sbjct: 119 TLVNELKKYRPETRNDSKVLEYLASRDPN 147

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/38 (57%), Positives = 29/38 (76%)

Query: 276 DPNLITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313
           D N+ +NNF+  ++FDEQVS+FC KMN  CGTR  P+P
Sbjct: 276 DSNMFSNNFNFENQFDEQVSEFCSKMNQVCGTRQCPIP 313

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score =  127 bits (320), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 52/63 (82%), Positives = 59/63 (93%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           +VPS++G LLRCSEIWDRI+ HPKYSD+D+DGLCSELM KAKCSERGVV+NAEDVQLAL 
Sbjct: 587 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 646

Query: 584 KHM 586
           KHM
Sbjct: 647 KHM 649

 Score =  105 bits (263), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 68/149 (45%), Positives = 87/149 (58%), Gaps = 3/149 (2%)

Query: 1   MSTTTAKRPLEL-DPNSRLQFAQSKEQQQELERYSTEDAGSRKKQEVSGTSNAAATTNMT 59
           MS +TAKR L++  P S  +F  SK +  E+E       G+R  ++ S       +    
Sbjct: 1   MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRR-TGTRDGED-SEQPKKKGSKTSK 58

Query: 60  KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLI 119
           K+ LD E K KRTAQNRAAQRAF              V +L  IQ+QNE+E+ FLR QLI
Sbjct: 59  KQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLI 118

Query: 120 TLVNELKKYRDPNPNESKVLEYLSQHNGN 148
           TLVNELKKYR    N+SKVLEYL++ + N
Sbjct: 119 TLVNELKKYRPETRNDSKVLEYLARRDPN 147

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%)

Query: 276 DPNLITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313
           D N+ +N+F+  ++FDEQVS+FC KMN  CGTR  P+P
Sbjct: 281 DSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIP 318

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score =  123 bits (309), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 51/64 (79%), Positives = 59/64 (92%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           +VPS+D  LLRCSE+WDRI+AHPKYSD+DIDGLC ELM KAKCSE+GVVVNAEDVQ AL+
Sbjct: 418 VVPSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALS 477

Query: 584 KHMS 587
           KH+S
Sbjct: 478 KHLS 481

 Score =  107 bits (266), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 66/135 (48%), Positives = 78/135 (57%), Gaps = 19/135 (14%)

Query: 59  TKKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQL 118
           ++ +LD EAK KRTAQNRAAQRAF              V++L+ IQKQNEIESEFLR QL
Sbjct: 38  SRTELDQEAKLKRTAQNRAAQRAFRERKERKMKELEAKVDHLSNIQKQNEIESEFLRSQL 97

Query: 119 ITLVNELKKYRDPNPNESKVLEYLSQH-NGN-------NKDFTFQFPETSN--------- 161
           ITLV ELKKYR    N+S+VL YL++H NGN         +F+F FP   N         
Sbjct: 98  ITLVKELKKYRPETANDSQVLNYLAKHENGNFNENLSKKSNFSFAFPWDDNNATTDKSDN 157

Query: 162 --LNKKVTIPSPDGS 174
                   IPSPD S
Sbjct: 158 LNTTTNNNIPSPDNS 172

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%)

Query: 274 LDDPNLITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313
           + D  LI+N F+  D+FDE+V+DFC KMN  CGTR +P+P
Sbjct: 255 MTDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIP 294

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score =  123 bits (308), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 87/173 (50%), Gaps = 40/173 (23%)

Query: 417 LPFINSSLAFPTDDIFXXXXXXXXXXXXXXGPLFN---ESSSLLSDFIRNEXXXXXXXXX 473
           LPFI+ ++AFPTDD                G  F    + +SL ++ +            
Sbjct: 329 LPFIDPTMAFPTDD--------------DEGLFFRTHRDENSLFAELL------------ 362

Query: 474 XXXXXXXXXLINKNLINQEISNPVLXXXXXXXXXXXXXXXXXXXXXXXXFIVPSRDGGLL 533
                     +N+NLIN+E S                             +VPSRDG LL
Sbjct: 363 DEVEPTDNNFVNENLINEEPSTTTAVAEETRPKPKTETD-----------VVPSRDGKLL 411

Query: 534 RCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALTKHM 586
           +CSE+WDRI+ HPKYS +DIDGLC ELMTKAKCSE+GVVV AEDVQ  L KHM
Sbjct: 412 KCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 69/128 (53%), Gaps = 13/128 (10%)

Query: 43  KQEVSGTSNAAATTNMTKKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTK 102
           +Q  S  + AA  +   +K LD E KNKRTAQNRAAQRAF              V +L +
Sbjct: 34  EQSSSPMAPAAKGSKPGRKPLDEETKNKRTAQNRAAQRAFRERKEKKMKELEDKVQSLEQ 93

Query: 103 IQKQNEIESEFLRGQLITLVNELKKYRDPNPNESKVLEYLSQHNGNNK------------ 150
             +   +ESEFLR QL+TLVNELKKYR    N+ +VL+YL++H                 
Sbjct: 94  ANRDTVVESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERTEPTDKEIEQSVQKK 153

Query: 151 -DFTFQFP 157
            DFTF FP
Sbjct: 154 MDFTFAFP 161

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (73%), Gaps = 1/38 (2%)

Query: 276 DPNLITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313
           DP L +N F+  D+FDEQVS FC KMN ACGTR  P+P
Sbjct: 242 DP-LFSNEFNFDDQFDEQVSQFCTKMNKACGTRECPIP 278

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score =  122 bits (305), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 51/64 (79%), Positives = 60/64 (93%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           +VPS+DG LL+CSEIWDRI+AHPKYSDLDIDGLC ELMTKAKCSERGVVVNA+DV+ AL 
Sbjct: 419 VVPSKDGKLLKCSEIWDRITAHPKYSDLDIDGLCGELMTKAKCSERGVVVNADDVKDALN 478

Query: 584 KHMS 587
           +H++
Sbjct: 479 RHIA 482

 Score =  114 bits (284), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 90/172 (52%), Gaps = 25/172 (14%)

Query: 37  DAGSRKKQEV--SGTSNAAATTNMTKKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXX 94
           D G  +  EV  SG       T+   K LD EA+ KRT QNRAAQRAF            
Sbjct: 17  DRGRDRDLEVVDSGAEPLKKRTHTASKPLDKEARMKRTEQNRAAQRAFRERKERKMKELE 76

Query: 95  XXVNNLTKIQKQNEIESEFLRGQLITLVNELKKYRDPNPNESKVLEYLSQHNG------- 147
             V+ LT+IQKQNE+ESEFLRGQL+TLV+ELKKYR    N+SKVLEYL++H+        
Sbjct: 77  AKVDKLTRIQKQNEVESEFLRGQLVTLVHELKKYRPETSNDSKVLEYLAKHDNVPPNQQG 136

Query: 148 ------NNKDFTFQFP----------ETSNLNKKVTIPSPDGSFERQQQKKP 183
                 +  DF+F+FP           ++        PSP     + QQ KP
Sbjct: 137 QAPAARDRGDFSFEFPWKGRTAPEFDNSTTQETTTATPSPVSPGTKDQQGKP 188

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%)

Query: 275 DDPNLITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313
           DD   ++N      +FDEQVSDFC +MN ACG++ +PVP
Sbjct: 224 DDSLTVSNEITFDTQFDEQVSDFCVRMNEACGSKTNPVP 262

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score =  122 bits (307), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (90%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           +VPSRDG LL+C EIWDRI++HPKYSDLDIDGLC EL TKAKCSE+GVVVNA+DVQ AL 
Sbjct: 504 VVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALA 563

Query: 584 KHMS 587
           KHMS
Sbjct: 564 KHMS 567

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 61/92 (66%)

Query: 60  KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLI 119
           +K L  EAKNKRTAQNRAAQRAF              V +L  +++QNE+E+EFLR QL+
Sbjct: 51  RKPLGTEAKNKRTAQNRAAQRAFRERKERKMKELEDKVTHLETVREQNEVETEFLRSQLM 110

Query: 120 TLVNELKKYRDPNPNESKVLEYLSQHNGNNKD 151
           TL++ELKKYR     +++VLEYL++     KD
Sbjct: 111 TLISELKKYRPEQSMDTQVLEYLAKREEEKKD 142

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/34 (67%), Positives = 26/34 (76%)

Query: 280 ITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313
           ITN+FD    FDEQVS+FC +MN ACGTR  PVP
Sbjct: 264 ITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVP 297

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score =  121 bits (303), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 51/64 (79%), Positives = 59/64 (92%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           +VP+RDG LL+CSEIWDRI+AHPKYSD+DIDGLC EL TKAKCSE+GVVVN++DVQ AL 
Sbjct: 506 VVPARDGLLLKCSEIWDRITAHPKYSDIDIDGLCMELRTKAKCSEKGVVVNSDDVQSALA 565

Query: 584 KHMS 587
           KHMS
Sbjct: 566 KHMS 569

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/85 (50%), Positives = 58/85 (68%)

Query: 60  KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLI 119
           +K LD EAKNKRTAQNRAAQRAF              V  L K+++Q+E+ESEFLR QL 
Sbjct: 27  RKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLEKVREQSEMESEFLRSQLQ 86

Query: 120 TLVNELKKYRDPNPNESKVLEYLSQ 144
            L+ E++KYR    ++S+VL+YL++
Sbjct: 87  MLIAEIQKYRPQQSSDSQVLKYLAE 111

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (67%)

Query: 283 NFDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313
           +FD    FDEQVS FC +MN  CGTR  P+P
Sbjct: 268 DFDFNTHFDEQVSVFCTQMNEVCGTRECPLP 298

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score =  120 bits (302), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 59/64 (92%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           +VP+RDG LL+CSE+WDRI++HPKYSD+DIDGLC EL TKAKCSE+GVVVN +DVQ ALT
Sbjct: 521 VVPARDGTLLKCSEVWDRITSHPKYSDIDIDGLCLELRTKAKCSEKGVVVNIDDVQRALT 580

Query: 584 KHMS 587
           KHMS
Sbjct: 581 KHMS 584

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%)

Query: 60  KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLI 119
           +K LD EAKNKRTAQNRAAQRAF              V  L ++++Q+E+ESEFLR QL 
Sbjct: 27  RKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLERVREQSELESEFLRSQLQ 86

Query: 120 TLVNELKKYRDPNPNESKVLEYLSQ 144
            L+ E++KYR    ++S+VL +L++
Sbjct: 87  KLLAEIQKYRPRQSSDSQVLNFLAK 111

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 53/148 (35%), Gaps = 13/148 (8%)

Query: 284 FDVTDKFDEQVSDFCGKMNMACGTRYDPV-PXXXXXXXXXXXXXXXXXXXXXXXXXIANQ 342
           FD    FDEQVS+FC +MN  CGTR  PV P                           +Q
Sbjct: 281 FDFNSHFDEQVSEFCTRMNEVCGTRECPVAPALPPSTAMAHTTPSSAQPQPDSLTRRPSQ 340

Query: 343 SXXXXXXXXXXXXXXXXXDFNSPLDSPQQQNQAFGQ-LGMPNSPQFLSAFELPTENXXXX 401
                               +S  D+PQ  +  FG  L  P +    + F   TE     
Sbjct: 341 ELSEKHLQNQLSPQAA----SSVWDTPQFGHSGFGSDLEDPTNRWMFAGFNAATEG---- 392

Query: 402 XXXXXXXXXXXXXXTLPFINSSLAFPTD 429
                         +LPFI++S+AFPTD
Sbjct: 393 ---GVIRTTSATADSLPFIDTSMAFPTD 417

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score =  118 bits (296), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (88%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           I+PS DG LL+CSE+WDRI+AHP+YSDLDIDGLC EL TKAKCSE+GVVVNAEDVQ AL 
Sbjct: 520 IIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALI 579

Query: 584 KHM 586
            HM
Sbjct: 580 SHM 582

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 75/147 (51%), Gaps = 16/147 (10%)

Query: 1   MSTTTAKRPLELDPNSRLQFAQSKEQQQELERYSTEDAGSRKKQEVSGTSNAAATTNMTK 60
           MST+TAKRP +   N R                S     S++++   G           +
Sbjct: 1   MSTSTAKRPFD---NKRAGSPDDGTDSDSGGNNSGSSPASKRRERKPG-----------R 46

Query: 61  KQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLIT 120
           K L+ EAK+KRTAQNRAAQRAF              V+ L  + KQ+E+E++FLR Q+  
Sbjct: 47  KPLETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVSQLESLNKQSELETKFLRNQVTN 106

Query: 121 LVNELKKYRD--PNPNESKVLEYLSQH 145
           L++ELK+Y    P   +S +L+YL++ 
Sbjct: 107 LLSELKRYNPELPKKRDSILLDYLAKQ 133

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 26/34 (76%)

Query: 280 ITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313
           +T+ FD   +FDE VS FC K++MACGT+ +P+P
Sbjct: 247 VTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIP 280

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score =  114 bits (285), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 54/63 (85%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           +VPS DG LL+CSE+WDRI++HPKYSD+DIDGLC ELM KAKCSERGVVV AEDVQ AL 
Sbjct: 516 VVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYALN 575

Query: 584 KHM 586
             +
Sbjct: 576 NRV 578

 Score =  101 bits (252), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 89/155 (57%), Gaps = 19/155 (12%)

Query: 1   MSTTTAKRPLELDPNSRLQFAQSKEQQQELERYSTEDAGSRKKQEVSGTSNAAATTNMTK 60
           MSTT+AKRPLE  P   L FA+      E +   T D   RKK    G           +
Sbjct: 1   MSTTSAKRPLE--PTVSLDFAED-----EADDSPTSDE-PRKKGGKPG-----------R 41

Query: 61  KQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLIT 120
           K LD EAK+KRTAQNRAAQRAF              V+ L ++ +Q+ +E+EFLR QL+T
Sbjct: 42  KPLDSEAKSKRTAQNRAAQRAFRERKEKKMKELEDKVHALEELNQQSLVETEFLRSQLVT 101

Query: 121 LVNELKKYRDPNPNESKVLEYLSQHNGNNKDFTFQ 155
           LV ELK+YR  NPN+S+VL+YL++   +  D + Q
Sbjct: 102 LVTELKRYRPENPNDSQVLQYLAKTENSKSDDSSQ 136

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 280 ITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313
            +N F+  DKFDEQVS+FC K+   CGT+  P+P
Sbjct: 310 FSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIP 343

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score =  108 bits (269), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 46/66 (69%), Positives = 56/66 (84%), Gaps = 2/66 (3%)

Query: 524 IVPSRDGG--LLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLA 581
           I+   D G   ++CSE+WDRI++HPKYSDLDIDGLC+ELM KAKCSE+GVVV A+DVQ A
Sbjct: 543 IIREEDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKA 602

Query: 582 LTKHMS 587
           LTKH+S
Sbjct: 603 LTKHLS 608

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 63/108 (58%), Gaps = 1/108 (0%)

Query: 39  GSRKKQEVSGTSNAAATTNMTKKQL-DIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXV 97
            S   +  S T      +N   ++L D EAK+KRTAQNRAAQRAF              V
Sbjct: 20  ASDANETASATKETKKKSNKVGRKLSDQEAKSKRTAQNRAAQRAFRERRERKMQELEDKV 79

Query: 98  NNLTKIQKQNEIESEFLRGQLITLVNELKKYRDPNPNESKVLEYLSQH 145
            +L ++ K++EIES+FLR QL  L+ EL++YR    N++KV EYLS H
Sbjct: 80  KSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKVKEYLSTH 127

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score =  102 bits (254), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           +VPS D  L+RCSEIWDRI+ +P+Y+DLDIDGLC ELM  AKCS++GVVV ++DV   L 
Sbjct: 412 VVPSTDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLA 471

Query: 584 KHMS 587
           KHM+
Sbjct: 472 KHMA 475

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 64/102 (62%)

Query: 51  NAAATTNMTKKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIE 110
           N + +  + K  +D EA+ +RTAQNRAAQRAF              VN+L  I ++NE+E
Sbjct: 27  NLSTSNKIRKNDIDAEARIRRTAQNRAAQRAFRERKEKKMKELENKVNSLENIHQKNEVE 86

Query: 111 SEFLRGQLITLVNELKKYRDPNPNESKVLEYLSQHNGNNKDF 152
           +EFLR Q++TLVNELKKYR    ++SK+L+ +S    N +D 
Sbjct: 87  TEFLRSQVLTLVNELKKYRSETTSDSKILKLVSNSRENTRDL 128

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 276 DPNLITNNFDVTDKFDEQVSDFCGKMN 302
           D  L +N+F+  ++FDEQVS FC KMN
Sbjct: 183 DSGLFSNDFNFNNQFDEQVSTFCAKMN 209

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 54/64 (84%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           ++ + DG  L+CS++W R++ HPKYS+LDIDGLC+ELM +AKCSE+GVVV + DVQ AL+
Sbjct: 496 VIRAEDGSYLKCSQVWSRLTEHPKYSELDIDGLCTELMLQAKCSEKGVVVESRDVQKALS 555

Query: 584 KHMS 587
           K++S
Sbjct: 556 KYLS 559

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 8/93 (8%)

Query: 64  DIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLITLVN 123
           D + K+KRT QNR AQRAF              V  L ++ +  E+E+ FLR +L ++ +
Sbjct: 37  DSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVLALEQVNEAKELETNFLRSRLKSMAD 96

Query: 124 ELKKYRDPNPNESKVLEYLSQ--------HNGN 148
           ELKKYR    ++ +VLEYL++        HN N
Sbjct: 97  ELKKYRPAQSSDLEVLEYLAKKEQLAKYNHNAN 129

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 276 DPNLITNNFDVTDKFDEQVSDFCGKMN 302
           D +L +N+F+  DKF +QVS FC K+N
Sbjct: 292 DSSLFSNDFNFDDKFSDQVSSFCDKVN 318

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score = 97.8 bits (242), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (80%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583
           IVP  DG LL C EIWDRI+ +P+YSD+DIDGLC ELM  AKCS++GV+V+++DVQ  L+
Sbjct: 443 IVPLTDGRLLECGEIWDRITTYPRYSDIDIDGLCEELMASAKCSDKGVLVSSDDVQKVLS 502

Query: 584 KHM 586
           + +
Sbjct: 503 RRL 505

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 45/74 (60%)

Query: 56  TNMTKKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLR 115
           T   K+Q + + + KR AQNRAAQ+AF              V  L  I ++NEIE+ FLR
Sbjct: 7   TGKDKEQNNADYRMKRIAQNRAAQKAFRERKEKKMKELQEKVRKLENINEKNEIETVFLR 66

Query: 116 GQLITLVNELKKYR 129
            QL++LVNELKKYR
Sbjct: 67  TQLLSLVNELKKYR 80

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%)

Query: 276 DPNLITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPV 312
           D NL +  FD  ++FDEQVS FC KMN     R + +
Sbjct: 260 DSNLFSTEFDFANEFDEQVSTFCAKMNKTFENRKEMI 296

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 79.3 bits (194), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 55/84 (65%)

Query: 60  KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLI 119
           +K LD  AKN+RTAQNRAAQRAF              +++L +I+  NE+ES FLR  ++
Sbjct: 26  RKPLDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKISDLERIKDNNEVESTFLRDYMM 85

Query: 120 TLVNELKKYRDPNPNESKVLEYLS 143
            L+ +++KYR  N  +SKVL+YLS
Sbjct: 86  DLICDMQKYRPNNSTDSKVLKYLS 109

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 7/67 (10%)

Query: 527 SRDGGLL-----RCSEIWDRISAH-PKYSDLDIDGLCSELMTKAKCSERG-VVVNAEDVQ 579
           S DGG+      +CS IW R     PK+SD DID LC EL+TKAKCS+ G +V+ + DV+
Sbjct: 409 SIDGGMACNKYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVK 468

Query: 580 LALTKHM 586
             L KH 
Sbjct: 469 NTLRKHF 475

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 47/59 (79%), Gaps = 1/59 (1%)

Query: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLAL 582
           +VP+ D  +L C++IWDRI+A PKY+  DI+ LC+ELM+KAKCS++GVVV++ DV   L
Sbjct: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKCSDKGVVVSSLDVDKVL 586

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 52/101 (51%), Gaps = 5/101 (4%)

Query: 50  SNAAATTNMTKKQLD--IEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQN 107
           SN  ATT  +K Q D   E K+KRTAQNRAAQRAF              V  L K+ + +
Sbjct: 13  SNGTATTTTSKVQKDSNAELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVVELEKVCRAH 72

Query: 108 EIESEFLRGQLITLVNELKKYRDPN---PNESKVLEYLSQH 145
           E E+ FLR QLI    EL+K  +      N + +  Y ++H
Sbjct: 73  ESETSFLRSQLILFGTELRKQHNTGNTPSNNNSISNYRNRH 113

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 18/23 (78%)

Query: 284 FDVTDKFDEQVSDFCGKMNMACG 306
           F+  ++FDEQ+S FC K+N ACG
Sbjct: 356 FNFDNQFDEQISKFCLKLNSACG 378

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 53/98 (54%), Gaps = 11/98 (11%)

Query: 36  EDAGSRKKQEVSGTSNAAATTNMTKKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXX 95
           E  GSR+K    G           +K LD EAKN+RTAQNRAAQRAF             
Sbjct: 34  EGGGSRRKGNKPG-----------RKPLDTEAKNRRTAQNRAAQRAFRERKERKMKDLED 82

Query: 96  XVNNLTKIQKQNEIESEFLRGQLITLVNELKKYRDPNP 133
            V  L + + Q+E E + LR Q+++L+ ELKKYR  +P
Sbjct: 83  KVRKLEEQRLQSEREVQSLRNQVVSLLRELKKYRPGSP 120

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 41/70 (58%)

Query: 60  KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLI 119
           +K LD EAKN+RTAQNRAAQRAF              V  L + +   E E + LRG +I
Sbjct: 31  RKPLDTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVRRLEEERSSAECEVQSLRGHVI 90

Query: 120 TLVNELKKYR 129
            LV EL+++R
Sbjct: 91  ALVRELRRWR 100

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 9/61 (14%)

Query: 534 RCSEIWDRIS--------AHPKYSDLDIDGLCSELMTKAKCSERG-VVVNAEDVQLALTK 584
           +CS+IW+RI+        + P++ D DID LC+ELMTKA+CS  G +V+   D++ +L K
Sbjct: 458 KCSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMTKARCSTNGSIVIKTGDIKQSLMK 517

Query: 585 H 585
           H
Sbjct: 518 H 518

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 35/50 (70%)

Query: 97  VNNLTKIQKQNEIESEFLRGQLITLVNELKKYRDPNPNESKVLEYLSQHN 146
           +++L KI+ +N IE+ FLR  +  L+NE+ K+R  N  +SK+L+YLS  N
Sbjct: 8   ISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTDSKILKYLSMRN 57

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 531 GLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERG-VVVNAEDVQLALTKHM 586
           G   C  I + IS+ PKYS LDID LCSEL+ KAKC++   +VV A D+Q AL + +
Sbjct: 352 GKASCYHILEEISSLPKYSSLDIDDLCSELIIKAKCTDDCKIVVKARDLQSALVRQL 408

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 50/83 (60%)

Query: 60  KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLI 119
           +K++D EAK++RTAQNRAAQRAF              V  L +   QN+  ++FL   L 
Sbjct: 38  RKRIDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVELLEQKDAQNKTTTDFLLCSLK 97

Query: 120 TLVNELKKYRDPNPNESKVLEYL 142
           +L++E+ KYR  N ++ ++L +L
Sbjct: 98  SLLSEITKYRAKNSDDERILAFL 120

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 50/103 (48%), Gaps = 5/103 (4%)

Query: 49  TSNAAATTNMT-----KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKI 103
           T+ AAA T        +++LD+EAKNKRT QNR AQRA+              +  L ++
Sbjct: 4   TTGAAAETAKKVGRPGRRKLDVEAKNKRTQQNRVAQRAYRERKEAKLRTLEHKIAALERL 63

Query: 104 QKQNEIESEFLRGQLITLVNELKKYRDPNPNESKVLEYLSQHN 146
              NE  +E +   L  L+ E  K+R   P +  V E L+  +
Sbjct: 64  NSYNEDRAELMAAHLRDLLGEANKFRGEKPRDKTVRELLTARD 106

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 523 FIVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAK--CSERGVVVNAEDVQL 580
            I   R G    C+ +   ++  P Y + D++ LC ELM K K    +  + V  EDV+ 
Sbjct: 317 IIAEKRCGSNDTCAHVIRTLTQSPHYQENDLEDLCQELMVKCKFDTHDASITVGREDVRS 376

Query: 581 ALTKHMS 587
           AL +H++
Sbjct: 377 ALERHIA 383

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 46/85 (54%)

Query: 60  KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLI 119
           +K +D EAKNKRTAQNRAAQRAF              +  L  +  +   E+E+L+  L 
Sbjct: 14  RKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLS 73

Query: 120 TLVNELKKYRDPNPNESKVLEYLSQ 144
            L+ E+ KYR  N  +  +L+ L +
Sbjct: 74  ELLTEVTKYRPANEKDQGILKRLKE 98

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 10/66 (15%)

Query: 532 LLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERG----------VVVNAEDVQLA 581
           +LRC +I   +     Y  LD + LC+ELM KAK S+ G          VV+ A D+Q  
Sbjct: 420 VLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRT 479

Query: 582 LTKHMS 587
           L KH+S
Sbjct: 480 LAKHIS 485

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 56/106 (52%), Gaps = 7/106 (6%)

Query: 60  KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIES---EFLRG 116
           +K+LD +AKNKRT QNR AQRAF               N + K+Q +N  ++   EFL+ 
Sbjct: 14  RKKLDADAKNKRTQQNRMAQRAFRERKEAKLKLLE---NEVDKLQLENLSKAEIIEFLKQ 70

Query: 117 QLITLVNELKKYRDPNPNESKVLEYLSQHNGNNKDF-TFQFPETSN 161
            ++TL+ E+K YR     + K+L+ + +   +  D  T Q    SN
Sbjct: 71  NVMTLLGEIKNYRKQTNKDKKLLDTIGKLENDGMDATTLQHSPVSN 116

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 535 CSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERG-VVVNAEDVQLALTKHM 586
           C  I   IS+ PKYS LDID LC ELMTKA+ ++   +VV A D+Q  L K +
Sbjct: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 50/83 (60%)

Query: 60  KKQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLI 119
           +K++D EAKN+RTAQNRAAQRAF              +  L +   QN+   +FL+  L 
Sbjct: 22  RKRVDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIELLEQKDAQNKSVIDFLQSSLK 81

Query: 120 TLVNELKKYRDPNPNESKVLEYL 142
           +L++E+ KYR  N N+ ++L +L
Sbjct: 82  SLLSEVTKYRAKNVNDERILAFL 104

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 535 CSEIWDRISAHPKYSDLDIDGLCSELMTKAKCS-ERGVVVNAEDVQLALTKHM 586
           CS I   IS+ PK+S LDID LC ELM KAKCS +  ++V A  +Q  L + +
Sbjct: 329 CSHILRHISSIPKHSSLDIDNLCCELMVKAKCSGDCQIMVQAHGLQSVLARQL 381

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%)

Query: 61  KQLDIEAKNKRTAQNRAAQRAFXXXXXXXXXXXXXXVNNLTKIQKQNEIESEFLRGQLIT 120
           +++ +EAKN+RTAQNRAAQ+AF                 L     Q+++ +++L+G L +
Sbjct: 6   RKIAVEAKNERTAQNRAAQQAFRNRKEDKWKQLEEKTELLESRDAQSKVATDYLQGSLRS 65

Query: 121 LVNE 124
           L+ E
Sbjct: 66  LLLE 69

>YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}
           ARR1Transcriptional activator of the basic leucine
           zipper (bZIP) family, required for transcription of
           genes involved in resistance to arsenic compounds
          Length = 294

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 530 GG--LLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVN 574
           GG  LL   +IW  +  HPK +  D++ L +EL   A CS   ++++
Sbjct: 236 GGDVLLSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILIS 282

>ZYRO0B01100g Chr2 (92729..93499) [771 bp, 256 aa] {ON} some
          similarities with uniprot|P38749 Saccharomyces
          cerevisiae YHL009C YAP3 bZIP transcription factor
          Length = 256

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 4/46 (8%)

Query: 37 DAGSRKKQEVSGTSNAAATTNMTKKQLDIEAKNKRTAQNRAAQRAF 82
          D  +  K +V+ +SN  ++  +T+++L    K  + AQNRAAQRAF
Sbjct: 53 DNATAAKSDVTVSSNGNSSGELTEEKL----KQIKRAQNRAAQRAF 94

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,413,598
Number of extensions: 1440436
Number of successful extensions: 5290
Number of sequences better than 10.0: 54
Number of HSP's gapped: 5450
Number of HSP's successfully gapped: 101
Length of query: 587
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 472
Effective length of database: 40,294,809
Effective search space: 19019149848
Effective search space used: 19019149848
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)