Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H022705.475ON69669636160.0
Smik_15.3185.475ON67268413621e-179
Kpol_543.95.475ON64268312781e-167
Skud_15.3025.475ON67853312581e-164
Suva_8.1905.475ON66651812451e-162
YOR138C (RUP1)5.475ON67152812321e-160
TPHA0J027805.475ON63168512021e-156
KAFR0E025405.475ON65952311451e-147
NDAI0C013905.475ON70972111191e-143
TDEL0A033905.475ON62251111071e-142
SAKL0G03564g5.475ON60551110641e-136
TBLA0A025405.475ON6787159331e-115
TBLA0B022305.475ON7907169351e-114
KNAG0B040505.475ON6737079201e-114
Kwal_55.212675.475ON6045129041e-112
KLTH0F15004g5.475ON5975068461e-103
CAGL0I07205g5.475ON6037138042e-97
ZYRO0D11264g5.475ON5475047224e-86
KLLA0E03169g5.475ON5445245616e-63
NDAI0C058908.185ON46234940.011
Smik_5.3088.185ON42835930.014
Skud_5.2808.185ON42835850.12
YER143W (DDI1)8.185ON42835840.14
NCAS0A039208.185ON47233800.46
KLLA0E10341g8.185ON41433800.49
Kpol_526.238.185ON42334780.80
Suva_5.2718.185ON42835771.00
Skud_7.2404.66ON31877771.0
KAFR0B023008.185ON41635761.5
Skud_5.531.480ON39789752.0
ZYRO0C02090g3.69ON33830742.1
CAGL0I06787g8.185ON42635724.0
YGL044C (RNA15)4.66ON29673724.2
Smik_5.561.480ON39792724.5
Smik_7.2394.66ON29973714.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H02270
         (696 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {O...  1397   0.0  
Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {...   529   e-179
Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...   496   e-167
Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {...   489   e-164
Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON...   484   e-162
YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON} ...   479   e-160
TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {...   467   e-156
KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.4...   445   e-147
NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.4...   435   e-143
TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {O...   431   e-142
SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {...   414   e-136
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...   363   e-115
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...   364   e-114
KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.4...   358   e-114
Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138...   352   e-112
KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weak...   330   e-103
CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} simila...   314   2e-97
ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {...   282   4e-86
KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {...   220   6e-63
NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON} Anc_8...    41   0.011
Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W ...    40   0.014
Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W ...    37   0.12 
YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA da...    37   0.14 
NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {O...    35   0.46 
KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {...    35   0.49 
Kpol_526.23 s526 (62128..63399) [1272 bp, 423 aa] {ON} (62128..6...    35   0.80 
Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W ...    34   1.00 
Skud_7.240 Chr7 complement(418142..419098) [957 bp, 318 aa] {ON}...    34   1.0  
KAFR0B02300 Chr2 (451471..452721) [1251 bp, 416 aa] {ON} Anc_8.1...    34   1.5  
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    33   2.0  
ZYRO0C02090g Chr3 complement(165011..166027) [1017 bp, 338 aa] {...    33   2.1  
CAGL0I06787g Chr9 complement(658666..659946) [1281 bp, 426 aa] {...    32   4.0  
YGL044C Chr7 complement(416146..417036) [891 bp, 296 aa] {ON}  R...    32   4.2  
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    32   4.5  
Smik_7.239 Chr7 complement(407397..408296) [900 bp, 299 aa] {ON}...    32   4.6  

>NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {ON}
           Anc_5.475 YOR138C
          Length = 696

 Score = 1397 bits (3616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/696 (97%), Positives = 682/696 (97%)

Query: 1   MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQ 60
           MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQ
Sbjct: 1   MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQ 60

Query: 61  DPLPSEQDLANQDYRSSNTPSSVPGSNNPFRESNNYLGDEYVEGQEVQRELIXXXXXXXX 120
           DPLPSEQDLANQDYRSSNTPSSVPGSNNPFRESNNYLGDEYVEGQEVQRELI        
Sbjct: 61  DPLPSEQDLANQDYRSSNTPSSVPGSNNPFRESNNYLGDEYVEGQEVQRELIDVDSSDDE 120

Query: 121 XXXXXXGMDGYRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKGPLKDELD 180
                 GMDGYRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKGPLKDELD
Sbjct: 121 DEDEDDGMDGYRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKGPLKDELD 180

Query: 181 QPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFEMPKFIL 240
           QPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFEMPKFIL
Sbjct: 181 QPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFEMPKFIL 240

Query: 241 EFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLAAINSFSMSE 300
           EFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLAAINSFSMSE
Sbjct: 241 EFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLAAINSFSMSE 300

Query: 301 RAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDESPQDLFIT 360
           RAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDESPQDLFIT
Sbjct: 301 RAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDESPQDLFIT 360

Query: 361 SAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNGEQEEVYNN 420
           SAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNGEQEEVYNN
Sbjct: 361 SAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNGEQEEVYNN 420

Query: 421 SLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHILEKRRQAL 480
           SLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHILEKRRQAL
Sbjct: 421 SLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHILEKRRQAL 480

Query: 481 ARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMGKNLHETITKIEMMIAEKKNS 540
           ARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMGKNLHETITKIEMMIAEKKNS
Sbjct: 481 ARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMGKNLHETITKIEMMIAEKKNS 540

Query: 541 KMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVIISPYLYYIRKKDGIW 600
           KMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVIISPYLYYIRKKDGIW
Sbjct: 541 KMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVIISPYLYYIRKKDGIW 600

Query: 601 YSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCRESIIPDEDTVRKAME 660
           YSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCRESIIPDEDTVRKAME
Sbjct: 601 YSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCRESIIPDEDTVRKAME 660

Query: 661 ENLGCLQFAKQDQLSLEEQSSTVNVTEHPKGENDSD 696
           ENLGCLQFAKQDQLSLEEQSSTVNVTEHPKGENDSD
Sbjct: 661 ENLGCLQFAKQDQLSLEEQSSTVNVTEHPKGENDSD 696

>Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {ON}
           YOR138C (REAL)
          Length = 672

 Score =  529 bits (1362), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 293/684 (42%), Positives = 416/684 (60%), Gaps = 57/684 (8%)

Query: 1   MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQ 60
           M +N+ VK+LLEMGIP EVAV+AL RTGGNLE AV FIFSNELP    +Q  +    N +
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELP----DQGSMSTENNVE 56

Query: 61  DPLPSEQDLANQDYRSSNTPSSVPGSNNPFRESNNYLGDEYVEGQEVQRELIXXXXXXXX 120
            P  SE  +                + N +   NN  G++ V+        +        
Sbjct: 57  LPRISENRIM---------------AGNSYDVPNN--GEQDVD--------MPDVGGVDV 91

Query: 121 XXXXXXGMDGYRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKGPLKDELD 180
                  +   RS S S ++      E  H   +  S+     PP YN+V     K  +D
Sbjct: 92  DYDDDEDITDDRSGSNSTNEYRRAAQEYDHYSVSETSIP----PPSYNIVQHNEFKSTMD 147

Query: 181 QPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFEMPKFIL 240
            PT++LPLPLNS+IE+Y  LFAL   +  P  FLK DF+DLN+  +W+KGTSF  PK+ +
Sbjct: 148 DPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNFRPDWFKGTSFTEPKYRI 207

Query: 241 EFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLAAINSFSMSE 300
            +  ++D +T ++             ++  G SD++   QP LLWQLQKL ++ +  M E
Sbjct: 208 AYREADDGSTTSD------------IVLASGPSDEL---QPHLLWQLQKLISVVNTRMCE 252

Query: 301 RAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDESPQDLFIT 360
           RA+ SA++F+L    Q++S L+ S++L +VLP FIKS+  DL++CP   D E+ ++LFI+
Sbjct: 253 RAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGIRDQET-RNLFIS 311

Query: 361 SAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSE-----NNEDNGEQE 415
           SA H P K++  +ET L+ FHF+PEEY+ NLYKMFNVLLYP++  E          G++E
Sbjct: 312 SALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEEEVIRRGGTGQEE 371

Query: 416 EVY---NNSLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHI 472
           E Y    N+L + A ++T++FNE +  T  +T  +GV++PL FYPQLY K+CKDQLI+HI
Sbjct: 372 ERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQLYTKRCKDQLIRHI 431

Query: 473 LEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMGKNLHETITKIEM 532
           + KR+QA  RS+ LL+EI  LKS++GK+    LES   YLQ+  +         I  ++ 
Sbjct: 432 ISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDDANNEAASQIASLKD 491

Query: 533 MIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVIISPYLYY 592
            +   +++KMEEYK L+S+LH +WNLSHPE  II TAK LGLI+ PY+LT   ISPY Y+
Sbjct: 492 TLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSYF 551

Query: 593 IRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCRESIIPDE 652
           IR ++G+W  +Q NTLGT+F+V++  S + VQE I+  T   +E PLMF++C E  IP E
Sbjct: 552 IRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPTE 611

Query: 653 DTVRKAMEENLGCLQFAKQDQLSL 676
           + V KA++ N GC +FAK DQ SL
Sbjct: 612 EVVEKALDSNNGCSKFAKDDQSSL 635

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
           complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score =  496 bits (1278), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 274/683 (40%), Positives = 415/683 (60%), Gaps = 52/683 (7%)

Query: 3   NNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQDP 62
           N  ++ +L+EMGIPR++A+DAL R  GNLE AV FIFSNELP   +      I+  ++  
Sbjct: 5   NENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEK-- 62

Query: 63  LPSEQDLANQDYRSSNTPSSVPGSNNPFR-ESNNYLGD--EYVEGQEVQRELIXXXXXXX 119
             +  +++N++       + V  +  P + E  NY+ D  E ++      + I       
Sbjct: 63  -ANHVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVD----- 116

Query: 120 XXXXXXXGMDGYRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKGPLKDEL 179
                   MD Y S+S  I                TNS++  ++PP Y +V     K  L
Sbjct: 117 -------NMDYYSSDSDYI----------------TNSVTDNLLPPSYQIVKHSDHKSRL 153

Query: 180 DQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFEMPKFI 239
             PT+ILPLP NSMIENY +L++L     +P   ++ DFKDL++ ++W+KG+SF  PK +
Sbjct: 154 RDPTVILPLPPNSMIENYFALYSLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNV 213

Query: 240 LEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLAAINSFSMS 299
           L+  S  D TT           +  + I PI   ++ +  QP LLWQLQKL++I + +MS
Sbjct: 214 LK--SVTDETT----------SKSTMKICPIEDMNQ-DDDQPELLWQLQKLSSIVNSTMS 260

Query: 300 ERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDESPQDLFI 359
           ERAY  A+IFS++ + Q +  L+++D+L +VLP FIK +  +L+ CP   +DE  + LFI
Sbjct: 261 ERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKYLVVNLESCPGFEEDEI-RKLFI 319

Query: 360 TSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNGEQEEVYN 419
           +SAF+ P   Q+ + T L+ FHF+P+EY+ NLYKMFNVLLYPD+   + E   E E+   
Sbjct: 320 SSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLYPDENDSDYESGDESEQ--G 377

Query: 420 NSLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHILEKRRQA 479
           NSL   + I++++F+EA+  +  ++   GVE+PL F+PQ+Y K CK++LIKHI+ KR+ A
Sbjct: 378 NSLGDISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDA 437

Query: 480 LARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMGKNLHETITKIEMMIAEKKN 539
             +SK++L++I  +KSF+GKDI   + S+ EYL+++      N+ E + KI+  +A  K 
Sbjct: 438 QFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDNK--SDNITEELLKIKNDMAIVKT 495

Query: 540 SKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVIISPYLYYIRKKDGI 599
            KM EY+ L+ +L  +WN+S+PE  I+ET + LGLI EPYLL   ++SPY YYIR++ G 
Sbjct: 496 QKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGEPYLLVMAVLSPYSYYIRERTGK 555

Query: 600 WYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCRESIIPDEDTVRKAM 659
           W  VQC+T G DF V +  S   V++ IK  T   +ETPLMF++CR  +IP+E  +RK+ 
Sbjct: 556 WNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHASETPLMFMYCRRDVIPEEYEIRKSF 615

Query: 660 EENLGCLQFAKQDQLSLEEQSST 682
           E N GCL F K+DQL L + +++
Sbjct: 616 ESNSGCLNFFKEDQLVLNKMNNS 638

>Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {ON}
           YOR138C (REAL)
          Length = 678

 Score =  489 bits (1258), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 245/533 (45%), Positives = 353/533 (66%), Gaps = 28/533 (5%)

Query: 162 MIPPKYNLVAKGPLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDL 221
           + PP YN+V +   K  +D PT++LPLPLNS+IE+Y  LFAL   +  P  FLK DF+DL
Sbjct: 133 IAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDL 192

Query: 222 NYNKNWYKGTSFEMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQP 281
           NY+ +W+KG+SF  PK+ L +  ++D +  +E             ++  G+SD +   QP
Sbjct: 193 NYSPDWFKGSSFTGPKYRLAYREADDGSATSE------------IVLASGSSDDL---QP 237

Query: 282 FLLWQLQKLAAINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTD 341
            LLWQLQKL ++ +  M ERA+ SAR+F+L    Q++S L+ S++L +VLP FIKS+  D
Sbjct: 238 RLLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVD 297

Query: 342 LQLCPSNSDDESPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYP 401
           L++CP   D E+ ++LFI+SA H P K++  +ET L+ FHF+PEEY+ NLYKMFNVLLYP
Sbjct: 298 LEMCPGIRDRET-RNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP 356

Query: 402 DDPSENNEDN-------GEQEEVY---NNSLNKAAHIITVIFNEADAYTPEMTSNSGVEI 451
           ++  EN+E++       G+++E +    N+L + A ++T++FNE +  T  MT  +GV+I
Sbjct: 357 EE--ENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDI 414

Query: 452 PLTFYPQLYFKKCKDQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEY 511
           PL FYPQLY K+CKDQLI+H++ KR+QA  RS+ LL EI  LKS++GK+IS  LES   Y
Sbjct: 415 PLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAY 474

Query: 512 LQKEENPMGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKT 571
           LQ   N         I  ++  +   +++KMEEYK L+S++H +W+LSHPE  II+TAK 
Sbjct: 475 LQASPNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQ 534

Query: 572 LGLIDEPYLLTTVIISPYLYYIRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQT 631
           L LI+ PY+LT   +SPY Y++R ++G+W  VQ N LGT+F++    S + VQE IK  T
Sbjct: 535 LRLIENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGT 594

Query: 632 SRPNETPLMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSLEEQSSTVN 684
              +ETPLMF++C E  IP E+ V KA++ N GC +FAK D+ SL    S  N
Sbjct: 595 KYASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSHFN 647

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/45 (75%), Positives = 39/45 (86%)

Query: 1  MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQ 45
          M +N+ VK+LLEMGIP EVA+DAL RTGGNLE AV FIFSNELP+
Sbjct: 1  MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPE 45

>Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON}
           YOR138C (REAL)
          Length = 666

 Score =  484 bits (1245), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 240/518 (46%), Positives = 344/518 (66%), Gaps = 23/518 (4%)

Query: 164 PPKYNLVAKGPLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNY 223
           PP Y++V     K  +D PT++LPLPLNS+IE+Y  LFAL A +  P  FLK DF+DLNY
Sbjct: 125 PPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQDLNY 184

Query: 224 NKNWYKGTSFEMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFL 283
             +W+KG+SF  P++ L +  S+D +T +E             ++  G S  V   QP L
Sbjct: 185 RPDWFKGSSFAEPRYRLAYRESSDGSTTSE------------IVVASGPSKDV---QPHL 229

Query: 284 LWQLQKLAAINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQ 343
           LWQLQKL ++ +  M ERA+ SA++F+L    Q+++ L+ S++L +VLP FIKS+  DL+
Sbjct: 230 LWQLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLE 289

Query: 344 LCPSNSDDESPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDD 403
           +CP   D E+ ++LFI+SA H P+K++  +ET L+ FHF+PEEY+ NLYKMFNVLLYP++
Sbjct: 290 MCPGIRDRET-RNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEE 348

Query: 404 PSEN-----NEDNGEQEEVYNNSLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQ 458
             E        D   QE    N+L + A ++T++FNE +  T  +T  +GV++PL FYPQ
Sbjct: 349 EEEEGEVVYGGDGAHQEP--ENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQ 406

Query: 459 LYFKKCKDQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENP 518
           LY K+CKDQLI+HI+ KR+QA  +S+ LL EI  LKS++GK+IS  LES   YLQ +   
Sbjct: 407 LYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKD 466

Query: 519 MGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEP 578
                 + I  ++  +   + +KMEEYK L+S+LH +WNLSHPE+ II TAK LGLI+ P
Sbjct: 467 ADNEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENP 526

Query: 579 YLLTTVIISPYLYYIRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETP 638
           Y+L+  ++SPY Y+ R +DG W  +Q NTLGT+F++++  S + VQE I+  T   +E P
Sbjct: 527 YILSMAVLSPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMP 586

Query: 639 LMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSL 676
           LMF++C E  IP +D V KA+E N GC++FAK DQ +L
Sbjct: 587 LMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTL 624

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 1  MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELP-QTEQEQPYIPININD 59
          M +N+ VK+LLEMGIP EVAVDAL RTGGNLE AV FIFSNELP Q    QP I  N   
Sbjct: 1  MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQPRISENRVV 60

Query: 60 QDPLPSEQDLANQDYRSSNTPSSV 83
           D      D+ N   +  + P  V
Sbjct: 61 PDAGAGAYDVPNSGDQDIDMPDVV 84

>YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON}
           RUP1Protein involved in regulation of Rsp5p, which is an
           essential HECT ubiquitin ligase; has a WW domain
           consensus motif of PPPSY (residues 131-135) that
           mediates binding of Rsp5p to Ubp2p; contains an UBA
           domain
          Length = 671

 Score =  479 bits (1232), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 247/528 (46%), Positives = 344/528 (65%), Gaps = 23/528 (4%)

Query: 157 SMSQEMIPP-KYNLVAKGPLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLK 215
           S+S+  IPP  Y++V     K  +  PT++LPLPLNS+IE+Y  LFAL   +  P  FLK
Sbjct: 124 SISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHVFLK 183

Query: 216 TDFKDLNYNKNWYKGTSFEMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDK 275
            DFKDLNY  +W+KG+SF  PK+ L +  + D +T +E                +  S  
Sbjct: 184 PDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEI---------------VLASGP 228

Query: 276 VEKQQPFLLWQLQKLAAINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFI 335
            E  QP LLWQLQKL ++ +    ERA+ SA++F+     Q+RS L+ S++L +VLP FI
Sbjct: 229 NEGLQPHLLWQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFI 288

Query: 336 KSITTDLQLCPSNSDDESPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMF 395
           KS+  DL++CP   D E+ + LFI+SA H P K++  +ET L+ FHF+PEEY+ NLYKMF
Sbjct: 289 KSLAVDLEMCPGIRDRET-RSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMF 347

Query: 396 NVLLYPDDPSENNE--DNGEQEEVY----NNSLNKAAHIITVIFNEADAYTPEMTSNSGV 449
           NVLLYP++  E  +    GEQEE       N+L + A ++T++FNE +  T  ++  +GV
Sbjct: 348 NVLLYPEEEEEEEDVIRGGEQEEARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGV 407

Query: 450 EIPLTFYPQLYFKKCKDQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAK 509
           +IPL FYPQLY K+CKDQLI+HI+ KR+QA  RS+ LL EI +LKS++GK+IS  LES  
Sbjct: 408 DIPLEFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTL 467

Query: 510 EYLQKEENPMGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETA 569
            YLQ   +       + I  ++  +   + +KMEEYK L+S+LH +WNLSHPE  II TA
Sbjct: 468 AYLQTIPDDANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTA 527

Query: 570 KTLGLIDEPYLLTTVIISPYLYYIRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKA 629
           K LGLI+ PY+LT   +SPY Y+IR ++G W  +Q NTLGT+F+V +  S + VQE IK 
Sbjct: 528 KQLGLIENPYILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKH 587

Query: 630 QTSRPNETPLMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSLE 677
            T   +ETPLMF++C E  IP E+ V +A++ N GCL+FA+ DQ SL+
Sbjct: 588 GTKYASETPLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLK 635

>TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {ON}
           Anc_5.475 YOR138C
          Length = 631

 Score =  467 bits (1202), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 276/685 (40%), Positives = 391/685 (57%), Gaps = 73/685 (10%)

Query: 2   ENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQD 61
           +N  +VK++++MGIP +VA+DAL R  G+LE AV FIFSNELP     +           
Sbjct: 3   DNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGES---------- 52

Query: 62  PLPSEQDLANQDYRSSNTPSSVPGSNNPFRESNNYLGDEYVEGQEVQRELIXXXXXXXXX 121
                  + N+ Y +S     V  SN+     NN+   +  E   V              
Sbjct: 53  -------VGNEKYTTS---EHVNISND-----NNFQAGDLSEVMNVSN------------ 85

Query: 122 XXXXXGMDG-YRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKGPLKDELD 180
                G D  + ++S  +S    + PE        N +S  +  P YN+V     K  L 
Sbjct: 86  ----YGYDNRFETDSGDLSSDEVSDPEI-----VENDISNNLKLPAYNIVKHEVEKTSLS 136

Query: 181 QPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFEMPKFIL 240
            PT+++PLP NS+IE+Y  LF++   I +P   LK DFKDLNY+  WY G  F  PKF +
Sbjct: 137 DPTVVMPLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGI 196

Query: 241 EFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLAAINSFSMSE 300
           +          NE + + D +     I P+   D+    QP LLWQLQKL+ I + +MSE
Sbjct: 197 KVH--------NEESLKDDLH---TSIEPLTCVDRDLDDQPKLLWQLQKLSTIMNSTMSE 245

Query: 301 RAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDESPQDLFIT 360
           R+Y S+++FSL  +   +  L  +++L +VLP FIK +T++L++CP    DE   +L I+
Sbjct: 246 RSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRNEL-IS 304

Query: 361 SAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNGEQEEVYNN 420
           SA++LP   +  V+T L  FHF+P+EY  NLYKMFN+LLY DD      ++G+      N
Sbjct: 305 SAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYADD------EDGDGAIDEGN 358

Query: 421 SLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHILEKRRQAL 480
           SLN  A  +T+IF+E D  +       GV IPL FYPQLY K+CKDQLIKHI+ KR+ A 
Sbjct: 359 SLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQ 418

Query: 481 ARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKE---ENPM----GKNLHETITKIEMM 533
             S+Q L ++  LKSF+GKDI   L S  ++L ++   +N +    GK L E +T I+  
Sbjct: 419 KESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGNGK-LMEGLTDIKEQ 477

Query: 534 IAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVIISPYLYYI 593
           + +KK  KM  YK L+ +L+  WNLS+PE+ II TAK LGLIDEPY L+  ++SP LYYI
Sbjct: 478 LTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYYI 537

Query: 594 RKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCRESIIPDED 653
           +K+DG WY VQ    G DF + +  SG  +Q+ ++  T   +ETPLMF++ +E  IPD+D
Sbjct: 538 KKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDDD 597

Query: 654 TVRKAMEENLGCLQFAKQDQLSLEE 678
           +V+K +E N GCLQF K DQ  L E
Sbjct: 598 SVQKILEANTGCLQFLKDDQKLLNE 622

>KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.475
           YOR138C
          Length = 659

 Score =  445 bits (1145), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 241/523 (46%), Positives = 342/523 (65%), Gaps = 29/523 (5%)

Query: 164 PPKYNLVAKGPLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNY 223
           PP+Y+ V     K ++  PTI+LPLP NS+IENYL+L+AL+        FLK DFKDLNY
Sbjct: 154 PPEYSTVQHSERKSDIADPTIVLPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNY 213

Query: 224 NKNWYKGTSFEMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFL 283
            K WY+ +S + P + ++F+ +++T    EN           +I+P     + +  QP L
Sbjct: 214 RKEWYRSSSIDEPFYRVKFNKADET----EN-----------EIVPAAELTETDHPQPKL 258

Query: 284 LWQLQKLAAINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQ 343
           LWQLQKL A+ +  +SERAY SA+IF+   N Q++S L  +++L +VLP FIK++  DL+
Sbjct: 259 LWQLQKLIAVVNSDLSERAYVSAKIFNSSSNQQLQSKLGDAEHLNEVLPYFIKALAVDLE 318

Query: 344 LCPSNSDDESPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDD 403
            C  +   +  + LFI+SAF+ P +++ L ET L+FFHF+PEEY+ NLYKMFNVLL PD 
Sbjct: 319 SCYGDKSSDIKK-LFISSAFYKPSQNEPLQETYLSFFHFLPEEYDTNLYKMFNVLLIPD- 376

Query: 404 PSENNEDNGEQEEVY-NNSLNKAAHIITVIFNEADAYTPE-MTSNS---GVEIPLTFYPQ 458
             E++E++GE +E   +NSLN  +  +T++FNE D  T + MT+++   GV+IP  FYPQ
Sbjct: 377 --EDDEESGESDEDQPDNSLNIISPFLTIVFNEMDESTDDNMTTSASFQGVDIPFEFYPQ 434

Query: 459 LYFKKCKDQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENP 518
           LY KKCKD+LIKHIL KR+++ ++ K +L EI  LKS+ GKDI M L S  ++LQK+ N 
Sbjct: 435 LYTKKCKDELIKHILSKRKESKSKLKVILQEINALKSYHGKDILMFLNSTIDFLQKDSNA 494

Query: 519 MGKN---LHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLI 575
              +   + + +  +   I  +K    +EYK LS +LH +WNLS+P+L II+TAKTLGLI
Sbjct: 495 ESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHNEWNLSYPDLHIIQTAKTLGLI 554

Query: 576 DEPYLLTTVIISPYLYYIRKKDGI--WYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSR 633
           D PYLLTTV+ISPY Y++R +  +  W  VQ N LGTDF ++       V   IK  T  
Sbjct: 555 DTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTDFHITNFLDKENVSTTIKQYTKV 614

Query: 634 PNETPLMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSL 676
           PNE+PLMF++C+E+ I  +D + K +EEN GC  F K DQL L
Sbjct: 615 PNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKADQLHL 657

>NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.475
           YOR138C
          Length = 709

 Score =  435 bits (1119), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 277/721 (38%), Positives = 402/721 (55%), Gaps = 76/721 (10%)

Query: 1   MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININD- 59
           ME+N++V +L+EMGIPREVAV+AL+R  GNLE AVAFIFSNE+P    E   +  N ND 
Sbjct: 1   MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVA-NDNDT 59

Query: 60  --QDP--LPSEQDLANQDYRSSNTPSSVPGSNNPFRESNNYLGDEYVEGQEVQRELIXXX 115
             Q+P  LP   + +  D   +++P+     +   ++  N    +  E QE         
Sbjct: 60  GQQEPSQLPPRSEASGADPYQTHSPTP---EHYYMKDERNAPSSQSYEQQEY------IP 110

Query: 116 XXXXXXXXXXXGMDGYRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKGPL 175
                      G D  R +     Q+N    ES    S+T+S S    PP YN+V    L
Sbjct: 111 TSNQENVTSQHGED--RDDDGDNIQEND---ESTFSSSSTSSQSPAPSPPNYNVVTYTQL 165

Query: 176 KDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFEM 235
           K  +  PTIILP+P+NS++ENYL+L  L   INIP  FL+ DFKDLNY  +WYKG S  +
Sbjct: 166 KARVTDPTIILPVPMNSLLENYLALIMLAIAINIPTPFLRPDFKDLNYENDWYKGNSLSI 225

Query: 236 PKFILEFDSSND-----------TTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLL 284
           P + L+  + +D           T  ++   E+ +Q    +              QP LL
Sbjct: 226 PNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDI--------------QPKLL 271

Query: 285 WQLQKLAAINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQL 344
           WQLQKL ++ + ++SER+Y S ++FSL     VR  L+  +NL DVLP+F KS+ T+++ 
Sbjct: 272 WQLQKLISVVNSTLSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEK 331

Query: 345 CPS--NSDDESP-----------------------QDLFITSAFHLPEKSQSLVETKLAF 379
           C +   SD                           + LF+++A +    +   ++T +  
Sbjct: 332 CVAIFGSDITENDKVDNADNDNNNGNSEERMRGEMESLFVSTASYEDAATGERLKTPVTT 391

Query: 380 FHFMPEEYNENLYKMFNVLLYP--DDPSENNEDNGEQEEVYNNSLNKAAHIITVIFNEAD 437
             F PEEY  NLYKMFN LL+P  D+PS+     G+        L+  A I TV+F+  D
Sbjct: 392 LSFSPEEYESNLYKMFNTLLFPEIDNPSKTAVSEGDVPGT--GCLDYIAPIFTVVFHAMD 449

Query: 438 AYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHILEKRRQALARSKQLLDEIRQLKSFE 497
           + T E+    GV++P+ FYPQLY   C+D L++ +  +R++A   SK+LL +  QL+SF+
Sbjct: 450 STTDEVDLPGGVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQ 509

Query: 498 GKDISMTLESAKEYLQKEENPMGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWN 557
           GKDI+M L+S  +YL K+     K L E +  +E +I   KN+ ME+YK LS+ L    N
Sbjct: 510 GKDITMFLKSTMDYLTKDCGSETKALEE-MKILETLINNAKNTIMEDYKALSADLQGPLN 568

Query: 558 LSHPELQIIETAKTLGLI-DEPYLLTTVIISPYLYYIRKKDGIWYSVQCNTLGTDFQVSQ 616
           +SHPE+ II+ AK   LI DEPYLLT  +ISP  Y+IR + G WY V+ N + T+FQ+++
Sbjct: 569 VSHPEVSIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEFQITE 628

Query: 617 LESGAAVQEIIKAQTSRPNETPLMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSL 676
            ES   VQ  IK  T   NE PLMF++CR+S I D+  ++K +E+N GCLQF+K DQ++L
Sbjct: 629 CESIRNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIAL 688

Query: 677 E 677
           +
Sbjct: 689 D 689

>TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {ON}
           Anc_5.475 YOR138C
          Length = 622

 Score =  431 bits (1107), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 222/511 (43%), Positives = 326/511 (63%), Gaps = 29/511 (5%)

Query: 176 KDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFEM 235
           K ++  PT++LPLP N + E Y +LF L     +P    + DF DLNY+KNWY+G S+  
Sbjct: 109 KGQISDPTVVLPLPPNFLFEGYFALFCLFVANYMPHLLARPDFIDLNYDKNWYRGDSYTN 168

Query: 236 PKFILEFDSSNDTTTINENAERGDQYRKAVDIIP---IGTSDKVEKQQPFLLWQLQKLAA 292
            ++ L++ S N +              + ++I+P   +   D     Q  LLWQLQKLA+
Sbjct: 169 AEYRLKYLSKNGSDD------------EQIEIVPKDELTQEDGDYTLQSELLWQLQKLAS 216

Query: 293 INSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDE 352
           + +  MS+RAY  A++F++    QV+  ++++++L +VLP FIKS+  DL++CP+  D+E
Sbjct: 217 VANSRMSDRAYVRAKMFAIAVEPQVQRNMAEAEHLHEVLPSFIKSVAVDLEMCPNFQDNE 276

Query: 353 SPQDLFITSAFHLPEKS----QSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENN 408
             ++ FI+SAFH P  S    +S ++T L+ FHF+PEEY  NLY+MFN LL+ DD  E++
Sbjct: 277 V-RECFISSAFHTPSNSAPQEESTMKTWLSLFHFLPEEYETNLYRMFNALLFADDSVESD 335

Query: 409 EDN---GEQEEVYNNSLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCK 465
           + +   GE E    NSL++ A + T++F+E +  T  +    GVE+PL FYPQLY K+CK
Sbjct: 336 QSDSPDGEGE----NSLSEIAPVFTIVFDEMEETTEAVPLAEGVEMPLEFYPQLYTKECK 391

Query: 466 DQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMGKNLHE 525
           D+LIKHI+ KRRQ+   S+ +L EI  LKSF+GKD+S  + S+ +YLQK+E      L +
Sbjct: 392 DKLIKHIIAKRRQSQTDSRAILQEITDLKSFQGKDLSKFINSSLDYLQKDEK--SPELIK 449

Query: 526 TITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVI 585
            +  ++  I  KK  KM EYK ++ +L  +WNLS PE+QI++TAK LGLID+ YLLT  +
Sbjct: 450 GLLDLKDQITNKKTKKMNEYKEIAHRLQSEWNLSLPEIQIVKTAKELGLIDDSYLLTMAV 509

Query: 586 ISPYLYYIRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCR 645
           ISPY+YY R +DG W+ VQ       + V    S   +Q+ IK  T RP+E PLMF++C+
Sbjct: 510 ISPYMYYTRNRDGQWFFVQSTPYEASYNVRACSSPLEIQDAIKQHTRRPSEAPLMFIYCK 569

Query: 646 ESIIPDEDTVRKAMEENLGCLQFAKQDQLSL 676
           +  IPD+DTV KA+E N GC +FAK DQL L
Sbjct: 570 KGFIPDDDTVLKALENNQGCHRFAKDDQLQL 600

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (72%)

Query: 1  MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELP 44
          M + + V++L+EMGI ++VA DAL RT G++E A  FIF N+ P
Sbjct: 1  MNDTDAVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAP 44

>SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 605

 Score =  414 bits (1064), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 220/511 (43%), Positives = 315/511 (61%), Gaps = 37/511 (7%)

Query: 175 LKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFE 234
           LKD L+ PT++LPLP N+++ENY +LF L+  I+ P  FLK DF+DLNYN+NW+KG  + 
Sbjct: 109 LKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGY-YS 167

Query: 235 MPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIG--TSDKVEKQQPFLLWQLQKLAA 292
            P++ L+F S+N+                 V I+P    T       QP LLWQ QK  A
Sbjct: 168 KPEYRLQFSSNNN-----------------VSIVPKAQLTIQDSLTLQPELLWQFQKFIA 210

Query: 293 INSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDE 352
           + + S+S+R + SA+IF  V    V   L   D+L +VLP FIKS+  D+++C    D  
Sbjct: 211 VLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLLKEDAR 270

Query: 353 SPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNG 412
             + LFI++A+H P K +  +ET ++  HF+PEEY+ NLY+MFN LLYP        +  
Sbjct: 271 DIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLYRMFNTLLYP--------EED 322

Query: 413 EQEEVYNNSLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHI 472
           E  E   NSL   A ++TV+F+E D  T  ++   GV++PL FYPQ+Y K  KD LI H+
Sbjct: 323 EDGEEVENSLGNLAPMLTVVFDEMDESTENVSLQQGVDVPLKFYPQIYTKSSKDSLINHV 382

Query: 473 LEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMGKN------LHET 526
           + KR++A + S  +L ++  LKSF+GK I+  L S  ++  K+  P+ +N      L ++
Sbjct: 383 IAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKD--PLFQNDKDTEELLKS 440

Query: 527 ITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVII 586
           +  I+  I  KK +KMEEYK +S  +H  WNLSHP+L +++ AK +GLIDEPYLLT+ I+
Sbjct: 441 LVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAIL 500

Query: 587 SPYLYYIRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCRE 646
           SPY YYIRK+DGIWY V     G+D + S  E    V E IK  T   +ETPLMF +C+E
Sbjct: 501 SPYHYYIRKRDGIWYRVISEANGSDLEASITEPH-EVSESIKLATRHASETPLMFTYCKE 559

Query: 647 SIIPDEDTVRKAMEENLGCLQFAKQDQLSLE 677
           S I +E+++RK++E+N G  +F K DQ  LE
Sbjct: 560 SKIGNENSIRKSLEDNQGVSKFVKMDQTELE 590

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (73%)

Query: 4  NETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQE 49
          N++++ LL+MGI  EVAVDAL RT G+LE +V +IFS EL  T + 
Sbjct: 5  NQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEH 50

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score =  363 bits (933), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 238/715 (33%), Positives = 378/715 (52%), Gaps = 90/715 (12%)

Query: 13  MGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQDPLPSEQ----- 67
           MGI ++VA   L + GGNLE A+  IF  + P T++ +      I+  D L +++     
Sbjct: 1   MGIAKDVATSTLNKVGGNLEAAINHIFL-DTPDTQEREA-----ISTSDLLTAQKTISSN 54

Query: 68  ----------------------DLANQDYR-----SSNTPSS---VPGSNNPFRESNNYL 97
                                 +L+ ++ R     +SN PS+   + G +N    SNN L
Sbjct: 55  NYNNDNSNSSFDSDSQATSCHIELSRKNSRKVNSNTSNLPSNTFIISGGSN----SNNIL 110

Query: 98  GDEYVEGQEVQRELIXXXXXXXXXXXXXXGMDGYRSESRSISQQNGNVPESFHIESATNS 157
                      RE +                  Y ++++  + Q+      F + S  NS
Sbjct: 111 S----------RENLSENSSDSSIDSKEEYQPLYLTDTQPPTYQD------FTMTSNDNS 154

Query: 158 MSQEMIPPKYNLVAKGPLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTD 217
             Q  +PP Y+       K   D PT++L L  + ++ NY  LF+++  +  P  F+  D
Sbjct: 155 -QQIFVPPVYSKGTYKVQKSLPDDPTVLLSLEPSKLLSNYFGLFSMSLALFAPDLFMGPD 213

Query: 218 FKDLNYNKNWYKGTSFEMPKFILEFDSSNDTTTINENAERGDQYR-KAVDIIPIGTSDKV 276
           F +LN+N NW KG   + P++ +++           N E G + R + V+ I +   ++ 
Sbjct: 214 FVNLNFNDNWNKGLQIDTPEYEVKY---------THNLEPGLEDRIEIVNAINLSEKERE 264

Query: 277 EKQQPFLLWQLQKLAAINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIK 336
              QP++LWQLQK+ +I +  +S RAY S+ I+SL  +   +  L ++ +L D+LP FI+
Sbjct: 265 LTYQPYILWQLQKVISIMNSQISSRAYISSGIYSLCLDDNTQKKLMETSHLYDILPTFIR 324

Query: 337 SITTDLQLCPSNSDDESPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFN 396
           S+  D +  P + D    +++F++ AFH     +   +  L  FHF+PEEY+ NLYKMFN
Sbjct: 325 SLMNDCKHVP-DLDQNRMKNMFVSKAFHQIPIHKEPTKVSLFLFHFLPEEYDSNLYKMFN 383

Query: 397 VLLY-----PDDPSENNE---DNGEQEEVYN---NSLNKAAHIITVIFNEADAYTPEMTS 445
            LLY     P  P  N      +   +E+ N   +SL++ + I+TVIF+E D  T  +T 
Sbjct: 384 SLLYRSYDEPIYPRTNQNSADSSSSDDEISNEEESSLDEISTILTVIFDELDQDTELITQ 443

Query: 446 NSGVEIPLTFYPQLYFKKCKDQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTL 505
             GVEIP  FYP+LY KKCK++LI  IL  R Q   + K++L+++  LKSFEGKDI   L
Sbjct: 444 PDGVEIPFEFYPELYTKKCKEKLINGILHTRYQNKLKMKEVLNDLNSLKSFEGKDILRFL 503

Query: 506 ESAKEYLQKE--ENPMGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPEL 563
            S  EYLQ++  E PM   L    + ++  ++  K  KM EYK +S  L  +WN+  PEL
Sbjct: 504 NSTLEYLQRDGKEGPMVNKL----SYVKEQLSRAKTEKMLEYKTISRSLQNEWNIDKPEL 559

Query: 564 QIIETAKTLGLIDEPYLLTTVIISPYLYYIRKKDGIWYSVQCNTLGTDFQVSQLESGAAV 623
            IIE A+ LGLI +P+LL   ++SPYLY+ R +   W+  Q + +GTDF++++ ES   V
Sbjct: 560 SIIEQAQDLGLIGDPHLLVMAVLSPYLYFFRDRRNRWFKFQSSIMGTDFEITKYESDKTV 619

Query: 624 QEIIKAQTSRPNETPLMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSLEE 678
           Q+ IK  T   +ETP+MF++C++  IP++  V +   +N GC  FA+ D++SL++
Sbjct: 620 QDEIKLNTKSASETPIMFVYCKKDAIPNDSLVLQKFAKNQGCSAFAQADEMSLKK 674

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score =  364 bits (935), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 246/716 (34%), Positives = 382/716 (53%), Gaps = 96/716 (13%)

Query: 1   MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQ 60
           ME+ E ++TL++MGIP +VA +AL    GN+E AV +IFSNELP    + P +P  I++ 
Sbjct: 1   MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPPRIDE- 59

Query: 61  DPLPSEQDLANQDYRSSNTPSSVPGS-NNPFR--ESNNYLGDE---YVEGQEV--QRELI 112
               +  +  N +  + NT +++P S +N F+  + N YL D+    V+  +       I
Sbjct: 60  ----NSDNNTNTNVYNDNTGNTIPISGSNGFQPGDLNKYLTDKNNAIVQDTDSTSHNATI 115

Query: 113 XXXXXXXXXXXXXXGMDGYRSESRSISQQNGNVP--ESFHIESATNSMSQEMIP-PKYNL 169
                                 +  +S+ + ++    S   E +T+  SQ   P   Y  
Sbjct: 116 NTSFINNTTTTTSNSNSNSNPNTNYMSESDIDIDMMTSSTRELSTDIRSQSFKPQASYTS 175

Query: 170 VAKGPLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIP-QFFLKTDFKDLNYNKNWY 228
             K  + D    PT++LPL  N ++ENYLSLF  +  +  P Q F    F DL YNK WY
Sbjct: 176 THKLQISD----PTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWY 231

Query: 229 KGTSFEMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQ 288
                          ++N+ TT +                              L  QLQ
Sbjct: 232 S------------ISNNNENTTTDS-----------------------------LFLQLQ 250

Query: 289 KLAAINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSN 348
           ++ +I +  MSERA+ S ++FS  FN  +  +LS+SD+L ++   FI+S+ T + L P  
Sbjct: 251 RVTSIINSRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV-LPPI- 308

Query: 349 SDDESPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENN 408
                 +D+ +T+A +   ++  +  + ++  +F+PEEY  NLYKMFN L+YP++   N+
Sbjct: 309 -----FKDILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRND 363

Query: 409 EDNGEQE---------EVYNNSLNKAAHIITVIFNEAD-AYTPEMTSNSGVEIPLTFYPQ 458
           ++  ++          +  +++L + + I T++F E D + +   T   GVEIPL FYPQ
Sbjct: 364 DEQSDESLQTDDDDNDDANDSALEEISPIFTILFEEYDESDSSSTTLPEGVEIPLQFYPQ 423

Query: 459 LYFKKCKDQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENP 518
           LY KK  DQLIKHI+ KR++A ++S+ LL+EI  LKSF+GKDI   L+S  +Y++K+   
Sbjct: 424 LYSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKDSQR 483

Query: 519 MGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEP 578
             K+ +  +T I   +   KN KM++YK L+ +LH +WNLSHPE  IIETAK L LID P
Sbjct: 484 ETKSAN-NLTNILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSP 542

Query: 579 YLLTTVIISPYLYYIRKKDGIWYSVQCNTLGTD----------------FQVSQLESGAA 622
           Y L+ VI SP LY I+K +  WY + C ++                   F + +  S   
Sbjct: 543 YNLSMVIFSPDLYLIKKANVDWYLIDCRSINQMQNKNRNNNNNNNNPDLFVLRKCNSEIE 602

Query: 623 VQEIIKAQTSRPNETPLMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSLEE 678
           +Q+IIK +T  P+ETPLMF++C+ES +P+ED V K+ E N+ C +F K+DQL+L E
Sbjct: 603 IQDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTLNE 658

>KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.475
           YOR138C
          Length = 673

 Score =  358 bits (920), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 232/707 (32%), Positives = 361/707 (51%), Gaps = 77/707 (10%)

Query: 2   ENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQD 61
           E  + V +L EMGIP +VA+DAL R  GNL  AV +IFSN++P  E  +   P   +D  
Sbjct: 3   EEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQPRESSDLK 62

Query: 62  PLPSEQDLANQDYRSSNTPSSVPGSNNPFRESNN-------YLG-DEYVEGQEVQRELIX 113
           P   +Q L             V   ++P  ++N+       YL  D+ +E   VQ   + 
Sbjct: 63  PGDLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDNIEVGSVQLNEVS 122

Query: 114 XXXXXXXXXXXXXGMDGYRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKG 173
                                         ++P +  I S+ +  + +  PP+Y      
Sbjct: 123 PAT---------------------------SIPPNSDIGSSPDDGTGD--PPEYGGCKVP 153

Query: 174 PLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSF 233
             ++  ++P             NYL LFA       P  F++ DFK+LNY+  WY G + 
Sbjct: 154 AAEEGAERPDSGAAPAAERYATNYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAI 213

Query: 234 EMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLAAI 293
           + P  I+           +  A+ G +      I+P          QP +LWQLQ++ ++
Sbjct: 214 QQPLCIVS----------DVGADGGSR-----QIVPEEEVTSDTPVQPEMLWQLQRVISV 258

Query: 294 NSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDES 353
               +SER+Y SA++F+ VF+ +V S +  SD+L + LP FIKSI  D ++CP+   +  
Sbjct: 259 CHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYEALPSFIKSIIRDAEMCPAQHSNTD 318

Query: 354 PQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNGE 413
            + +F++SA    E+     ET L  FHF PEEYN NLYKMFN LLYP+D + ++  +  
Sbjct: 319 VKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNANLYKMFNALLYPEDDTIDDNSSDT 378

Query: 414 QEEV-----YNNSLNKAAHIITVIFNEAD-------AYTPEMTSNSGVEIPLTFYPQLYF 461
                       SL + A ++T+IFNEAD       A    + S  GVE+P +FYPQLY 
Sbjct: 379 DSSNDTDVQVEGSLKELAPLLTIIFNEADPGQLSAGAQDTCINSPQGVEVPFSFYPQLYT 438

Query: 462 KKCKDQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYL--------- 512
           ++ K+Q++K IL +R+ A A  +Q L  + QLKS+EGK     LE   E L         
Sbjct: 439 REVKEQVVKPILRQRKAARAELRQCLARMNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAV 498

Query: 513 -QKEENPMGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKT 571
             + +N M K + + +T I++ + E++    ++Y  LS++L  +WN+S+PE ++I  AK 
Sbjct: 499 RSRTKNEM-KEVIQKVTSIKLQLNEERAKLKKQYVDLSNKLQNEWNISNPERKVIGEAKR 557

Query: 572 LGLIDEPYLLTTVIISPYLYYIRKKDGI--WYSVQCNTLGTDFQVSQLESGAAVQEIIKA 629
           LGL+D+P+LL+ V++SPY Y +R   G   W  VQ N+ GTD  +++  +   VQ+ I+ 
Sbjct: 558 LGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQSNSYGTDGLITKHVTEEKVQQYIRD 617

Query: 630 QTSRPNETPLMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSL 676
            T   N+ PLMF++CRE     ++    A+E+N+GC +F K DQL L
Sbjct: 618 CTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMGCSEFNKADQLYL 664

>Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138C -
           Hypothetical ORF [contig 130] FULL
          Length = 604

 Score =  352 bits (904), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/512 (38%), Positives = 298/512 (58%), Gaps = 30/512 (5%)

Query: 171 AKGPLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKG 230
           A   +K++ + P ++ P   N++ ENY +LF L   +  P +FL  DFKDLNY  +W +G
Sbjct: 105 AANEVKNDQEDPLVVKPESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARG 164

Query: 231 TSFEMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKL 290
             F  P+F ++F+++ D T +          R+ +      TS      QP LLWQ QK 
Sbjct: 165 -QFLKPQFRIKFETNEDVTIVP---------RETL------TSQDNLTLQPELLWQFQKF 208

Query: 291 AAINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSD 350
            A+     S R   SAR  +     QV   L+ +++L DVLP FI+S+  D++LCP +  
Sbjct: 209 LAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELCPGS-- 266

Query: 351 DESPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNED 410
            +S ++LFI++A++ P      +ET ++  HFMPEEY+ N+YKMFN LLYP     N+ D
Sbjct: 267 -QSIKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYP-----NDAD 320

Query: 411 NGEQEEVYNNSLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIK 470
           + +  E   NSL   A +IT++F+E D  T ++    GVE+P+ FYPQLY +  K  LIK
Sbjct: 321 DDDDVEETQNSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTEDAKQSLIK 380

Query: 471 HILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKE-----ENPMGKNLHE 525
            + +   +   R+  +L  + +LKSF+GK I   L S  +++ ++     ENP   +L +
Sbjct: 381 DVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSAVTENPQINDLVD 440

Query: 526 TITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVI 585
           T+  I+  +++KK   M EYK +S +L+ DWNLSHPEL IIE  + LGLIDEPY+LTT +
Sbjct: 441 TLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTTAV 500

Query: 586 ISPYLYYIRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCR 645
           ISP+ Y+IRK+D  WY V          V++ ++   V   I+  T   +ETPLMF + +
Sbjct: 501 ISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDA-ETVTNTIRLNTRTASETPLMFTYFK 559

Query: 646 ESIIPDEDTVRKAMEENLGCLQFAKQDQLSLE 677
           ES I   +T+ +A+E+N G   FA+QDQ SL+
Sbjct: 560 ESAIDTNETLTEAIEKNTGVTSFAEQDQSSLK 591

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 3/92 (3%)

Query: 6  TVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQE-QPYIPININDQDPLP 64
           +K+LL+MGI R+VA++AL +T G++E++V +IFS ELPQ   E +P  P++ + +    
Sbjct: 5  AIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAEQGPQ 64

Query: 65 SEQDLANQDYRSSNTPSSVPGSNNPFRESNNY 96
           E+D  +         +SV  SN P  E   Y
Sbjct: 65 KEEDREDSALLEHTEYASV--SNGPLEEPERY 94

>KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weakly
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 597

 Score =  330 bits (846), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/506 (37%), Positives = 293/506 (57%), Gaps = 35/506 (6%)

Query: 175 LKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFE 234
           LK+  + P ++ P   N++ ENY +LF L   +  P  FL+ DF+DL Y ++WYKG  F 
Sbjct: 103 LKNRPEDPLVVRPASGNALFENYFALFCLAVGLGFPHHFLEPDFQDLTYGQDWYKG-QFL 161

Query: 235 MPKFILEFDSSNDTTTINENAERGDQYRKAVDIIP--IGTSDKVEKQQPFLLWQLQKLAA 292
            P + ++F++++D                 V I+P    TS      QP LLWQ QK  A
Sbjct: 162 KPAYRVKFENNDD-----------------VSIVPQETLTSQDNLILQPELLWQFQKFLA 204

Query: 293 INSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDE 352
           + +     R Y +AR  + V   QV   L+ SD+L + LP FIKS+  D++LCP      
Sbjct: 205 VQNSPQCRRKYVTARYLTKVLEPQVVEKLNNSDHLHEALPSFIKSLANDVELCPGA---H 261

Query: 353 SPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNG 412
           S ++LFI++A++ P      +ET ++  HFMPEEY+ N+YKMFN LLYPD    +NED  
Sbjct: 262 SVKELFISTAYYKPVSEPEPIETLVSLLHFMPEEYDTNIYKMFNALLYPD----SNED-A 316

Query: 413 EQEEVYNNSLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHI 472
           E +++  NSL   A +IT++F+E D  T + T   GV++PL FYPQLY ++ K+ LIK +
Sbjct: 317 EMDDI-QNSLGNLAPMITIVFDEMDESTEQATLPHGVDVPLEFYPQLYTEEAKNLLIKEV 375

Query: 473 LEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKE-----ENPMGKNLHETI 527
            +    +  +++ +L  +  LKSF+GK I   L SA +++ K+     E    + L +++
Sbjct: 376 TKLSADSQTQARSILRNLNDLKSFQGKQIHSFLNSALDFITKDMSGVSEQSGVQELVDSL 435

Query: 528 TKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVIIS 587
            +++  +  KK  KM +YK +S +L+ + NLSHPEL II+ AK LGLIDEPYLLT+ +IS
Sbjct: 436 QEVKQQLGSKKTEKMAQYKAVSHRLNNELNLSHPELGIIQRAKDLGLIDEPYLLTSAVIS 495

Query: 588 PYLYYIRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCRES 647
              Y+IR+ +G W+ V   +      V++ ++ + V   I+  T   +E+PLMF + + S
Sbjct: 496 ASNYFIRQNNGQWFHVVGRSNSEHMDVTKTDA-STVSSAIRFHTRCASESPLMFTYFKPS 554

Query: 648 IIPDEDTVRKAMEENLGCLQFAKQDQ 673
            I  E  V++A+  N G   FA+QDQ
Sbjct: 555 AIDTEAQVKEAVGHNKGAKLFAEQDQ 580

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 34/40 (85%)

Query: 6  TVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQ 45
           +++LL+MGI REVA++AL +T G++E++V +IFS ELPQ
Sbjct: 5  AIQSLLDMGITREVAIEALAKTNGDVENSVNYIFSGELPQ 44

>CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} similar
           to uniprot|Q12242 Saccharomyces cerevisiae YOR138c
          Length = 603

 Score =  314 bits (804), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 233/713 (32%), Positives = 358/713 (50%), Gaps = 132/713 (18%)

Query: 1   MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFS--NELPQTEQEQPYIPININ 58
           M+    V++LLEMGI R+VA  AL    G++E A+ +IF+  NE+               
Sbjct: 1   MDFEGNVQSLLEMGIARDVAEQALRECNGDVEAALNYIFNTPNEI--------------- 45

Query: 59  DQDPLPSEQDLANQDYRSSNTPSSVPG----SNNPFRESNNYLGDEYVEGQEVQRELIXX 114
           D D +  +Q          + P    G    S    +E+N      Y E Q VQ  L   
Sbjct: 46  DNDAMAGQQ--------MGSVPVGTQGIFDDSAFKIQENNPPQSQSYSEQQLVQENLPDN 97

Query: 115 XXXXXXXXXXXXGMDGYRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKGP 174
                                RS S  N +   S  +E +  +   ++IP ++       
Sbjct: 98  TF-------------------RSDSDTNSDSDSSSSLEQSQYTSIDDLIPQQF------- 131

Query: 175 LKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKD--LNYNKNWYKGTS 232
            K+ +D PT+++P P       Y +LFAL   I++P +F+K D  D  L ++ +W+    
Sbjct: 132 -KNTMDYPTVVIPAPAVPNHIYYCALFALFISIHLPHYFVKADHDDMPLLFSPDWF---- 186

Query: 233 FEMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLW--QLQKL 290
                        ND                          D+  + +P L+   QL KL
Sbjct: 187 -------------NDI-------------------------DREPEDEPLLVLRDQLHKL 208

Query: 291 AAI-NSFSMSERAYASARIFSLVFNGQVRS---VLSKSD--NLIDVLPLFIKSITTDLQL 344
            A+ NS   S RA+ ++++F +     ++S   +L+  +  +L  +LP FIK+I  +L  
Sbjct: 209 IAVQNSNDHSARAFVTSKMFDVDLQSVIQSNEPMLTNPNYFHLYQILPSFIKTIA-NLSY 267

Query: 345 CPSNSDDESPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDP 404
              N        LFI+SA    E++ S  E+ L+ FHF+PEEY  NLYKMFNVLLYPDD 
Sbjct: 268 TEKN--------LFISSAIQGGEEASSSKESLLSLFHFLPEEYESNLYKMFNVLLYPDDD 319

Query: 405 SENNEDNGEQEEVYNNSLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKC 464
            +  ED   ++EV  NSL + A ++T+IFNEA+         +GVE+PL FYPQLY KKC
Sbjct: 320 HDIGED---EDEVSENSLKELAPVMTIIFNEAENIDENAPVTNGVEVPLKFYPQLYTKKC 376

Query: 465 KDQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMGKNLH 524
           KDQLI H+L KR+      KQ+L +I  LKS++GKDI   + S+ +YL K+++  G  + 
Sbjct: 377 KDQLISHVLSKRKDGRKELKQILKDIGNLKSYQGKDILSFINSSLDYLTKDKDDSG--IA 434

Query: 525 ETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTV 584
           E + K++  +  KK  KM  YK +S ++H +WN+ +PEL+I+ETA  LGLIDEPY L   
Sbjct: 435 EELHKLKDELTAKKTEKMNSYKQISEKMHTEWNIQNPELKIVETATKLGLIDEPYFLNLA 494

Query: 585 IISPYLYYIRKKDGIWYSVQCNTLGT---DFQVSQLESGAAVQEIIKAQTSRPNETPLMF 641
           ++SP+ Y++R +   WY V+ N   T      V + +    V + +K  T+ PN TPLMF
Sbjct: 495 VVSPFFYFVRNRKDEWYEVRFNPFNTAEDKISVGKCDGPGEVIQHVKNSTTVPNSTPLMF 554

Query: 642 LFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSLEEQSSTVNVTEHPKGEND 694
           ++ ++S + D+  +++ + +N   L F KQDQ+ L+         E+ +GE D
Sbjct: 555 VYSKDSYMADDTEMQELLSQNKTLLDFFKQDQIYLQN-------FENARGEGD 600

>ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 547

 Score =  282 bits (722), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 175/504 (34%), Positives = 275/504 (54%), Gaps = 73/504 (14%)

Query: 172 KGPLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGT 231
           + P K  +  PT+++PLP +S+ ENY +LF+L+    +P    K +  DL YN  W +G+
Sbjct: 109 QSPKKSLVTDPTVVIPLP-HSLFENYFALFSLSMCQYLPHLMAKPELGDLMYNPKWAQGS 167

Query: 232 SFEMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLA 291
           S     FI                                              QLQ+L 
Sbjct: 168 SDPSTSFI---------------------------------------------QQLQRLC 182

Query: 292 AINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDD 351
           ++ + S S+R Y SA++F+ V +  ++  L+++++L +VLP FI+S+   L+ C   ++D
Sbjct: 183 SVVNASFSDRCYVSAKLFAAVLDAPLKRKLAEAEHLHEVLPSFIRSLIHALEECGCYAED 242

Query: 352 ESPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDN 411
           +  + LF++SA  L  + +SL    L+   FMPEEY  +LY MFN LLYP+   E  E++
Sbjct: 243 QI-RSLFVSSA--LSSECKSL----LSVLQFMPEEYESSLYAMFNALLYPE--LEEGEES 293

Query: 412 GEQEEVYNNSLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKH 471
           G       NSL   A ++T++F+E DA T E+TSN GV++PL FYPQLY K  KD +++ 
Sbjct: 294 G-------NSLLDLAPVLTIVFDEMDADT-EVTSNRGVDVPLEFYPQLYTKSVKDAIVRP 345

Query: 472 ILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMGKNLHETITKIE 531
           + ++R+ A  RS+Q+L E+  LKS++GKD    + S  +YLQ++     K + + +  ++
Sbjct: 346 LQQQRKAAQERSRQVLAEMNGLKSYQGKDTLKFINSTLDYLQRDNQ--SKEIIDKLESLK 403

Query: 532 MMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVIISPYLY 591
             IA+ K  +  EYK LS +LH +WNLSHP   +I  A   GLIDEPYLL  V++SP  Y
Sbjct: 404 NSIADHKTQRKNEYKELSQKLHGEWNLSHPTY-LINEAMERGLIDEPYLLAMVVLSPGHY 462

Query: 592 YIRKKDGIWYSVQCNTLGTDFQVSQLESGAA--VQEIIKAQTSRPNETPLMFLFCRESII 649
             R + G W  ++     TD  + ++   A   VQ  I+  T+ P++TPLM L+ + S +
Sbjct: 463 LQRSRSGQWKMIR-----TDSNMIRISDCAPSQVQATIRQHTTFPSKTPLMLLYVKSSHV 517

Query: 650 PDEDTVRKAMEENLGCLQFAKQDQ 673
             +  V K++E N G   F + DQ
Sbjct: 518 SVDTIVSKSLESNEGITNFLRIDQ 541

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 6/58 (10%)

Query: 8  KTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQDPLPS 65
          ++L+EMGI  EVA  AL +T GNLE AV +IFS E+   +      P+N     P+P 
Sbjct: 5  QSLIEMGITPEVAQRALQQTHGNLEAAVNYIFSGEVSDDQ------PVNQPQSAPMPG 56

>KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {ON}
           weakly similar to uniprot|Q12242 Saccharomyces
           cerevisiae YOR138C RUP1
          Length = 544

 Score =  220 bits (561), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 160/524 (30%), Positives = 263/524 (50%), Gaps = 55/524 (10%)

Query: 185 ILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFEMPKFILEFDS 244
           ILP   ++++E+Y  LFAL   +N+P  FL  DFK+L YN +W+KG   +          
Sbjct: 57  ILPKGSSALLESYFPLFALCMAVNVPTKFLNVDFKELVYNPHWFKGELVQ---------- 106

Query: 245 SNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLAAINSFSMSERAYA 304
            +D   ++ NA     +++ +      T  +  + QP L+ ++Q L  I +   S R + 
Sbjct: 107 -SDYRLVHRNAGPLLIHKREL------TGSEYLEMQPELIPRMQLLIGIANDPESMRRFV 159

Query: 305 SARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDESPQDLFITSAFH 364
           ++ + +   +  V   LS+ D+L +V P FIK++  D+ LC    DD+S   LF++ A H
Sbjct: 160 ASELINKGTDFNVSRALSECDHLSEVFPQFIKNLHNDMDLCLK--DDKSTSKLFLSKALH 217

Query: 365 LPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNGEQEEVYNNSLNK 424
            P   +    T L+  +F PE Y   LY+MFN +L P       ED+G   E+  N+ + 
Sbjct: 218 RPNVLEPFQPTSLSVLNFSPENYAYTLYEMFNPMLLP-------EDSGRGYEI-ENAFDF 269

Query: 425 AAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHILEKRRQALARSK 484
            A + T+IF++ D  T E+  + GV+IP+ FYPQLY K   ++++  +LE+       +K
Sbjct: 270 LAPVFTIIFDDMDDTTEEVNLSHGVQIPIEFYPQLYTKNALEKVVVPVLEETDALRNTNK 329

Query: 485 QLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMG-----KNLHETITKIEMMIAEKKN 539
             +D++  L+SF+GK IS  L S+  YL  EE P+G     K L +T+ KI+  ++ KK 
Sbjct: 330 LKVDQMSSLQSFQGKQISSFLNSSINYL--EEIPLGDEDKSKELVDTLEKIKYQLSNKKR 387

Query: 540 SKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVIISPYLYYIRK---- 595
             M +Y     Q+    +   P  +II+ AK +G+IDEPYLL  V+ SP  Y I +    
Sbjct: 388 EMMADYTETQRQIDL-LSFEGPSEKIIDLAKQVGIIDEPYLLRLVVFSPNDYIIARGISA 446

Query: 596 KDG----------IWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCR 645
            DG          + Y       G+     +  +    Q+I K+ T   +ETP++F++ +
Sbjct: 447 DDGNTGMETGNNNLQYIRNIIEFGSSSLTQEELTAQETQDITKSHTRHASETPILFVYIK 506

Query: 646 ESIIPDEDTVRKAMEENLGCLQFAKQDQLSLEEQSSTVNVTEHP 689
           +  I     +  ++ EN     F K      EE ++ VN  + P
Sbjct: 507 KDHIDAPQDILASISENETLTNFLK------EEHTTYVNYKQSP 544

>NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON}
           Anc_8.185 YER143W
          Length = 462

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%)

Query: 6   TVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIF 39
           T+K L+++G PR   + AL RTGGN E A A +F
Sbjct: 428 TIKQLMDLGFPRNQVITALNRTGGNAEYAAALLF 461

>Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 25/35 (71%)

Query: 5   ETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIF 39
           +T+K L+++G PR+  V AL +TGGN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDTVVKALKQTGGNAEFAASLLF 427

>Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%)

Query: 5   ETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIF 39
           +T+K L+++G PR+  V AL +T GN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDAVVTALKQTNGNAEFAASLLF 427

>YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA
           damage-inducible v-SNARE binding protein with a role in
           suppression of protein secretion; may play a role in
           S-phase checkpoint control; has ubiquitin-associated
           (UBA), ubiquitin-like (UBL), and retroviral-like
           proteinase (RVP) domains
          Length = 428

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%)

Query: 5   ETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIF 39
           +T+K L+++G PR+  V AL +T GN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLF 427

>NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {ON}
           Anc_8.185 YER143W
          Length = 472

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 7   VKTLLEMGIPREVAVDALMRTGGNLEDAVAFIF 39
           +K + ++G  R  A++AL RTGGN E A A +F
Sbjct: 439 IKQVTDLGFTRTEAINALNRTGGNAELAAALLF 471

>KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {ON}
           similar to uniprot|P40087 Saccharomyces cerevisiae
           YER143W DDI1 DNA damage-inducible v-SNARE binding
           protein contains a ubiquitin-associated (UBA) domain may
           act as a negative regulator of constitutive exocytosis
           may play a role in S-phase checkpoint control
          Length = 414

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 25/33 (75%)

Query: 7   VKTLLEMGIPREVAVDALMRTGGNLEDAVAFIF 39
           +K L+++G  R+ A++AL +TGGN++ A + +F
Sbjct: 381 IKKLVDLGFSRKEAINALNKTGGNVDYAASLLF 413

>Kpol_526.23 s526 (62128..63399) [1272 bp, 423 aa] {ON}
           (62128..63399) [1272 nt, 424 aa]
          Length = 423

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 6   TVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIF 39
           T+K L+++G  R   + AL +TGGN E A + +F
Sbjct: 389 TIKKLMDLGFSRAEVIKALTQTGGNAEFAASLLF 422

>Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 34.3 bits (77), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%)

Query: 5   ETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIF 39
           +T+K L+++G PR+  V AL +T GN + A + +F
Sbjct: 393 KTIKQLMDLGFPRDDVVKALKQTNGNADFAASLLF 427

>Skud_7.240 Chr7 complement(418142..419098) [957 bp, 318 aa] {ON}
           YGL044C (REAL)
          Length = 318

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 512 LQKEENPMGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPE--LQIIETA 569
           L+  E P G +++  +T   MMI+ +   K +E ++   Q  +DW  +HPE  + ++E  
Sbjct: 165 LKFPELPSGIDVNINMTTPAMMISSELAKKPKEVQLKFLQKFQDWTRTHPEDAVSLLELC 224

Query: 570 KTLGLIDEPYLLTTVII 586
             L  +    LLT  I 
Sbjct: 225 PQLSFVTAELLLTNGIC 241

>KAFR0B02300 Chr2 (451471..452721) [1251 bp, 416 aa] {ON} Anc_8.185
           YER143W
          Length = 416

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 6   TVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFS 40
           T+K L+++G  R   + AL  TGGN + A +F+F+
Sbjct: 382 TIKQLMDLGFSRNEVIKALDATGGNADFAASFLFN 416

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
           YEL037C (REAL)
          Length = 397

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 40/89 (44%), Gaps = 14/89 (15%)

Query: 2   ENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIF----SNELPQTEQEQPYIPINI 57
           + NET++ ++EMG PRE    AL     N + AV ++      N  P   Q+Q   P   
Sbjct: 146 QRNETIERIMEMGYPREEVERALRAAFNNPDRAVEYLLMGIPENLRPPEPQQQAVAP--- 202

Query: 58  NDQDPL-------PSEQDLANQDYRSSNT 79
            +Q P        P+E DL  Q  +  NT
Sbjct: 203 TEQPPTTATTAEQPAEDDLFAQAAQGGNT 231

>ZYRO0C02090g Chr3 complement(165011..166027) [1017 bp, 338 aa] {ON}
           highly similar to uniprot|P38629 Saccharomyces
           cerevisiae YNL290W RFC3 Subunit of heteropentameric
           Replication factor C (RF-C) which is a DNA binding
           protein and ATPase that acts as a clamp loader of the
           proliferating cell nuclear antigen (PCNA) processivity
           factor for DNA polymerases delta and epsilon
          Length = 338

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 547 ILSSQLHKDWNLSHPELQIIETAKTLGLID 576
           IL S L +DW  +H  LQ + T+K L LID
Sbjct: 245 ILDSILKEDWTTAHYTLQKVRTSKGLALID 274

>CAGL0I06787g Chr9 complement(658666..659946) [1281 bp, 426 aa] {ON}
           similar to uniprot|P40087 Saccharomyces cerevisiae
           YER143w DDI1 induced in response to DNA alkylation
           damage
          Length = 426

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 5   ETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIF 39
           +T+K L+++G  R+  + AL+ T GN E A + +F
Sbjct: 391 KTIKQLMDLGFSRQEVIQALVSTNGNAEFAASLLF 425

>YGL044C Chr7 complement(416146..417036) [891 bp, 296 aa] {ON}
           RNA15Component of the cleavage and polyadenylation
           factor I (CF I); CF 1, composed of the CF 1A complex
           (Rna14p, Rna15p, Clp1p, Pcf11p) and Hrp1, is involved in
           cleavage and polyadenylation of mRNA 3' ends; interacts
           with the A-rich polyadenylation signal in complex with
           Rna14p and Hrp1p; mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay;
           required for gene looping
          Length = 296

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 516 ENPMGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPE--LQIIETAKTLG 573
           E P G +++  +T   MMI+ +   K +E ++   Q  ++W  +HPE  + ++E    L 
Sbjct: 147 ELPSGIDVNINMTTPAMMISSELAKKPKEVQLKFLQKFQEWTRAHPEDAVSLLELCPQLS 206

Query: 574 LIDEPYLLTTVII 586
            +    LLT  I 
Sbjct: 207 FVTAELLLTNGIC 219

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
           YEL037C (REAL)
          Length = 397

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 16/92 (17%)

Query: 2   ENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQ------------TEQE 49
           E NET++ ++EMG PRE    AL     N + AV ++    +P+            T  E
Sbjct: 146 ERNETIERIMEMGYPREEVERALRAAFNNPDRAVEYLLMG-IPENLRQPEPQQQAVTATE 204

Query: 50  QPYIPININDQDPLPSEQDLANQDYRSSNTPS 81
            P       +Q   P+E DL  Q  +  N  S
Sbjct: 205 HPSTAATTTEQ---PAEDDLFAQAAQGDNASS 233

>Smik_7.239 Chr7 complement(407397..408296) [900 bp, 299 aa] {ON}
           YGL044C (REAL)
          Length = 299

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 516 ENPMGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPE--LQIIETAKTLG 573
           E P G +++  +T   MMI+ +   K +E ++   Q  ++W  +HPE  + ++E    L 
Sbjct: 150 ELPSGIDVNINMTTPAMMISSELAKKPKEVQLKFLQKFQEWTRTHPEDAVSLLELCPQLS 209

Query: 574 LIDEPYLLTTVII 586
            +    LLT  I 
Sbjct: 210 FVTAELLLTNGIC 222

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,360,101
Number of extensions: 3794554
Number of successful extensions: 12588
Number of sequences better than 10.0: 132
Number of HSP's gapped: 13072
Number of HSP's successfully gapped: 147
Length of query: 696
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 579
Effective length of database: 40,065,477
Effective search space: 23197911183
Effective search space used: 23197911183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)