Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H022605.474ON57057029110.0
NDAI0C014005.474ON70563912961e-171
TDEL0A033805.474ON55958812331e-164
YOR137C (SIA1)5.474ON62261511651e-152
Skud_15.3015.474ON62564611551e-151
Suva_8.1895.474ON62661611261e-147
Smik_15.3175.474ON62661811261e-147
TBLA0A025505.474ON5785949701e-124
KLTH0F15026g5.474ON5746059221e-117
SAKL0G03542g5.474ON5746149201e-116
Kwal_55.212685.474ON5685959141e-115
KLLA0E03147g5.474ON5786165741e-65
KNAG0B058604.200ON5854242934e-27
Ecym_24554.200ON5724022651e-23
SAKL0B05038g4.200ON5904122605e-23
NCAS0J012204.200ON5834012562e-22
KAFR0A062104.200ON5814052526e-22
TBLA0D020204.200ON6434192482e-21
ZYRO0B07898g4.200ON5834162421e-20
TDEL0E017304.200ON5744072401e-20
NDAI0J019704.200ON5893262374e-20
YLR361C (DCR2)4.200ON5783382331e-19
Skud_12.4454.200ON5813362294e-19
Smik_12.4484.200ON5803382269e-19
Suva_10.4624.200ON5813362214e-18
KLLA0B13134g4.200ON5653372205e-18
Kpol_472.154.200ON5293322161e-17
CAGL0B02761g4.200ON5784152081e-16
ABL009W4.200ON5693762045e-16
Kwal_55.203334.200ON5773891982e-15
KLTH0E10824g4.200ON5804031965e-15
TPHA0F011004.200ON5584081822e-13
CAGL0K05225g7.435ON913100771.1
YML047C (PRM6)1.495ON35277732.2
YER116C (SLX8)7.416ON27471732.3
Kpol_304.55.713ON66677742.5
TBLA0A10760singletonON232979724.2
SAKL0D04532g3.231ON55761714.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H02260
         (570 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H02260 Chr8 complement(443026..444738) [1713 bp, 570 aa] {O...  1125   0.0  
NDAI0C01400 Chr3 (292788..294905) [2118 bp, 705 aa] {ON} Anc_5.474    503   e-171
TDEL0A03380 Chr1 complement(601033..602712) [1680 bp, 559 aa] {O...   479   e-164
YOR137C Chr15 complement(581813..583681) [1869 bp, 622 aa] {ON} ...   453   e-152
Skud_15.301 Chr15 complement(535844..537721) [1878 bp, 625 aa] {...   449   e-151
Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON...   438   e-147
Smik_15.317 Chr15 complement(543212..545092) [1881 bp, 626 aa] {...   438   e-147
TBLA0A02550 Chr1 (616882..618618) [1737 bp, 578 aa] {ON} Anc_5.4...   378   e-124
KLTH0F15026g Chr6 (1230760..1232484) [1725 bp, 574 aa] {ON} simi...   359   e-117
SAKL0G03542g Chr7 complement(292214..293938) [1725 bp, 574 aa] {...   358   e-116
Kwal_55.21268 s55 (759935..761641) [1707 bp, 568 aa] {ON} YOR137...   356   e-115
KLLA0E03147g Chr5 complement(290622..292358) [1737 bp, 578 aa] {...   225   1e-65
KNAG0B05860 Chr2 complement(1152991..1154748) [1758 bp, 585 aa] ...   117   4e-27
Ecym_2455 Chr2 complement(885426..887144) [1719 bp, 572 aa] {ON}...   106   1e-23
SAKL0B05038g Chr2 complement(434061..435833) [1773 bp, 590 aa] {...   104   5e-23
NCAS0J01220 Chr10 complement(212622..214373) [1752 bp, 583 aa] {...   103   2e-22
KAFR0A06210 Chr1 (1254374..1256119) [1746 bp, 581 aa] {ON} Anc_4...   101   6e-22
TBLA0D02020 Chr4 (503782..505713) [1932 bp, 643 aa] {ON} Anc_4.2...   100   2e-21
ZYRO0B07898g Chr2 (616796..618547) [1752 bp, 583 aa] {ON} simila...    98   1e-20
TDEL0E01730 Chr5 (333362..335086) [1725 bp, 574 aa] {ON} Anc_4.2...    97   1e-20
NDAI0J01970 Chr10 complement(488882..490651) [1770 bp, 589 aa] {...    96   4e-20
YLR361C Chr12 complement(847388..849124) [1737 bp, 578 aa] {ON} ...    94   1e-19
Skud_12.445 Chr12 complement(787532..789277) [1746 bp, 581 aa] {...    93   4e-19
Smik_12.448 Chr12 complement(786446..788188) [1743 bp, 580 aa] {...    92   9e-19
Suva_10.462 Chr10 complement(807033..808778) [1746 bp, 581 aa] {...    90   4e-18
KLLA0B13134g Chr2 (1149114..1150811) [1698 bp, 565 aa] {ON} simi...    89   5e-18
Kpol_472.15 s472 (43361..44950) [1590 bp, 529 aa] {ON} (43361..4...    88   1e-17
CAGL0B02761g Chr2 (265971..267707) [1737 bp, 578 aa] {ON} simila...    85   1e-16
ABL009W Chr2 (381100..382809) [1710 bp, 569 aa] {ON} Syntenic ho...    83   5e-16
Kwal_55.20333 s55 (355985..357718) [1734 bp, 577 aa] {ON} YLR361...    81   2e-15
KLTH0E10824g Chr5 (973337..975079) [1743 bp, 580 aa] {ON} simila...    80   5e-15
TPHA0F01100 Chr6 complement(249205..250881) [1677 bp, 558 aa] {O...    75   2e-13
CAGL0K05225g Chr11 complement(505973..508714) [2742 bp, 913 aa] ...    34   1.1  
YML047C Chr13 complement(180017..181075) [1059 bp, 352 aa] {ON} ...    33   2.2  
YER116C Chr5 complement(395348..396172) [825 bp, 274 aa] {ON}  S...    33   2.3  
Kpol_304.5 s304 complement(14534..16534) [2001 bp, 666 aa] {ON} ...    33   2.5  
TBLA0A10760 Chr1 complement(2665056..2672045) [6990 bp, 2329 aa]...    32   4.2  
SAKL0D04532g Chr4 complement(362288..363961) [1674 bp, 557 aa] {...    32   4.4  

>NCAS0H02260 Chr8 complement(443026..444738) [1713 bp, 570 aa] {ON}
           Anc_5.474
          Length = 570

 Score = 1125 bits (2911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/570 (95%), Positives = 546/570 (95%)

Query: 1   MRLKTRRIVKTSXXXXXXXXXXXXCNSLGSLRNHLKNVFRQDIPEEYTGGPITDIQCIPC 60
           MRLKTRRIVKTS            CNSLGSLRNHLKNVFRQDIPEEYTGGPITDIQCIPC
Sbjct: 1   MRLKTRRIVKTSQRLLQLLIFFILCNSLGSLRNHLKNVFRQDIPEEYTGGPITDIQCIPC 60

Query: 61  FYWYQTCGSIIWNDQKWLRVSKNLSDESLYSMESGPFSRSFLYVRQDTGEKPISDIAISS 120
           FYWYQTCGSIIWNDQKWLRVSKNLSDESLYSMESGPFSRSFLYVRQDTGEKPISDIAISS
Sbjct: 61  FYWYQTCGSIIWNDQKWLRVSKNLSDESLYSMESGPFSRSFLYVRQDTGEKPISDIAISS 120

Query: 121 DPLMIPVHVTQDINNLLQSSDSSVYHNHKFHQKGSSWRASWSWFWNSGKVLXXXXXXXXX 180
           DPLMIPVHVTQDINNLLQSSDSSVYHNHKFHQKGSSWRASWSWFWNSGKVL         
Sbjct: 121 DPLMIPVHVTQDINNLLQSSDSSVYHNHKFHQKGSSWRASWSWFWNSGKVLASHDHADDA 180

Query: 181 XXXTMDDISLRGENWKYKGYGIWCKFDNTKEIVANIEIFLGSLFLESRPYWREVIHEFKP 240
              TMDDISLRGENWKYKGYGIWCKFDNTKEIVANIEIFLGSLFLESRPYWREVIHEFKP
Sbjct: 181 SDSTMDDISLRGENWKYKGYGIWCKFDNTKEIVANIEIFLGSLFLESRPYWREVIHEFKP 240

Query: 241 DDKLPLPISITVKIATNVKEETGELNDGTLKMDSKFKILQVSDVHFRSSINSMPMLKEYQ 300
           DDKLPLPISITVKIATNVKEETGELNDGTLKMDSKFKILQVSDVHFRSSINSMPMLKEYQ
Sbjct: 241 DDKLPLPISITVKIATNVKEETGELNDGTLKMDSKFKILQVSDVHFRSSINSMPMLKEYQ 300

Query: 301 TMQFITNTITRELPNLVIVTGDILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYS 360
           TMQFITNTITRELPNLVIVTGDILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYS
Sbjct: 301 TMQFITNTITRELPNLVIVTGDILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYS 360

Query: 361 EYASRDQIINFISTLPYSLTKFSTDNGHLIIPLHKFNDPKGEVSQDELMIYVIDSFHSIE 420
           EYASRDQIINFISTLPYSLTKFSTDNGHLIIPLHKFNDPKGEVSQDELMIYVIDSFHSIE
Sbjct: 361 EYASRDQIINFISTLPYSLTKFSTDNGHLIIPLHKFNDPKGEVSQDELMIYVIDSFHSIE 420

Query: 421 NDVKFKEIASKPVDWEYALAFRSLPIPQYRPDGLFPIIGQYNERTSLELRENVGTAVGNV 480
           NDVKFKEIASKPVDWEYALAFRSLPIPQYRPDGLFPIIGQYNERTSLELRENVGTAVGNV
Sbjct: 421 NDVKFKEIASKPVDWEYALAFRSLPIPQYRPDGLFPIIGQYNERTSLELRENVGTAVGNV 480

Query: 481 INLQDFLISKKVKSISCGHEHNNDCCLQSKNEMWLCYGGSTGVGTKRMEGLFANVRLFDI 540
           INLQDFLISKKVKSISCGHEHNNDCCLQSKNEMWLCYGGSTGVGTKRMEGLFANVRLFDI
Sbjct: 481 INLQDFLISKKVKSISCGHEHNNDCCLQSKNEMWLCYGGSTGVGTKRMEGLFANVRLFDI 540

Query: 541 DTDIGEITSWKRNMHLIDNVYDYQYIYKRE 570
           DTDIGEITSWKRNMHLIDNVYDYQYIYKRE
Sbjct: 541 DTDIGEITSWKRNMHLIDNVYDYQYIYKRE 570

>NDAI0C01400 Chr3 (292788..294905) [2118 bp, 705 aa] {ON} Anc_5.474
          Length = 705

 Score =  503 bits (1296), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 290/639 (45%), Positives = 388/639 (60%), Gaps = 79/639 (12%)

Query: 3   LKTRRIVKTSXXXXXXXXXXXXCNSLGSLRNHLKNVF-----RQDIPEEYTGGPITDIQC 57
           LKTRRI KT               S  S++ HL+N+         I  EY  GPI DIQ 
Sbjct: 73  LKTRRIFKTIKQLLLLIIFLTIITSWSSIKGHLQNISLFSTRDSTIHPEYEEGPILDIQR 132

Query: 58  IPCFYWYQTCGSIIWNDQ-KWLRVSKNLSDESLYSMESGPFSRSFLYVRQDTGE------ 110
           + C++WY TC +++W+D   W R+ K+LSDE LY++ES  +  S++YV+  +        
Sbjct: 133 LRCYHWYSTC-NVLWHDGILWQRIKKDLSDEKLYALESTQYYDSYIYVKTLSANMDTLSP 191

Query: 111 ----------KPISDIAISSDPLMIPVHVTQDINNLLQSSDSSVYHNHKFHQKGSSWRAS 160
                     K IS+IA+S DP +IP+ V +D+N L +SSDSS++H H FHQ G      
Sbjct: 192 NIPNGSPHTLKRISEIAMSRDPTIIPMQVIRDVNKLFKSSDSSMFHTHVFHQSGDEHDPV 251

Query: 161 WS--WFWNSGKVLXXXXXXXXXXXXTM----------------DDISLRGENWKYKGYGI 202
           +S     N  K +                              DD+SL GE+WKY+G GI
Sbjct: 252 YSDNHAHNKNKDIDVHDDNSHMNGYQFLQQIWSWLLAISDSHDDDLSLMGEDWKYRGSGI 311

Query: 203 WCKFDNTKE----IVANIEIFLGSLFLESRPYWREVIHEFKPDDK---LPLPISITVKIA 255
           WCK++N  E    IV  +EI+LGS F E R  W+E+IHE+K +     + LPISIT +I 
Sbjct: 312 WCKYENGVEMEPMIVNKLEIYLGSSFQEFRHNWKEIIHEYKTERDERDVSLPISITRQIG 371

Query: 256 TNVK---------EETGELNDGTLKMDSKFKILQVSDVHFRSSINSMPMLKEYQTMQFIT 306
              K         E+  E   G L     FKILQVSD+H++ S  S+  LKE+QT  FI 
Sbjct: 372 RGTKTDPDKIILIEKETEKKFG-LMTAFGFKILQVSDLHYKCSDESISNLKEFQTNNFIK 430

Query: 307 NTITRELPNLVIVTGDILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRD 366
             I RE PNL+++TGDILD TN +DYQTCIM LVQP I F+IPY+I LG++DYS YASR+
Sbjct: 431 KVILREFPNLIVITGDILDGTNCVDYQTCIMKLVQPFINFEIPYLIMLGTSDYSRYASRE 490

Query: 367 QIINFISTLPYSLTKFS--TDNGHLIIPLH-KFNDPKGEVSQDELMIYVIDSFHSIENDV 423
            I+ FI TLPY + K S   ++ +++IP++ K+ND   +V+   +MIY +DSF+ I+N  
Sbjct: 491 SILQFIRTLPYCINKLSQNVNDTNVMIPIYNKYND-DDKVNDPYIMIYGVDSFNPIDN-T 548

Query: 424 KFKEIASKPVDWEYALAFRSLPIPQYRPDGLFPIIGQYNERTSLELRENV---------- 473
           K K   S  V W+Y LAFRSLPIP+YRP+G+FPI+GQYNE++SL   E            
Sbjct: 549 KMKNEGS--VKWDYGLAFRSLPIPEYRPEGMFPIVGQYNEKSSLTFEEFANNDDSVDADD 606

Query: 474 ---GTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQSKNEMWLCYGGSTGVGTKRMEG 530
              G  +G    LQDFLIS+ V+ +SCGHEH+NDCCLQSKN+MWLCY GS+G+   R+E 
Sbjct: 607 GGDGRWIG-ANKLQDFLISENVQVLSCGHEHSNDCCLQSKNKMWLCYDGSSGMDVARLEN 665

Query: 531 LFANVRLFDIDTDIGEITSWKRNMHLIDNVYDYQYIYKR 569
           + A+VRLF++DT+ GEITSWKRN + IDNVYDYQYIYK+
Sbjct: 666 IHASVRLFEVDTNAGEITSWKRNSNSIDNVYDYQYIYKK 704

>TDEL0A03380 Chr1 complement(601033..602712) [1680 bp, 559 aa] {ON}
           Anc_5.474 YOR137C
          Length = 559

 Score =  479 bits (1233), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 262/588 (44%), Positives = 357/588 (60%), Gaps = 56/588 (9%)

Query: 2   RLKTRRIVKTSXXXXXXXXXXXXCNSLGSLRNHLKNVFRQDIPEEYTGGPITDIQCIPCF 61
           RL+ RRI+                +S  S   HL+N F      EY GG I D+Q I C+
Sbjct: 4   RLRHRRIITILRRLAIASFFLLAYSSRSSFIIHLQNTFNVPTTSEYRGGLIDDVQSIRCY 63

Query: 62  YWYQTCGSIIWNDQK-------WLRVSKNLSDESLYSMESGPFSRSFLYVRQDTGE---K 111
            W+  C S+I   +        W R+SKNL+DESLYS+E+  F +++LYV +  G     
Sbjct: 64  RWFGQCRSLIAKQRSSDDRIVSWSRISKNLTDESLYSIETSFFYKTYLYVHEWDGSVNPG 123

Query: 112 PISDIAISSDPLMIPVHVTQDINNLLQSSDSSVYHNHKFHQKGSSWRASWSWFWNSGKVL 171
           PIS++AIS D  MIP+ VTQD+  L+++SDSSV+HNH   ++    R    +F       
Sbjct: 124 PISELAISRDSSMIPIQVTQDVQRLIKTSDSSVFHNHVHRER----RPIIDFF------- 172

Query: 172 XXXXXXXXXXXXTMDDISLRGENWKYKGYGIWCKFDNTKEIVANIEIFLGSLFLESRPYW 231
                         D I   GE+WKYKG GIWCK  + ++ + NI+++LGS FLESRP W
Sbjct: 173 -------TRDHSDSDIIHSLGEDWKYKGGGIWCKHRSDQDPITNIQLYLGSGFLESRPNW 225

Query: 232 REVIHEFKPDDKLPLPISITVKIATNVKEETGEL-----NDGTLKMD------SKFKILQ 280
           +EVIHE+  +      + I+V    N   E GE      +D  L++          KILQ
Sbjct: 226 KEVIHEYSRNKGHKSQL-ISVTREINNGHEKGEQSVIIKDDDVLRISLSPHYGKSLKILQ 284

Query: 281 VSDVHFRSSINSMPMLKEYQTMQFITNTITRELPNLVIVTGDILDSTNSIDYQTCIMNLV 340
           +SD+HFR S +++ +L E+QT  FI+N I+RE P+LV+VTGD LD  NS+DYQ CIM LV
Sbjct: 285 ISDIHFRCSEDTIAVLSEFQTKHFISNVISRERPDLVVVTGDFLDGDNSLDYQACIMKLV 344

Query: 341 QPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKFSTDNGHLIIPLHKFNDPK 400
           QPMIK K PY IT G +DYS +A+  QI +FI  LPYSL ++++  GHL I  H     K
Sbjct: 345 QPMIKSKTPYAITTGVSDYSRFAAISQIQDFIKGLPYSLNRYASPEGHLAISSHF---SK 401

Query: 401 GEVSQDELMIYVIDSFHSIENDVKFKEIASKPVDWEYALAFRSLPIPQYRPDGLFPIIGQ 460
           G     +  IY++DSFH ++   +F  +      + YALAFR LPIP+YRP+G+FPIIGQ
Sbjct: 402 GT----DAAIYILDSFHPVK---QFFSMQKDYQTYRYALAFRHLPIPEYRPEGVFPIIGQ 454

Query: 461 YNERTSLELRENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQSKNEMWLCYGGS 520
           YNE++       V + + +   LQ  + S  VK++SCGHEH+NDCCLQS+ +MWLCYGGS
Sbjct: 455 YNEQSI------VKSKLFDDKILQKIMYSFNVKAMSCGHEHSNDCCLQSRGDMWLCYGGS 508

Query: 521 TGVGTKRMEGLFANVRLFDIDTDIGEITSWKRNMHLIDNVYDYQYIYK 568
            G+G  RM G+  +VRLF+ID D+ E+TSWKRN  LI++VYDYQYIY+
Sbjct: 509 AGIGIDRMNGMEPSVRLFNIDGDLDEVTSWKRNFRLIESVYDYQYIYQ 556

>YOR137C Chr15 complement(581813..583681) [1869 bp, 622 aa] {ON}
           SIA1Protein of unassigned function involved in
           activation of the Pma1p plasma membrane H+-ATPase by
           glucose
          Length = 622

 Score =  453 bits (1165), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 258/615 (41%), Positives = 357/615 (58%), Gaps = 95/615 (15%)

Query: 27  SLGSLRNHLKNVFRQDIPEEYTGGPITDIQCIPCFYWYQTCGSIIW-------------- 72
           S  SL+ H KNV       EY GG I DIQ + C++WY+ C S+                
Sbjct: 27  SRDSLKLHAKNVLMDHNVAEYHGGMIDDIQILRCYHWYRQCSSLYAPKLHPSNTAKKIKD 86

Query: 73  -NDQKWLRVSKNLSDESLYSMESGPFSRSFLYVR----QDTGEKPISDIAISSDPLMIPV 127
            N   W RVSKN++ E+LYS++SGPF  S+LYV     Q   +  I ++AI+ D  +IP+
Sbjct: 87  KNSILWTRVSKNITVETLYSLQSGPFYNSYLYVHLKDFQSNPKNTIKELAIARDSALIPL 146

Query: 128 HVTQDINNLLQSSDSSVYHNHKF--HQKGSSWRASWSWFWNSGKVLXXXXXXXXXXXXTM 185
            V +DIN L++SSDSSV+HNH +   +  SSW   W   +                    
Sbjct: 147 QVLRDINKLVKSSDSSVFHNHVYLREKPTSSW---WKLLFG--------------ISVDT 189

Query: 186 DDISLRGENWKYKGYGIWCKF----DNTKEIVANIEIFLGSLFLESRPYWREVIHEFKPD 241
           D+I++ GE W YKG GIWCK+    D+    + N+EI+LGS F+ESRP W+EVIHEF  +
Sbjct: 190 DNIAVFGEEWVYKGSGIWCKYILNDDDNDAPITNLEIYLGSSFIESRPSWKEVIHEFHRN 249

Query: 242 DKLPLPISITVKIAT---NVKEETGELNDGTLKMDSK----------------------- 275
           +   LPISIT K+ T   + K   G L  G+L+  SK                       
Sbjct: 250 NIPSLPISITRKLETKNHHHKFSNGLL--GSLRTPSKDINIQVDADYKITSPHIQFSRGQ 307

Query: 276 --FKILQVSDVHFRSSINSMPMLKEYQTMQFITNTITRELPNLVIVTGDILDSTNSIDYQ 333
             FKILQ++D HF+ + NSM ++ E +T+ FI   +  E P+LV++TGD+LDS N+IDYQ
Sbjct: 308 RSFKILQITDFHFKCTDNSMTVINEIKTVNFIDRVLASENPDLVVITGDLLDSHNTIDYQ 367

Query: 334 TCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKFSTDNGHLIIP- 392
           TCIM +VQPMI  KIPY I+LG +D S  A+  QI +FI  LPY+    +++ GH+ I  
Sbjct: 368 TCIMKVVQPMISNKIPYAISLGVSDESNLATSAQIRDFIRNLPYTFNNVASEEGHMAIEV 427

Query: 393 -----------LHKFNDPKGEVSQDELMIYVIDSFHSIENDVK-FKEIASKPVDWEYALA 440
                      L +  D + E +  E + +V DSF  + N ++ + ++  K    ++ LA
Sbjct: 428 SFKKKLTKNTLLERDIDTEDETNPSEALFFVFDSFAPVNNFLQDYNDLIGK---IDFGLA 484

Query: 441 FRSLPIPQYRPDGLFPIIGQYNERTSLEL-----RENVGTAVG--NVINLQDFLISKKVK 493
           F+  P+ +YRP GLFPIIGQYNER++L +     R  V   +   +  +  D L    +K
Sbjct: 485 FQYFPLSEYRPHGLFPIIGQYNERSTLTVDTPRSRGQVSMTINGKHYKSFLDILSLWNIK 544

Query: 494 SISCGHEHNNDCCLQSKNEMWLCYGGSTGVGTKRMEGLFANVRLFDIDTDIGEITSWKRN 553
            +SCGHEHNNDCCLQSKNEMWLCYGGS G+G  R++G++  VRLF++D  + EITSWKRN
Sbjct: 545 GVSCGHEHNNDCCLQSKNEMWLCYGGSAGIGLPRIQGIYPTVRLFNLDDILDEITSWKRN 604

Query: 554 MHLIDNVYDYQYIYK 568
            +L+D VYDYQYIYK
Sbjct: 605 SNLVDEVYDYQYIYK 619

>Skud_15.301 Chr15 complement(535844..537721) [1878 bp, 625 aa] {ON}
           YOR137C (REAL)
          Length = 625

 Score =  449 bits (1155), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 263/646 (40%), Positives = 362/646 (56%), Gaps = 97/646 (15%)

Query: 1   MRLKTRRIVKTSXXXXXXXXXXXXCNSLGSLRNHLKNVFRQDIPEEYTGGPITDIQCIPC 60
           MRL  RR V                 S  SLR + KNVF      EY GG I DIQ + C
Sbjct: 1   MRLHNRRKVNFLRRILFILCIFLLYLSRDSLRLNTKNVFINPKIAEYNGGTIDDIQILRC 60

Query: 61  FYWYQTCGSIIW------------NDQK---WLRVSKNLSDESLYSMESGPFSRSFLYVR 105
           ++WY+ CGS+               D+    W RVSKN++ ESLYS++SG F  S+LYV 
Sbjct: 61  YHWYRQCGSLYAPRLHPSTSAERVKDKSSVLWSRVSKNITVESLYSLQSGTFYNSYLYVH 120

Query: 106 ----QDTGEKPISDIAISSDPLMIPVHVTQDINNLLQSSDSSVYHNHKFHQKG--SSWRA 159
               Q   +  I ++A++ D  +IP+ V +DIN +++SSDSSV+HNH + ++   SSW  
Sbjct: 121 MKSFQGNSKNSIKELAMARDSALIPLQVLRDINKMVKSSDSSVFHNHVYRREKPTSSW-- 178

Query: 160 SWSWFWNSGKVLXXXXXXXXXXXXTMDDISLRGENWKYKGYGIWCKF----DNTKEIVAN 215
            W   +                    DDI++ GE W YKG GIWCKF    D+    + N
Sbjct: 179 -WKLLFG--------------ISVDSDDIAVFGEEWVYKGSGIWCKFILNDDDNDPPIIN 223

Query: 216 IEIFLGSLFLESRPYWREVIHEFKPDDKLPLPISITVKIATNVKE-----------ETGE 264
           +EI+LGS F+ESRP+W+EVIHEF  ++   +PISIT K  T               E  +
Sbjct: 224 LEIYLGSSFIESRPFWKEVIHEFHRNNMPSMPISITRKHETKNAHYKYPNKLPGSLEAPD 283

Query: 265 LNDGTLKM-------------------DSKFKILQVSDVHFRSSINSMPMLKEYQTMQFI 305
            N+  L++                      FKILQ++D HF+ + NSM ++ E +T+ FI
Sbjct: 284 KNNDALRLLQADEDYRITSSHIQYSWGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFI 343

Query: 306 TNTITRELPNLVIVTGDILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASR 365
              +  E P+LV++TGD+LDS NS+DYQTCIM LVQPMI  ++PY I+LG++D S +A+ 
Sbjct: 344 DRVLALEKPDLVVITGDLLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATL 403

Query: 366 DQIINFISTLPYSLTKFSTDNGHLIIP------------LHKFNDPKGEVSQDELMIYVI 413
            QI +FI  LPY+    ++  GH+ I             L K  D   E S  E + +V 
Sbjct: 404 SQIKDFIGNLPYAFNNIASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVF 463

Query: 414 DSFHSIEND--VKFKEIASKPVDWEYALAFRSLPIPQYRPDGLFPIIGQYNERTSLELRE 471
           DSF+ + ND  + + ++  K    +Y LAF+  P+ +YRP GLFPIIGQYNE+++L +  
Sbjct: 464 DSFNPV-NDFLLDYSDLIGK---IDYGLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVET 519

Query: 472 N-VGTAVGNVIN------LQDFLISKKVKSISCGHEHNNDCCLQSKNEMWLCYGGSTGVG 524
           +     V   IN        D L    +K + CGHEHNNDCCLQSKN+MWLCYGGS G+ 
Sbjct: 520 SRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQSKNDMWLCYGGSAGID 579

Query: 525 TKRMEGLFANVRLFDIDTDIGEITSWKRNMHLIDNVYDYQYIYKRE 570
             R+EG++ NVRLF++D  + EITSWKRN  ++D VYDYQYIYK E
Sbjct: 580 LPRIEGIYPNVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYIYKGE 625

>Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON}
           YOR137C (REAL)
          Length = 626

 Score =  438 bits (1126), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 261/616 (42%), Positives = 352/616 (57%), Gaps = 93/616 (15%)

Query: 27  SLGSLRNHLKNVFRQDIPEEYTGGPITDIQCIPCFYWYQTCGSI---------------I 71
           S  SL  + KN        EY GG I DIQ + C+ WY+ CGS+                
Sbjct: 27  SRDSLSLNAKNTLLSPNLTEYHGGLIDDIQVLRCYCWYRQCGSLYAPRLQPSGAGKKAKE 86

Query: 72  WNDQKWLRVSKNLSDESLYSMESGPFSRSFLYVR----QDTGEKPISDIAISSDPLMIPV 127
             +  W RVSKN+S E +YS+++G F  S+LYV     Q   +  I ++AI+ D  +IP+
Sbjct: 87  KKNVLWNRVSKNISVEPMYSLQTGIFYNSYLYVHAKNIQSKLKNSIKELAIARDSALIPL 146

Query: 128 HVTQDINNLLQSSDSSVYHNHKFHQKGSSWRASWSWFWNSGKVLXXXXXXXXXXXXTMDD 187
            V +DIN +++SSDSSV+HNH + +   +     S +W   K+L              DD
Sbjct: 147 QVLRDINKMVKSSDSSVFHNHVYQRDKPT-----SPWW---KLLLGIAVDS-------DD 191

Query: 188 ISLRGENWKYKGYGIWCKF----DNTKEIVANIEIFLGSLFLESRPYWREVIHEFKPDDK 243
           IS+ GE W YKG GIWCK+    D     + ++EI+LGS F+ESRP W+EVIHEF  ++ 
Sbjct: 192 ISVFGEEWVYKGNGIWCKYILNNDGNDLPIVDLEIYLGSSFIESRPNWKEVIHEFHRNNI 251

Query: 244 LPLPISITVKIATNVKEETGELND--GTLKM----------------------------- 272
             LPISIT KI T  +   G LN   G LK                              
Sbjct: 252 PSLPISITRKINT-PRTRHGPLNGLPGPLKSPENENNILRLLQVDEDYRITSPHIQFSKG 310

Query: 273 DSKFKILQVSDVHFRSSINSMPMLKEYQTMQFITNTITRELPNLVIVTGDILDSTNSIDY 332
              FKILQ++D HF+ + N M ++ E +T+ FI   +  E P+LV++TGD+LDS NS+DY
Sbjct: 311 QRSFKILQMTDFHFKCTENGMTIINEIRTVNFIDRMLALENPDLVVITGDLLDSANSMDY 370

Query: 333 QTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKFSTDNGHLIIP 392
           QTCIM LVQPMI  KIPY I+LG++D S+ AS  QI +FIS LPYS    +T+ GH+ I 
Sbjct: 371 QTCIMRLVQPMISNKIPYAISLGASDESKLASLPQIKDFISNLPYSFNHVATEEGHMAIQ 430

Query: 393 L------------HKFNDPKGEVSQDELMIYVIDSFHSIEND-VKFKEIASKPVDWEYAL 439
           +             +  D K E S  E + ++ DSF+ + +  + +  +  K    +Y L
Sbjct: 431 VSFKKKLLKHALFERETDAKYESSPSEALFFIFDSFNPVGDFLLDYSNLIGK---IDYGL 487

Query: 440 AFRSLPIPQYRPDGLFPIIGQYNERTSLEL-----RENVGTAVG--NVINLQDFLISKKV 492
            F+  PI +YRP GLFPIIGQYNER++L +     +  V   +G  +  +  D L    V
Sbjct: 488 TFQYFPISEYRPHGLFPIIGQYNERSTLTVDTARSKGEVSMTIGGKHYNSFLDILNLWNV 547

Query: 493 KSISCGHEHNNDCCLQSKNEMWLCYGGSTGVGTKRMEGLFANVRLFDIDTDIGEITSWKR 552
           K +SCGHEHNNDCCLQSKNEMWLCYGGS G+   RMEGL+ NVRLF++D  + EITSWKR
Sbjct: 548 KGVSCGHEHNNDCCLQSKNEMWLCYGGSAGMDVSRMEGLYPNVRLFNLDDIMDEITSWKR 607

Query: 553 NMHLIDNVYDYQYIYK 568
           + +L+D VYDYQYIYK
Sbjct: 608 SSNLVDEVYDYQYIYK 623

>Smik_15.317 Chr15 complement(543212..545092) [1881 bp, 626 aa] {ON}
           YOR137C (REAL)
          Length = 626

 Score =  438 bits (1126), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 254/618 (41%), Positives = 353/618 (57%), Gaps = 97/618 (15%)

Query: 27  SLGSLRNHLKNVFRQDIPEEYTGGPITDIQCIPCFYWYQTCGSIIW-------------- 72
           S  SL+ H KN        EY  G I DIQ + C++WY+ CGS+                
Sbjct: 27  SRDSLKLHAKNALINPNTAEYHEGMIDDIQVLRCYHWYRQCGSLYAPRLHPSNTASKVKD 86

Query: 73  -NDQKWLRVSKNLSDESLYSMESGPFSRSFLYVR----QDTGEKPISDIAISSDPLMIPV 127
            N+  W RVSKN++ E+LYS++SG F  S+LYV     Q      I ++AI+ D  +IP+
Sbjct: 87  KNNVLWSRVSKNITIEALYSLQSGAFYNSYLYVHPKGFQSNSRNSIKELAIARDSALIPL 146

Query: 128 HVTQDINNLLQSSDSSVYHNHKFHQKG--SSWRASWSWFWNSGKVLXXXXXXXXXXXXTM 185
            V +DIN +++SSDSSV+HNH + ++   SSW   W   +                    
Sbjct: 147 QVLRDINKMVKSSDSSVFHNHVYQREKPTSSW---WKLLFG--------------ISVDS 189

Query: 186 DDISLRGENWKYKGYGIWCKF----DNTKEIVANIEIFLGSLFLESRPYWREVIHEFKPD 241
           DDI++ GE W YKG GIWCK+    D++   + ++EI+LGS F+ESRP W+EV+HEF  +
Sbjct: 190 DDIAVFGEEWVYKGSGIWCKYVLNDDDSDPPIISLEIYLGSSFIESRPSWKEVMHEFHRN 249

Query: 242 DKLPLPISITVKIATN------VKEETGELN--------------DGTLKMDS------- 274
           +   LPISIT K+ T        K  TG L               DG  K+ S       
Sbjct: 250 NIPSLPISITRKLKTKNNLHKASKRLTGPLKAPEKDNNILELLQVDGNYKITSPHIQFSR 309

Query: 275 ---KFKILQVSDVHFRSSINSMPMLKEYQTMQFITNTITRELPNLVIVTGDILDSTNSID 331
               FKILQ++D HF+ + NSM ++ E +T+ FI   +  E P+LV++TGD+LDS N+ID
Sbjct: 310 GQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALENPDLVVITGDLLDSQNTID 369

Query: 332 YQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKFSTDNGHLII 391
           YQTCIM LVQPMI  KIPY I+LG +D S  A+  Q+ ++I  LPY+    +++ GH+ I
Sbjct: 370 YQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVASEEGHIAI 429

Query: 392 PLH------------KFNDPKGEVSQDELMIYVIDSFHSIEND--VKFKEIASKPVDWEY 437
            +             +  + K E +  E + +V DSF+ + ND  + +  +  K    +Y
Sbjct: 430 RVSFKKKLLKNTLLKRGINAKDETTPSEALFFVFDSFNPV-NDFLLDYSNLIGK---IDY 485

Query: 438 ALAFRSLPIPQYRPDGLFPIIGQYNERTSLEL-----RENVGTAVG--NVINLQDFLISK 490
            LAF+  P+ +YRP GLFPIIGQYNER++L +     +  V   +   N  +  D L   
Sbjct: 486 GLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLDILNLW 545

Query: 491 KVKSISCGHEHNNDCCLQSKNEMWLCYGGSTGVGTKRMEGLFANVRLFDIDTDIGEITSW 550
            +K +SCGHEHNNDCCLQS NEMWLCYGGS G+   R+EG+  NVRLF++D    EITSW
Sbjct: 546 NIKGVSCGHEHNNDCCLQSINEMWLCYGGSAGIDVARIEGIHPNVRLFNLDDIKDEITSW 605

Query: 551 KRNMHLIDNVYDYQYIYK 568
           KR+ +L+D VYDYQYIYK
Sbjct: 606 KRSSNLVDEVYDYQYIYK 623

>TBLA0A02550 Chr1 (616882..618618) [1737 bp, 578 aa] {ON} Anc_5.474
           YOR137C
          Length = 578

 Score =  378 bits (970), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 222/594 (37%), Positives = 338/594 (56%), Gaps = 59/594 (9%)

Query: 6   RRIVKTSXXXXXXXXXXXXCNSLGSLRNHLKNVFRQDIPEEYTGGPITDIQCIPCFYWYQ 65
           R+++K              C +   LR    NV  Q    EY GG I DI+ + C+ WY+
Sbjct: 5   RKLLKVFKKTTYLTTFLLLCIAWSRLRLFFLNVKSQPNAVEYNGGLIDDIKLMKCYRWYK 64

Query: 66  TCGSIIWNDQK-------WLRVSKNLSDESLYSMESGPFSRSFLYVR-------QDTGEK 111
            C ++             W RVSKN++D SLY++ES     +F YV        ++  ++
Sbjct: 65  NCETLYAQSAVHDNSFVLWNRVSKNMTDSSLYAIESNWLYETFFYVHLFNTNANKEDEKQ 124

Query: 112 PISDIAISSDPLMIPVHVTQDINNLLQSSDSSVYHNHKFHQKGSSWRASWSWFWNSGKVL 171
           P++DIA+S DP ++P+ V Q++   L+SSDS + +   ++QK +SW   W  FWN+    
Sbjct: 125 PLADIAVSRDPSLVPLTVLQEVMPSLRSSDSMMGNKRLYYQK-TSW---WYRFWNNP--- 177

Query: 172 XXXXXXXXXXXXTMDDISLRGENWKYKGYGIWCKFDNTKEIVANIEIFLGSLFLESRPYW 231
                           ++L  + WK+    +W K  +   ++ NI+++LGS F+ESRP+W
Sbjct: 178 ------------LPTKMNLMNK-WKHNNDILWSKIQHDSCLITNIQLYLGSNFVESRPFW 224

Query: 232 REVIHEFKPDDKLPLPISITVKIA-------TNVKEETGELNDGTLKMDSKFKILQVSDV 284
           +E+IHE   +D   +PISIT K+        T  K      +   LK  S  KILQ+SD+
Sbjct: 225 KEIIHELHNEDGNSIPISITRKVECGFDANHTFPKNTINNKDLLQLKQKSDLKILQLSDI 284

Query: 285 HFRSSINSMPMLKEYQTMQFITNTITRELPNLVIVTGDILDSTNSIDYQTCIMNLVQPMI 344
           H + +  +  +L E+Q+  FI+  I  E P+LV++TGDILD   S+DYQTCI+N+VQP+I
Sbjct: 285 HIKGNEENSAILGEFQSRIFISRIIDIERPDLVVITGDILDGNKSVDYQTCILNVVQPII 344

Query: 345 KFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKFSTDNGHLIIPLHKF----NDPK 400
           + +IP++I+ G+ D+S+YA++ +I +F++ +PY L K S  NGHL IP + F    ND K
Sbjct: 345 RAQIPFVISFGAKDFSKYATQQEITDFVNQIPYCLNKNSDSNGHLTIP-YNFSTIPNDSK 403

Query: 401 GE----VSQDELMIYVIDSFHSIENDVK-FKEIASKPVDWEYALAFRSLPIPQYRPDGLF 455
            +    ++Q++L I++ +S  S     K +  +   P   + ALAF+ LPIP YR  G+F
Sbjct: 404 DDYSNLITQNDLAIFIFNSKTSKRQFFKDYISLYKSPP--KLALAFQYLPIPTYRLSGVF 461

Query: 456 PIIGQYNERTSLELRENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQSKNEMWL 515
           PIIGQYNER  L           N  NL +++    +K++SCG +H+NDCCLQS +++WL
Sbjct: 462 PIIGQYNERNLLP------EGFDNDDNLINYMHEMNIKALSCGFDHSNDCCLQSIHDIWL 515

Query: 516 CYGGSTGVGTKRMEGLFANVRLFDIDTDIGEITSWKRNMHLIDNVYDYQYIYKR 569
           CY G+TG+       +  +VRLF +D     ITSWKRN + ID VYDYQYIY +
Sbjct: 516 CYSGATGLTAPHSIFMPPSVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIYNQ 569

>KLTH0F15026g Chr6 (1230760..1232484) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q12212 Saccharomyces cerevisiae YOR137C SIA1
           Suppressor of eIF5A High-copy suppressor of
           temperature-sensitive tif51A-1
          Length = 574

 Score =  359 bits (922), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 227/605 (37%), Positives = 334/605 (55%), Gaps = 78/605 (12%)

Query: 3   LKTRRIVKTSXXXXXXXXXXXXC-NSLGSLRNHLKNVFRQDIP-EEYTGGPITDIQCIPC 60
           LK RR++  +            C  +   ++ H  N+F+     E YTGG I D++ + C
Sbjct: 6   LKRRRMLHNAVRKILIPVFILFCLATCIPVKTHFANIFQPPTKLEGYTGGLIDDVRFLKC 65

Query: 61  FYWYQTCGSIIWNDQK------WLRVSKNLSDESLYSMESGPFSRSFLYVRQDTGEKP-I 113
           F WY+ C  I+    +      W+RV K L +E LYS++SG F RS+LYV    G K  +
Sbjct: 66  FRWYKDCDVILEKRGRNGEFVPWMRVRKELDEEKLYSVDSGLFYRSYLYVHPCDGNKDCV 125

Query: 114 SDIAISSDPLMIPVHVTQDINNLLQSSDSSVYHNHKFHQKGSSWRASWSWFWNSGKVLXX 173
           SD+AI+ D   IP+ V QDIN  +QS DSS++H H+ H      +  W+  +   +    
Sbjct: 126 SDLAIAKDRSSIPMQVLQDINAKIQSKDSSMFHGHEHH------KTFWTRIFGGRR---- 175

Query: 174 XXXXXXXXXXTMDDISLRGENWKYKGYGIWCKFDNTKEI-----VANIEIFLGSLFLESR 228
                       + +SL+GE+W Y+ +GIWCK+ ++ +I     + N++IFLGS F++ R
Sbjct: 176 ------------ERLSLQGEDWHYRRHGIWCKYSSSNKIDEGQSITNLQIFLGSGFVDPR 223

Query: 229 PYWREVIHEF-KPDDKLPLPISITVKIATNVKEETGELNDGTLKMD-SKFKILQVSDVHF 286
           P W+  IHE    + + P PISI+++      +      +G L  D  KFKILQVSD+H 
Sbjct: 224 PMWKTAIHEMDHRNSESPTPISISIQKYDKSMDSRFVTENGILNADDGKFKILQVSDLHV 283

Query: 287 RSSIN---SMPMLKEYQTMQFITNTITRELPNLVIVTGDILDSTNSIDYQTCIMNLVQPM 343
            ++I    S     E++T +FI+  I  E P+LV+ TGD ++   + DYQT I+   + +
Sbjct: 284 SNAIERCESHLCTNEWKTQRFISRIIELETPDLVVFTGDFINGPETTDYQTAILKATECV 343

Query: 344 IKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKF---STDNGHLI-----IPLHK 395
           I  KIP+ +T G+ DYS+YAS   I NFI +LPY+L         +  LI     + L +
Sbjct: 344 ISAKIPWAMTWGTLDYSKYASERDIFNFIKSLPYNLNYLHAKQVQDASLITTTFALQLKR 403

Query: 396 FNDPKGEVSQDELMIYVIDSFHSIENDVKF----KEIASKPVDWE--YALAFRSLPIPQY 449
            N+  G       ++Y++DS +  EN V F     E ASK  D +  Y+LAF+  PIP+Y
Sbjct: 404 DNEIFG-------VVYILDSTNP-ENAVDFLKTAYENASKNSDRDTLYSLAFQHAPIPEY 455

Query: 450 RPDGLFPIIGQYNERTSLELRENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQS 509
           RP G FPIIG YN+++ L++ +     VG    L DF    K+ + SCG EH NDCCLQS
Sbjct: 456 RPSGSFPIIGSYNDKSPLDVPQ-----VGIRKALDDF----KIHAFSCGQEHGNDCCLQS 506

Query: 510 KN-----EMWLCYGGSTG-VGTKRMEGLFANVRLFDIDTDIGEITSWKRNMHLIDNVYDY 563
            +     ++WLCYGG  G VG    E   ++VRLF ID  + EIT+WKRN    D+VYDY
Sbjct: 507 SDSNSNKDVWLCYGGHAGVVGRYSPEDSASSVRLFRIDDSLKEITTWKRNSREPDSVYDY 566

Query: 564 QYIYK 568
           Q+++K
Sbjct: 567 QFLFK 571

>SAKL0G03542g Chr7 complement(292214..293938) [1725 bp, 574 aa] {ON}
           similar to uniprot|Q12212 Saccharomyces cerevisiae
           YOR137C SIA1 Suppressor of eIF5A High-copy suppressor of
           temperature-sensitive tif51A-1
          Length = 574

 Score =  358 bits (920), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 218/614 (35%), Positives = 327/614 (53%), Gaps = 92/614 (14%)

Query: 3   LKTRRIVKTSXXXXXXXXXXXXCNSLGSLRNHLKNVFRQDIPEEYTGGPITDIQCIPCFY 62
           L+ RR++KT               S  ++     N F++    +Y GG I D++ I C+ 
Sbjct: 4   LQHRRVLKTCKKVLLPIVLLVVLLSHSAIHKQWINTFKKGHDVQYQGGLIDDVRFIKCYR 63

Query: 63  WYQTCGSIIWNDQ-------KWLRVSKNLSDESLYSMESGPFSRSFLYVRQDTGE----- 110
           WY  C +I ++ Q       +W RV K + D +LY++ SG    ++LYV           
Sbjct: 64  WYSHCDTI-YDKQHSNGPLIQWKRVHKKMRDSNLYAINSGMLYSTYLYVHSAKKTTFGTT 122

Query: 111 KPISDIAISSDPLMIPVHVTQDINNLLQSSDSSVYHNHKFHQKGSSWRASWSWFWNSGKV 170
           + I+D+AI+ +  ++P+HV +D+N  ++SSD+SV+HNH++ Q+      SWS F      
Sbjct: 123 RAITDLAIAREKTVVPLHVLKDVNLQIRSSDNSVFHNHEYPQE-----FSWSIFGKGSPT 177

Query: 171 LXXXXXXXXXXXXTMDDISLRGENWKYKGYGIWCKFDNTKE-----IVANIEIFLGSLFL 225
           L            ++DD     E+W+YK  GIWCK+   +E      + N++I+LG  F+
Sbjct: 178 L------------SVDD-----EDWEYKSDGIWCKYSLIQEGSDDTALTNLQIYLGDDFI 220

Query: 226 ESRPYWREVIHEFKPDDKLPLPISITVKIATNVKEETGELNDG-----TLKMDSK-FKIL 279
           ESRP W+E IH         L I       T+ +    EL D      TL + S+ FKIL
Sbjct: 221 ESRPMWKEAIHGKSRGRLAALSI-------TSERFNKNELVDNVHIANTLSLKSQGFKIL 273

Query: 280 QVSDVHFRSSI---NSMPMLKEYQTMQFITNTITRELPNLVIVTGDILDSTNSIDYQTCI 336
           Q+SD+H+ S +   N  P L ++QT  FI+  I RE P+LV++TGDILD  N++DY+T +
Sbjct: 274 QLSDLHYSSGMGVCNEPPCLADFQTRNFISTVIDREKPDLVVITGDILDGVNTLDYETAL 333

Query: 337 MNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKFSTDNG--------- 387
           +  VQPM+  + PY I  G  D+S  A++  I+ FI +LP+ +   + D+          
Sbjct: 334 LKAVQPMVSSRTPYAIAFGLQDFSTQATKRDILEFIGSLPFCMNSVNNDSNVINLDKHSF 393

Query: 388 ---HLIIPLHKFNDPKGEVSQDELMIYVIDSF-----HSIENDVKFKEIASKPVDWEYAL 439
              ++ +P+HK  +  G       M+YV+DS       S   +     + SK     Y+ 
Sbjct: 394 YTTNIALPIHKGEEISG-------MVYVLDSTDVESQDSFLRNAHASALLSKHTKPMYSF 446

Query: 440 AFRSLPIPQYRPDGLFPIIGQYNERTSLELRENVGTAVGNVINLQDFLISKKVKSISCGH 499
           AF+ LP  +YRP GLF IIG YNE+  L       + V     L+D L   KV+ +SCG+
Sbjct: 447 AFQHLPTIEYRPTGLFAIIGSYNEKKQL-------SDVIPRTKLRDTLGELKVQVLSCGY 499

Query: 500 EHNNDCCLQS-----KNEMWLCYGGSTGVGTKRMEGLFANVRLFDIDTDIGEITSWKRNM 554
           EH NDCCL S       E+WLCYGG +G+   ++EG+  N+RLF ID + GEITSWKR++
Sbjct: 500 EHGNDCCLHSTGPEYTGELWLCYGGVSGLSGYQIEGMSPNIRLFGIDDEKGEITSWKRSL 559

Query: 555 HLIDNVYDYQYIYK 568
              + VYDYQYIYK
Sbjct: 560 ANPEEVYDYQYIYK 573

>Kwal_55.21268 s55 (759935..761641) [1707 bp, 568 aa] {ON} YOR137C
           (SIA1) - High-copy suppressor of temperature-sensitive
           tif51A-1 [contig 130] FULL
          Length = 568

 Score =  356 bits (914), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 215/595 (36%), Positives = 324/595 (54%), Gaps = 63/595 (10%)

Query: 3   LKTRRIVKTSXXXXXXXXXXXXCNSLGSLRNHLKNVFRQDIPEE-YTGGPITDIQCIPCF 61
           L+ RR++KT              +  G ++    N   Q    + Y GG I D++ I CF
Sbjct: 6   LQRRRVLKTVLRVLIPVISVLCISFYGVIKIQFVNWLNQGFEAKGYEGGTIDDVKFIKCF 65

Query: 62  YWYQTCGSIIWNDQ------KWLRVSKNLSDESLYSMESGPFSRSFLYVRQDTG-EKPIS 114
            W+  C  +            WLRV K+L+D+SLY+++ G    ++LYV  + G +  IS
Sbjct: 66  RWFGDCNVVFERHSLRDEILPWLRVGKSLNDDSLYAVDRGLLHHTYLYVHPNDGTQDSIS 125

Query: 115 DIAISSDPLMIPVHVTQDINNLLQSSDSSVYHNHKFHQKGSSWRASWSWFWNSGKVLXXX 174
           D+AI+ D   +PV V QD+N+  +  DSS++H+H  H      ++ WSW   SG      
Sbjct: 126 DLAIARDESNVPVQVLQDVNSRAKFKDSSMFHDHDHH------KSIWSWIRGSG------ 173

Query: 175 XXXXXXXXXTMDDISLRGENWKYKGYGIWCKFD-----NTKEIVANIEIFLGSLFLESRP 229
                        +SLRGE+W YKG+G+WCK+      + + ++ +I+ F+G  F+E RP
Sbjct: 174 ----------FHSLSLRGEDWHYKGHGVWCKYSSKSRLDDEAVITDIQTFIGYGFVEPRP 223

Query: 230 YWREVIHEFKPDDK-LPLPISITVKIATNVKEETGELNDGTLKM-DSKFKILQVSDVHFR 287
            W+  IHE     + L   IS +++I+          ++  L++ D +FKILQ+SDVH  
Sbjct: 224 MWKVAIHEMNNFGRDLQQSISFSIQISDKEAHIDPSASNIDLQLRDGEFKILQLSDVHVS 283

Query: 288 SSINSMPMLK--EYQ-TMQFITNTITRELPNLVIVTGDILDSTNSIDYQTCIMNLVQPMI 344
           S + +  + K   YQ T  F++  I  E P++VI TGD +D  N+IDYQT I+   + +I
Sbjct: 284 SDLANCDVEKCTNYQKTKMFVSRVIQLERPDMVIFTGDFIDGPNAIDYQTAILKAAETVI 343

Query: 345 KFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKFSTDNGHLIIPLHKFND-PKGEV 403
             +IP+ +T GS+DYS+YAS+ QI+ ++ TLP+ L + S   G  +     FN  P    
Sbjct: 344 SAEIPWAVTWGSSDYSKYASKRQILQYLETLPFCLNRLSFGKGDKVSGNTTFNSFPLNNG 403

Query: 404 SQDEL-MIYVIDSFHSIENDVKFKEIASKPVDWE------YALAFRSLPIPQYRPDGLFP 456
           S  ++ +IY +DS  S EN  +F   A K V         Y+LAF+  PIP+YRP G FP
Sbjct: 404 SDSQVGLIYTLDS-TSDENAAEFVRSAYKDVIEHTNRKPLYSLAFQHSPIPEYRPKGPFP 462

Query: 457 IIGQYNERTSLELRENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQS-----KN 511
           IIG YN++  L++ +         + +++ L   +++++SC  EH NDCCLQS     K 
Sbjct: 463 IIGSYNDKDPLDVPQ---------LGIREALEDAEIQAMSCSQEHGNDCCLQSSGPDCKK 513

Query: 512 EMWLCYGGSTGVGTKRMEGLFANVRLFDIDTDIGEITSWKRNMHLIDNVYDYQYI 566
           ++WLCYGG TGV    +    ANVRLF ID +  EIT+WKRN    D VYDYQY+
Sbjct: 514 DVWLCYGGHTGVAGHYVSEKMANVRLFRIDDNAKEITTWKRNSLSPDAVYDYQYL 568

>KLLA0E03147g Chr5 complement(290622..292358) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|Q12212 Saccharomyces
           cerevisiae YOR137C SIA1 Suppressor of eIF5A High-copy
           suppressor of temperature-sensitive tif51A-1
          Length = 578

 Score =  225 bits (574), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 178/616 (28%), Positives = 293/616 (47%), Gaps = 93/616 (15%)

Query: 3   LKTRRIVKTSXXXXXXXXXXXXCNSLGSLRNHLKNVFRQDIPE-------EYTGGPITDI 55
            + RRI+  +              S   ++ HLKN   Q  P+       + TG  + D+
Sbjct: 2   FRNRRILLYARRFFLVWICFLFITSWSLIQRHLKNWLVQ-APDLKLSGSLQDTGIKVRDV 60

Query: 56  QCIPCFYWYQTCGSIIWNDQ------KWLRVSKNLSDESLYSMESGPFSRSFLY---VRQ 106
           +   C+ W+  C +I W+         W R+      ++  S+  G    S++Y   +  
Sbjct: 61  RISKCYSWFSNCDAI-WDYSLQDDLVTWYRIDMGKMQDT--SIGQGFGWTSYVYWQPLYP 117

Query: 107 DTGEKPISDIAISSDPLMIPVHVTQDINNLLQSSDSSVYHNH-----KFHQKGSS---WR 158
           +     + D+A+S + L  P+ +  +  N ++++D   YH H     +F+ K  S   + 
Sbjct: 118 NERGSAVVDLALSRNGL--PLGLANERYNKIKNNDIDGYHVHSNTDNEFYVKDDSSNRFN 175

Query: 159 ASWSWFWNSGKVLXXXXXXXXXXXXTMDDISLRGENWKYKGYGIWCKFDNTKEIVANIEI 218
               W    G  L                     E+W ++G GIWCK+      +  I+ 
Sbjct: 176 PDMKWSAKFGNHL---------------------EDWFWRGDGIWCKYGRRSNGIKEIKA 214

Query: 219 FLGSLFLESRPYWREVIHEFKPDDKLPLPISITVK------IATNVKEETGELNDGTLKM 272
           F+G  F+ESRP W+E++H    +     PISI+ +           +++  ++++ +L M
Sbjct: 215 FIGEDFIESRPMWKEMVHCLHREG-YSKPISISFQKSRLDDFTYGKEKDLSQISEPSLVM 273

Query: 273 D-SKFKILQVSDVHFRSSINSMPMLK--------EYQTMQFITNTITRELPNLVIVTGDI 323
             + FKILQ+SD+HF   I S    +        ++  +QFI + I  E P+L ++TG I
Sbjct: 274 KRADFKILQISDLHFGRHIVSDSRKEKPDSIFRYDWPNVQFIHSVIRNERPDLAVITGHI 333

Query: 324 L-DSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKF 382
             D   ++DY++ I+ +V P+I   IP++ T G    +    +  I+NFI +LP+ L KF
Sbjct: 334 FKDFNKNLDYESQILKMVSPIISNGIPFLFTWGEPQVTT-EFKVNILNFIKSLPFCLNKF 392

Query: 383 STDNG-HLIIPLHKFNDPKGEVSQDEL-MIYVIDSFHSIENDVKFKEIASKPVDWEYALA 440
              N  +L++PL      K   SQ ++  I+  DS  ++     F +   +     Y LA
Sbjct: 393 DLKNSTYLMLPL--LLPAKTPGSQKQIGTIFAFDS--NVTESYNFLDKFPRSPQSVYNLA 448

Query: 441 FRSLPIPQYRPDGLFPIIGQYNERTSLELRENVGTAVGNVINLQDFLISKKVKSISCGHE 500
           F+ LP+ +YRP G F +IG Y ++ SL+        + +    ++ L  K +K+ISCGHE
Sbjct: 449 FQHLPLHEYRPQGSFALIGNYEQKGSLDY-------IPHTKAFRNLLGEKDIKAISCGHE 501

Query: 501 HNNDCCLQS-------KNEMWLCYGGSTGVGTKRMEGLFANVRLFDIDTDIGEITSWKRN 553
           H NDCC+ S       KN MWLCYGG TG      +   + VR+F IDT+  +ITSWKR+
Sbjct: 502 HGNDCCVLSDGKQQNLKNNMWLCYGGVTGYD----QAYESKVRIFKIDTEKNDITSWKRS 557

Query: 554 MHLIDNVYDYQYIYKR 569
           +     V DYQYI+ R
Sbjct: 558 IKDTSKVSDYQYIWSR 573

>KNAG0B05860 Chr2 complement(1152991..1154748) [1758 bp, 585 aa]
           {ON} Anc_4.200 YLR361C
          Length = 585

 Score =  117 bits (293), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 111/424 (26%), Positives = 183/424 (43%), Gaps = 82/424 (19%)

Query: 207 DNTKEIVANIEIFLGSLFLESRPYWREVIHEFKPDDKLPLPISITVKIATNV------KE 260
           +N    V +I +  G   ++ R  W  +       DK PLP+S + +    V      + 
Sbjct: 168 ENNLPCVTDITVLFGEDCVDPRSEWNLL------RDK-PLPVSSSTRRNDPVDCYLSYRS 220

Query: 261 ETGELNDGTLKMDS--KFKILQVSDVHF------------RSSINSMPMLKEYQTMQFIT 306
             G      LK+D+  +FK++Q++D+H               S +  P L + +T+ F+ 
Sbjct: 221 GGGRWARPVLKLDAAGQFKVVQLADLHMGVGPGKCIDEFPEHSKSEGPCLADPKTLTFVE 280

Query: 307 NTITRELPNLVIVTGD-ILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASR 365
           + +  E P LV+ TGD I+   +  D +T ++  + P+++  IP+ +  G+ D     SR
Sbjct: 281 SVLDTESPQLVVFTGDQIMGDKSRYDSETTLLKALAPVLERHIPWCLVWGNHDDEGSLSR 340

Query: 366 DQIINFISTLPYSLTKFST-DNGHLIIPL----HKFNDPKGEVSQDELMIYVIDSFHSIE 420
            ++  F  TLP SL K S  D G     +    H+     GE  +  + +Y +DS H   
Sbjct: 341 WELSRFAETLPLSLFKISPRDTGDSSFGVGNYFHQVFSDNGE-EKPAITLYFLDS-HKYS 398

Query: 421 NDVKFKEIAS--KPVDWEY-------------------------ALAFRSLPIPQY---- 449
              K        K   W+Y                         ++AF  +P+P+Y    
Sbjct: 399 RTGKLYPGYDWIKEAQWDYVKQLYDKAIAPFADAATETSQERQLSMAFFHIPLPEYGDFQ 458

Query: 450 ---RPDGLFPIIGQYNERTSLELRENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCC 506
               P    P++GQ+ E  +     +     G +  LQ      +V++ SCGH+H ND C
Sbjct: 459 SQSNPAEQNPMLGQHKEGLTAPKYNS-----GGLTTLQHM----RVQATSCGHDHCNDYC 509

Query: 507 LQ---SKNEMWLCYGGSTGVGTKRMEGLFA-NVRLFDIDTDIGEITSWKRNMHLIDNVYD 562
           LQ   + +++WLC+GGS G G     G     +R F+ DT  G I +WKR      N +D
Sbjct: 510 LQDDSTGDKIWLCFGGSAGEGAYAGYGGTERRIRTFNFDTTSGRIETWKRLNGSPQNAFD 569

Query: 563 YQYI 566
           YQ +
Sbjct: 570 YQVL 573

>Ecym_2455 Chr2 complement(885426..887144) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii ABL009W
          Length = 572

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 102/402 (25%), Positives = 176/402 (43%), Gaps = 63/402 (15%)

Query: 211 EIVANIEIFLGSLFLESRPYWREVIHEFKPDDKLPLPISITVKIATNVKEETGELNDGTL 270
           E V+ I +  G   ++ R  W  +   +K  D+   P  +++K     K   G   D  +
Sbjct: 182 EYVSGINVLFGEDCVDPRVNWN-LEKGWKLADRY-YPSYLSIKRIQVRKGTPGV--DLRV 237

Query: 271 KMDSKFKILQVSDVHFR----SSINSMPMLK----EYQTMQFITNTITRELPNLVIVTGD 322
             +  FK++Q++D+HF        +  P  +    + +T+ F+   +  E P+L++ TGD
Sbjct: 238 NEEGNFKVVQLADLHFGVGKGECKDEFPTTENCEADPKTLNFVETVLEIENPDLIVFTGD 297

Query: 323 ILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKF 382
            ++     D +T ++  + P I+  IPY +  G+ D S    R ++  ++  LPYSL K 
Sbjct: 298 QIEGEWEQDSETALLKALGPAIRRGIPYAVIWGNHDDSGSMDRQELSKYVYQLPYSLFKI 357

Query: 383 STDNG-----HLIIPLHKFNDPKGEVSQDELMIYVIDSFHSIEN-DVKF----------- 425
           +  +G          + + +D  G  +   +  Y +DS     N  V F           
Sbjct: 358 NPRDGLRNDFGFGNYVLQVDDRDGSPA---ITFYFLDSHKRSPNPKVYFGYDWIKEEQLN 414

Query: 426 -------KEIASKPVDWEYALAFRSLPIPQY-------RPDGLFPIIGQYNERTSLELRE 471
                  K +A K  D   ++AF  +P+P+Y         +     IG + E  +   R 
Sbjct: 415 YLEEYYTKNLADKHTD--LSMAFIHIPLPEYLNFQSVRNDEQQNEKIGSFKEGITAP-RY 471

Query: 472 NVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQS-----KNEMWLCYGGSTG-VGT 525
           N GTA        D L+  KV ++S GH+H ND CL++      + +WLCYGG+ G  G 
Sbjct: 472 NSGTA--------DVLVKLKVSAVSVGHDHCNDYCLETDFLSHSDSLWLCYGGAVGERGY 523

Query: 526 KRMEGLFANVRLFDIDTDIGEITSWKRNMHLIDNVYDYQYIY 567
               G    +R+F+ +     I +WKR     D  +D+Q I+
Sbjct: 524 AGYGGTERRIRIFEFNAKKKVINTWKRLHGSPDRKFDFQIIH 565

>SAKL0B05038g Chr2 complement(434061..435833) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q05924 Saccharomyces cerevisiae
           YLR361C DCR2 Protein involved in cell cycle regulation
          Length = 590

 Score =  104 bits (260), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 113/412 (27%), Positives = 181/412 (43%), Gaps = 81/412 (19%)

Query: 212 IVANIEIFLGSLFLESRPYWREVIHEFKPDDKLPLPISITVKIATNVKEETGELNDGTLK 271
            ++ I +  G   ++ +P W      +    K P  I+     + N      E  D +LK
Sbjct: 194 FLSEINVLFGEDCVDPKPDWTLNKEWYITSRKYPSFITTKRLTSKN------EAFDVSLK 247

Query: 272 MDS--KFKILQVSDVHFR----SSINSMPML----KEYQTMQFITNTITRELPNLVIVTG 321
           M+S  KFKI+Q++D+HF        +  PM      + +T++FI   + RE P+LV+ TG
Sbjct: 248 MNSRGKFKIVQLADLHFSVGKGKCRDEFPMHDSCEADPKTLEFINRVLDREKPHLVVFTG 307

Query: 322 D-ILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLT 380
           D I+ +    D +T ++ +++P+I  KIP+ +  G+ D     SR ++   ++ LPYS+ 
Sbjct: 308 DQIMGNECKQDSETALLKVLEPVITRKIPFAMVWGNHDDEGSLSRWEMSQIVAKLPYSIF 367

Query: 381 KFSTDNGHLIIPLHKFNDPKGEV-----------SQDELMIYVIDSFHSIENDVKFKEIA 429
           + S          H   D K  +           +Q  + +Y +DS     N   F    
Sbjct: 368 RLSQ---------HDTKDSKFGLGNYIQQIFTSENQPAISLYFLDSHKYSSNPKIFPGYD 418

Query: 430 -SKPVDWEY---------------------ALAFRSLPIPQY-------RPDGLFPIIGQ 460
             K   W+Y                     ++AF  +P+P+Y        PD    +IG 
Sbjct: 419 WIKEEQWDYMRNYYETNLKKANEAYGGNHLSMAFFHIPLPEYLHFQSQQEPDKQNLVIGN 478

Query: 461 YNERTSLELRENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQ----SKNE-MWL 515
           Y E  +     +     G +  L D     KV ++S GH+H ND CL     SK+E +WL
Sbjct: 479 YKEGITAPKYNS-----GGLKALHDL----KVSAVSVGHDHCNDYCLLEDSISKDEKIWL 529

Query: 516 CYGGSTGVGTKRMEGLFA-NVRLFDIDTDIGEITSWKRNMHLIDNVYDYQYI 566
           CYGG  G G     G     +R+F+IDT    I +WKR     D ++D+Q I
Sbjct: 530 CYGGGGGEGGYAGYGGTERRIRIFEIDTQGNSIYTWKRLNGTPDEIFDHQTI 581

>NCAS0J01220 Chr10 complement(212622..214373) [1752 bp, 583 aa] {ON}
           Anc_4.200
          Length = 583

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 108/401 (26%), Positives = 179/401 (44%), Gaps = 62/401 (15%)

Query: 213 VANIEIFLGSLFLESRPYWREVIHEFKPDDKLPLPISITVKIATNVKEETGELNDGTLKM 272
           + ++ +  GS  ++ RP W  V+++     +   P  ++ ++  N           TLK 
Sbjct: 189 ITDLTLLFGSDCVDPRPGW--VLNKNWTYSEYRFPSYLSTRLYNNANPRQAR---PTLKE 243

Query: 273 DS--KFKILQVSDVHFRSSIN----SMPMLK----EYQTMQFITNTITRELPNLVIVTGD 322
           DS  KFKI+Q++D+H    IN      P  +    + +T++F+   +  E P LV+ TGD
Sbjct: 244 DSSGKFKIVQLADLHMGVGINKCEDEFPKHEHCEADPKTIEFVKKVLELEDPQLVVFTGD 303

Query: 323 ILDSTNSI-DYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTK 381
            +    SI D +T ++  + P++K KIP+ +  G+ D     +R ++    + LPYSL +
Sbjct: 304 QIMGDRSIQDSETTLLKAIAPVVKRKIPWAMVWGNHDDEGSLTRWELSELATNLPYSLFQ 363

Query: 382 FST--------------------DNGHLIIPL-----HKFNDPKGEVSQDELMIYVIDSF 416
             T                    D+  LI        HK++  K     D +     D F
Sbjct: 364 IGTKDTKNNLFGVGNYYIQAQANDSDDLIATFYFLDSHKYSKTKISPGYDWIKESQWDYF 423

Query: 417 HSIENDVKFKEIASKPVDWEYALAFRSLPIPQY-------RPDGLFPIIGQYNERTSLEL 469
             + N+ K K           ++AF  +P+P+Y       RP+    I+G + E  +   
Sbjct: 424 EDLYNN-KLKLSIQSSHKLHVSMAFFHIPLPEYLNLDSKRRPNEQNQIVGTFKEGVTAPR 482

Query: 470 RENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQSKNE---MWLCYGGSTGVGTK 526
             + G  V     LQ   +S      SCGH+H ND CLQ  +    +WLCYGG  G G  
Sbjct: 483 YNSGGLNV-----LQKLGVS----VTSCGHDHCNDYCLQDDSTPSFIWLCYGGGGGEGGY 533

Query: 527 RMEGLFA-NVRLFDIDTDIGEITSWKRNMHLIDNVYDYQYI 566
              G     +R+++ID++ G I++WKR       ++DYQ I
Sbjct: 534 AGYGGTERRLRIYEIDSNKGTISTWKRLNSSPKEIFDYQII 574

>KAFR0A06210 Chr1 (1254374..1256119) [1746 bp, 581 aa] {ON}
           Anc_4.200 YLR361C
          Length = 581

 Score =  101 bits (252), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 102/405 (25%), Positives = 178/405 (43%), Gaps = 59/405 (14%)

Query: 210 KEIVANIEIFLGSLFLESRPYWR----EVIHEFKPDDKLPLPISITVKIATNVKEETGEL 265
           +EI++ I +  G   ++ RP W     +   EFK       P  I+ K      +++ +L
Sbjct: 187 QEIISEINVLFGDDCVDPRPNWNLLKGQKFTEFK------YPSYISYKSVDKFDDQSIQL 240

Query: 266 NDGTLKMDSK-FKILQVSDVHFRSSINSMP----------MLKEYQTMQFITNTITRELP 314
           +   L   S+ FKI+Q++D+H     N                + +T++FI   +  E P
Sbjct: 241 SPKLLTTTSQDFKIVQLADLHMGVGTNECRDEFPESSDGVCKADPKTLEFIEKVLDNESP 300

Query: 315 NLVIVTGDILDSTNSI-DYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFIS 373
            LV+ TGD +    SI D +T ++  + P+I+ K+P+ +  G+ D     SR Q+    +
Sbjct: 301 QLVVFTGDQIMGDRSIQDSETTLLKALDPVIRRKLPWAMVWGNHDDEGSLSRWQLSELAA 360

Query: 374 TLPYSL---TKFSTDNGHLIIPLHKFNDPKGEVSQDELM-IYVIDSF------------- 416
            LPYSL   +K+ T N    +  +      G+  ++ L+ +Y +DS              
Sbjct: 361 KLPYSLFEMSKYDTKNNKFGVGNYAKQVFNGDNEEEGLITLYFLDSHKYSQMGKIYPGYD 420

Query: 417 -----------HSIENDVKFKEIASKPVDWEYALAFRSLPIPQYRPDGLFPIIGQYNERT 465
                      H     +  K+   K    + ++AF  +P+P+Y         G+ N   
Sbjct: 421 WIKEEQLNYIEHEYNTKLLLKQSKQKK---QLSMAFFHIPLPEYLNLNSAKRAGENNPLV 477

Query: 466 SLELRENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCL---QSKNEMWLCYGGSTG 522
             E +E V     N   L+  L S  V+  SCGH+H ND CL    + +++WLC+GGS G
Sbjct: 478 G-EFKEGVTAPKYNSGALEK-LQSLGVQVTSCGHDHCNDYCLLDDSTSSDIWLCFGGSAG 535

Query: 523 VGTKRMEGLFA-NVRLFDIDTDIGEITSWKRNMHLIDNVYDYQYI 566
            G     G     +R++ ++T+   + +WK      +  +DYQ +
Sbjct: 536 EGAYAGYGGTERRIRVYALNTERSTVYTWKLLNGSPNLPFDYQQL 580

>TBLA0D02020 Chr4 (503782..505713) [1932 bp, 643 aa] {ON} Anc_4.200
           YLR361C
          Length = 643

 Score =  100 bits (248), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 104/419 (24%), Positives = 181/419 (43%), Gaps = 79/419 (18%)

Query: 212 IVANIEIFLGSLFLESRPYWREVIHEFKPDDKLPLPISITVKIATNVKEETGELNDGTLK 271
           +++N ++  G   +E RP +          D LP  +S+ +                T  
Sbjct: 221 LISNADVLFGHDAVEPRPNYALQGVIANGSDSLPAWLSLQIFSPPQRLSHQDGPRLTTDP 280

Query: 272 MDSKFKILQVSDVHFRS------------------SINSMPMLKEYQTMQFITNTITREL 313
            + KFKI+Q++D+H  +                  S ++ P+     T+QF++  +  E 
Sbjct: 281 ANHKFKIVQLADLHLSTGYGVCRDPFPANLIADDGSCHADPL-----TLQFVSQVLDEEQ 335

Query: 314 PNLVIVTGD-ILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFI 372
           P LV+ +GD I+      D +T ++  V P+I+  IP+ +  G+ D      R +I  F 
Sbjct: 336 PQLVVFSGDQIMGDRCKADSKTALLKAVAPVIQRGIPWAMIWGNHDDEGSMDRIEISEFA 395

Query: 373 STLP---YSLTKFSTDN-----GHLIIPLHKFNDPKGEVSQ--DELMIYVIDSFHSIEND 422
           + LP   +  T F T +     G+ ++ ++   D    V+Q      +Y +DS H     
Sbjct: 396 AALPGSQFQFTPFDTSDNTFGVGNYLLNVYDTQD----VTQVTPAFTLYFLDS-HKYATT 450

Query: 423 VKFKEIAS--KPVDWEY----------------ALAFRSLPIPQYR------PDG---LF 455
            +F       KP    Y                ++AF  +P+P+YR      P+    L 
Sbjct: 451 GRFSAGYDWVKPKQLHYFQYQHDQLPPTEPQHISMAFLHIPVPEYRNLQSNRPETRGELN 510

Query: 456 PIIGQYNERTSLELRENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQ---SKNE 512
           P +G + E  +   R++     G +  LQ   IS     +SCGH+H ND CL+   + ++
Sbjct: 511 PFVGNHKEPVTAPARDS-----GTLSMLQQLGIS----VVSCGHDHCNDYCLEDDSTGSD 561

Query: 513 MWLCYGGSTGVGTKRMEGLFAN-VRLFDIDTDIGEITSWKRNMHLIDNVYDYQYIYKRE 570
           +WLCYGG+ G G     G     +R++++D   G + +WKR    ++   DYQ +  RE
Sbjct: 562 VWLCYGGAAGEGGYSGYGGTERRIRIYELDAKAGRVVTWKRRRGSMNEARDYQVLVDRE 620

>ZYRO0B07898g Chr2 (616796..618547) [1752 bp, 583 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361C DCR2
           Protein involved in cell cycle regulation
          Length = 583

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 107/416 (25%), Positives = 175/416 (42%), Gaps = 80/416 (19%)

Query: 208 NTKEIVANIEIFLGSLFLESRPYWREVIHEFKPDDKLPLPISITVKIATNVKEETGELND 267
           N + ++++I +  G   ++ R  W       + D      +       T  +  T  L D
Sbjct: 182 NGRPVISDISVLFGEDCVDPRKNW-------ELDRSWVFKMGEFPSFITTRRLSTKYLED 234

Query: 268 G----TLKMDSKFKILQVSDVHFRSSINSMPMLKEY----------QTMQFITNTITREL 313
                T+  D  +KI+Q++D+HF   +     L E+          +T +F+   +  E 
Sbjct: 235 WRPRLTVGEDGAYKIVQLADLHF--GVGKGECLDEFPAHDHCEADPKTTKFVEEVLDIEQ 292

Query: 314 PNLVIVTGD-ILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFI 372
           P++VI TGD I+ S +  D +T ++  + P+I   IP+ +  G+ D     +R ++  F+
Sbjct: 293 PDMVIFTGDQIMGSRSKQDSETALLKTLAPVISKGIPWAMVWGNHDDEGTLNRWELSKFV 352

Query: 373 STLPYSL----TKFSTDNGHLIIP-LHKFNDPKGEVSQDELMIYVIDS------------ 415
           + LP SL     K + DN   +    H+  D   E  Q  L  Y +DS            
Sbjct: 353 NDLPLSLFMVGPKDTADNTFGVGNYFHQVMD--FENRQPVLTFYFLDSHKYSTTGKIFPG 410

Query: 416 -----------FHSIENDVKFKEI--ASKPVDWEYALAFRSLPIPQY-------RPDGLF 455
                      F  I ++  ++ I    KP     ++AF  +P P+Y       RP    
Sbjct: 411 YDWIKEDQWDYFKRIYDEKLYQHIRNTQKP---HLSMAFFHIPTPEYLHEASRERPGESN 467

Query: 456 PIIGQYNERTSLELRENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCL---QSKNE 512
           PIIG   E  +    ++   A          L    V++ SCGH+H+ND CL    S  +
Sbjct: 468 PIIGNPMEGVTAPRYDSKAAAA---------LAHMNVQAASCGHDHSNDYCLLDDSSPQK 518

Query: 513 MWLCYGGSTGVGTK--RMEGLFANVRLFDIDTDIGEITSWKRNMHLIDNVYDYQYI 566
           +W CYGG+ G G      +G    VR++  +T  G I +WKR      N +DYQ I
Sbjct: 519 IWFCYGGAVGEGGYGDHNDGYERRVRIYHFETKDGNIYTWKRLNSSPINYFDYQLI 574

>TDEL0E01730 Chr5 (333362..335086) [1725 bp, 574 aa] {ON} Anc_4.200
           YLR361C
          Length = 574

 Score = 97.1 bits (240), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 110/407 (27%), Positives = 175/407 (42%), Gaps = 63/407 (15%)

Query: 208 NTKEIVANIEIFLGSLFLESRPYWREVIHEFKPDDKLPLPISITVKIATNVKEETGELND 267
           N  ++ + + +  G   ++ RP W   + +  P  K      +T K      EET  +N+
Sbjct: 174 NGAQVFSELNVLFGEDSVDPRPGWH--LEKSWPLSKGSTSAYLTYKFLD--LEETRIMNE 229

Query: 268 G-TLKMDSKFKILQVSDVHF-------RSSINSMPMLK-EYQTMQFITNTITRELPNLVI 318
              L  + +FKILQ++D+HF       R      P  + + +T++FI   +  E P+LV+
Sbjct: 230 ALRLGEEGRFKILQLADLHFSAGKSECRDEFPKHPTCEADSKTLRFIERVLDIESPDLVV 289

Query: 319 VTGDILDSTNSI-DYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPY 377
            TGD +    SI D +T ++  V P I+ KIP+ +  G+ D      R  +  ++ +LPY
Sbjct: 290 YTGDQIMGDRSIRDSETSLLKAVAPAIRRKIPWAMVWGNHDDEGSLGRWALSKYVESLPY 349

Query: 378 SLTKFS----TDNGHLIIP-LHKFNDPKGEVSQDELMIYVIDSFHSIEN----------- 421
           S+ + S     DN   +    H+  DP     +    +Y +DS H               
Sbjct: 350 SIFQISPKDTKDNSFGVGNYFHQIIDPT--TGKPAATLYFLDS-HKYSTTGKVYPGYDWI 406

Query: 422 ------------DVKFKEIASKPVDWEYALAFRSLPIPQYRPDGLFPIIGQYNERTSLEL 469
                       D K     +KP     ++AF  +P+P+Y     F    + N R  L  
Sbjct: 407 KEAQWDYLRELYDEKISPSLAKPSQKHLSMAFFHIPLPEYLD---FDSQKEANNRNPL-- 461

Query: 470 RENVGTAVGNVI------NLQDFLISKKVKSISCGHEHNNDCCL---QSKNEMWLCYGGS 520
              VG +   V+      N +  L    V   SCGH+H ND CL    +  + WLCYGG 
Sbjct: 462 ---VGNSKEAVMAPKYNSNGKKTLDHLGVSVTSCGHDHCNDYCLLDDSTSKKTWLCYGGG 518

Query: 521 TGVGTKRMEGLFA-NVRLFDIDTDIGEITSWKRNMHLIDNVYDYQYI 566
           TG G     G     VR++ +D   G+I +WKR     +  +DYQ +
Sbjct: 519 TGEGGYGGYGGTERRVRIYLLDGKNGDIHTWKRLNGNPNGYFDYQLM 565

>NDAI0J01970 Chr10 complement(488882..490651) [1770 bp, 589 aa] {ON}
           Anc_4.200
          Length = 589

 Score = 95.9 bits (237), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 93/326 (28%), Positives = 151/326 (46%), Gaps = 59/326 (18%)

Query: 271 KMDSKFKILQVSDVHFRSSINS----MPMLKE-----YQTMQFITNTITRELPNLVIVTG 321
           K   KFKI+Q++D+H     N+     P   E      +T++FI + +  E P LVI TG
Sbjct: 264 KETGKFKIVQLADLHMAVGENTCRDEFPKTDEDCKADPKTLKFIESVLDIESPQLVIYTG 323

Query: 322 DILDSTNSI-DYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLT 380
           D +    SI D +T ++  + P+I  ++ + +  G+ D     SR Q+    S LP+SL 
Sbjct: 324 DQIMGDLSIQDSETTLLKALSPVISRRLSWAMVWGNHDDEGSLSRWQLSELASILPFSLF 383

Query: 381 KFS----TDN----GHLIIPLHKFNDPKGEVSQDELMIYVIDSFHSIENDVKFKEIA-SK 431
           +FS     DN    G+ +  ++ +++      + ++ +Y +DS    +N   F      K
Sbjct: 384 QFSPKDTNDNSFGVGNYVENIYDYSN------ELKITLYFLDSHKYSKNGKIFPGYDWIK 437

Query: 432 PVDWEY--------------ALAFRSLPIPQYR-------PDGLFPIIGQYNERTSLELR 470
              WEY              ++AF  +P+P+Y        P     I+GQ+ E  +    
Sbjct: 438 EDQWEYMKSLHSSTPENKGISMAFFHIPLPEYLDLDSKKVPSQQNEIVGQFKEGVTAPKY 497

Query: 471 ENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQ---SKNEMWLCYGGSTGVGTKR 527
            +     G +  LQ+      V   SCGH+H ND CL+   + + +WLCYGGS G G   
Sbjct: 498 NS-----GGLSTLQEL----GVTVTSCGHDHCNDYCLRDDSTPSMIWLCYGGSAGEGAYA 548

Query: 528 MEGLFA-NVRLFDIDTDIGEITSWKR 552
             G     +R+F+IDT    + +WKR
Sbjct: 549 GYGGTERRIRVFEIDTTDNSVYTWKR 574

>YLR361C Chr12 complement(847388..849124) [1737 bp, 578 aa] {ON}
           DCR2Phosphoesterase involved in downregulation of the
           unfolded protein response, at least in part via
           dephosphorylation of Ire1p; dosage-dependent positive
           regulator of the G1/S phase transition through control
           of the timing of START
          Length = 578

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 95/338 (28%), Positives = 151/338 (44%), Gaps = 61/338 (18%)

Query: 273 DSKFKILQVSDVHFRSSINSMPMLKEY----------QTMQFITNTITRELPNLVIVTGD 322
           + KFKI+Q++D+H    +     + EY          +T  F+   +  E P LV+ TGD
Sbjct: 245 EGKFKIVQLADLHL--GVGESECIDEYPKHEACKADPKTETFVQQVLDIEKPQLVVFTGD 302

Query: 323 ILDSTNSI-DYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTK 381
            +    SI D +T ++  V P+I  KIP+ +  G+ D     +R Q+    S LPYSL K
Sbjct: 303 QIMGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQLSEIASVLPYSLFK 362

Query: 382 FST----DN----GHLIIPLHKFNDPKGEVSQDELMIYVIDSF-HSIENDVKFKEIASKP 432
           FS     DN    G+ I  +   ND +  V      +Y +DS  +S    +       K 
Sbjct: 363 FSPHDTHDNTFGVGNYIYQIFSNNDTEVPVG----TLYFLDSHKYSTVGKIYPGYDWIKE 418

Query: 433 VDWEY---------------ALAFRSLPIPQY-------RPDGLFPIIGQYNERTSLELR 470
             W+Y               ++AF  +P+P+Y        P    P+IG Y E  +    
Sbjct: 419 SQWKYIEDYHDVNLKFKTGLSMAFFHIPLPEYLNIESKTHPGEKNPLIGMYKEGVTAPKY 478

Query: 471 ENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQ---SKNEMWLCYGGSTGVGTKR 527
            + G    + ++         V  +SCGH+H ND CL+   + N++WLCYGG  G G   
Sbjct: 479 NSEGITTLDRLS---------VDVVSCGHDHCNDYCLRDDSTPNKIWLCYGGGGGEGGYA 529

Query: 528 MEGLFA-NVRLFDIDTDIGEITSWKRNMHLIDNVYDYQ 564
             G     +R+++I+ +   I +WKR       ++D+Q
Sbjct: 530 GYGGTERRIRIYEINVNENNIHTWKRLNGSPKEIFDFQ 567

>Skud_12.445 Chr12 complement(787532..789277) [1746 bp, 581 aa] {ON}
           YLR361C (REAL)
          Length = 581

 Score = 92.8 bits (229), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 95/336 (28%), Positives = 150/336 (44%), Gaps = 57/336 (16%)

Query: 273 DSKFKILQVSDVHF----RSSINSMPMLK----EYQTMQFITNTITRELPNLVIVTGDIL 324
           + KFKI+Q++D+H        ++  P  +    + +T  FI   +  E P +V+ TGD +
Sbjct: 248 EGKFKIVQLADLHLGVGESECVDEFPKHEVCKADPKTKTFIQQVLDIEKPQMVVFTGDQI 307

Query: 325 DSTNSI-DYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKF- 382
               SI D +T ++  V P+I  KIP+ +  G+ D     +R Q+    S LPYSL K  
Sbjct: 308 MGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQLSQLASALPYSLFKSN 367

Query: 383 ---STDN----GHLIIPLHKFNDPKGEVSQDELMIYVIDSF-HSIENDVKFKEIASKPVD 434
              + DN    G+ +  +   +D +  VS     +Y +DS  +S    +       K   
Sbjct: 368 IHDTQDNTFGVGNYVHQVFSKDDTEAPVS----TLYFLDSHKYSTAGKIYPGYDWIKESQ 423

Query: 435 WEY---------------ALAFRSLPIPQY-------RPDGLFPIIGQYNERTSLELREN 472
           W+Y               ++AF  +P+P+Y             P+IG Y E  +     +
Sbjct: 424 WKYIEEYHDKVLKSKTKLSMAFFHIPLPEYLNTASKTHAGEKNPLIGTYKEGVTAPKYNS 483

Query: 473 VGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQ---SKNEMWLCYGGSTGVGTKRME 529
            G A  + +          V  ISCGH+H ND CL+   + N  WLCYGG  G G     
Sbjct: 484 EGIATLDRLG---------VDVISCGHDHCNDYCLRDDSTPNRPWLCYGGGGGEGGYAGY 534

Query: 530 GLFA-NVRLFDIDTDIGEITSWKRNMHLIDNVYDYQ 564
           G     +R+++ID     I +WKR     +N++DYQ
Sbjct: 535 GGTERRIRIYEIDISEDNIHTWKRLNGSPENLFDYQ 570

>Smik_12.448 Chr12 complement(786446..788188) [1743 bp, 580 aa] {ON}
           YLR361C (REAL)
          Length = 580

 Score = 91.7 bits (226), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 99/338 (29%), Positives = 151/338 (44%), Gaps = 61/338 (18%)

Query: 273 DSKFKILQVSDVHFRSSINSMPMLKEY----------QTMQFITNTITRELPNLVIVTGD 322
           + KFKI+Q++D+H    +     L E+          +T  FI   +  E P LV+ +GD
Sbjct: 247 EGKFKIVQLADLHL--GVGESECLDEFPKHEACKADPKTKIFIEQVLDNEKPQLVVFSGD 304

Query: 323 ILDSTNSI-DYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTK 381
            +    SI D +T ++  V P+I  KIP+ +  G+ D     +R Q+    S LPYSL K
Sbjct: 305 QIMGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQLSELASELPYSLFK 364

Query: 382 FS----TDN----GHLIIPLHKFNDPKGEVSQDELMIYVIDSF-HSIENDVKFKEIASKP 432
           FS     DN    G+ I  +  F++   E+    L  Y +DS  +S    +       K 
Sbjct: 365 FSPYDTQDNSFGVGNYIWQV--FSNKSTELPVSTL--YFLDSHKYSTVGKIYPGYDWIKE 420

Query: 433 VDWEY---------------ALAFRSLPIPQY-------RPDGLFPIIGQYNERTSLELR 470
             W+Y               ++AF  +P+P+Y        P    P++G Y E  +    
Sbjct: 421 SQWKYIEDYYHENLKLKTGPSMAFFHIPLPEYLNVESKTHPGERNPLVGTYKEGVTAPKY 480

Query: 471 ENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQ---SKNEMWLCYGGSTGVGTKR 527
            + G      +N  D L    V  ISCGH+H ND CL+   + N +WLCYGG  G G   
Sbjct: 481 NSEG------LNTLDKL---GVDVISCGHDHCNDYCLRDDSTPNRLWLCYGGGGGEGGYA 531

Query: 528 MEGLFA-NVRLFDIDTDIGEITSWKRNMHLIDNVYDYQ 564
             G     +R+++I+     I +WKR       ++DYQ
Sbjct: 532 GYGGTERRIRIYEINVGENNIHTWKRLNGSPREIFDYQ 569

>Suva_10.462 Chr10 complement(807033..808778) [1746 bp, 581 aa] {ON}
           YLR361C (REAL)
          Length = 581

 Score = 89.7 bits (221), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 93/336 (27%), Positives = 148/336 (44%), Gaps = 57/336 (16%)

Query: 273 DSKFKILQVSDVHF----RSSINSMPMLK----EYQTMQFITNTITRELPNLVIVTGDIL 324
           + +FKI+Q++D+H        ++  P  +    + +T  F+   +  E P LV+ TGD +
Sbjct: 248 EGRFKIVQLADLHLGVGESECVDEFPKHETCKADPKTEAFVQQVLDIEAPQLVVFTGDQI 307

Query: 325 DSTNSI-DYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKF- 382
               SI D +T ++  V P+I   IP+ +  G+ D     +R Q+    STLPYSL +F 
Sbjct: 308 MGDRSIQDSETALLKAVAPVISRGIPWAMVWGNHDDEGSLTRWQLSELASTLPYSLFQFG 367

Query: 383 ---STDN----GHLIIPLHKFNDPKGEVSQDELMIYVIDSF-HSIENDVKFKEIASKPVD 434
              + DN    G+ +  +   ND +  VS     +Y +DS  +S    +       K   
Sbjct: 368 IYDTKDNTFGVGNYVHQVFSKNDTEMPVS----TLYFLDSHKYSTVGKIYPGYDWIKESQ 423

Query: 435 WEY---------------ALAFRSLPIPQY-------RPDGLFPIIGQYNERTSLELREN 472
           WEY               ++AF  +P+P+Y        P     ++G Y E  +     +
Sbjct: 424 WEYMKKYYDETLEFKTELSMAFFHIPLPEYLNTESNTHPGEKNALVGTYKEGVTAPKYNS 483

Query: 473 VGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQ---SKNEMWLCYGGSTGVGTKRME 529
            G A          L    V  +SCGH+H ND CLQ   + + +WLCYGG  G G     
Sbjct: 484 EGMAT---------LEKLGVDVVSCGHDHCNDYCLQDDSTSSLIWLCYGGGGGEGGYAGY 534

Query: 530 GLFA-NVRLFDIDTDIGEITSWKRNMHLIDNVYDYQ 564
           G     +R+++I+     I +WKR        +DYQ
Sbjct: 535 GGTERRIRIYEINISENNIYTWKRLNGSPKEFFDYQ 570

>KLLA0B13134g Chr2 (1149114..1150811) [1698 bp, 565 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361C DCR2
           Protein involved in cell cycle regulation
          Length = 565

 Score = 89.4 bits (220), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 94/337 (27%), Positives = 147/337 (43%), Gaps = 61/337 (18%)

Query: 275 KFKILQVSDVHFRSSINSMPMLKEY----------QTMQFITNTITRELPNLVIVTGD-I 323
           KFKI+Q++D+HF  S+       E+          +T+QFI   +  E P +V+ TGD I
Sbjct: 232 KFKIVQLADLHF--SVGKGVCRDEFPQHETCEADPKTLQFIDQVLDIEKPQMVVFTGDQI 289

Query: 324 LDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKF- 382
           +      D +T ++ ++ P+I  KIP+ +  G+ D     +R Q+  F S LPYSL +  
Sbjct: 290 MGDECKQDSETALLKVLAPVISRKIPWAMVWGNHDDEGSLNRWQLSEFASKLPYSLFEIG 349

Query: 383 ---STDNGHLIIPLHKFNDPKGEVSQDELMIYVIDSFHSIENDVKFKEIA-SKPVDWEY- 437
              S DN   +   +   + KG      + +Y +DS H       F      K   WEY 
Sbjct: 350 PRDSKDNQFGL--GNYVREVKGGDGTTNIALYFLDS-HKYSKSKAFPGYDWVKEEQWEYM 406

Query: 438 --------------------ALAFRSLPIPQYR----PDGLFPIIGQYNERTSLELRENV 473
                               ++AF  +P+P+YR      G   ++G Y E  +     + 
Sbjct: 407 EEYLESHDSIKQAKHSGDLISMAFFHIPLPEYRNFPQESGSNRVVGTYKEGITAPRYNSE 466

Query: 474 GTAVGNVINLQDFLISKKVKSISCGHEHNNDCCL-----QSKNEMWLCYGGSTGVGTKRM 528
           G            L    V   S GH+H ND CL       ++++WLCYGG+ G G    
Sbjct: 467 GVKT---------LHKLGVSVTSVGHDHCNDYCLLDDFNDGEDKIWLCYGGAAGEGGYAG 517

Query: 529 EGLFA-NVRLFDIDTDIGEITSWKRNMHLIDNVYDYQ 564
            G     +R+++ID    +I SWKR     +N +D+Q
Sbjct: 518 YGGTERRIRVYEIDALKKDIYSWKRLNGSPENTFDHQ 554

>Kpol_472.15 s472 (43361..44950) [1590 bp, 529 aa] {ON}
           (43361..44950) [1590 nt, 530 aa]
          Length = 529

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 95/332 (28%), Positives = 154/332 (46%), Gaps = 50/332 (15%)

Query: 259 KEETGELNDGTLKMDSKFKILQVSDVHFRS----SINSMPMLKE----YQTMQFITNTIT 310
           KE   E+  G     +KFKILQ++D+H+ +      +  P  ++    ++T  FI + + 
Sbjct: 189 KEVLPEIQLGVKGRTNKFKILQLADLHYSTLDGECRDEYPKTEDCNADFKTRTFIESILN 248

Query: 311 RELPNLVIVTGD-ILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQII 369
            + P+LV+ TGD I+ S  S+D  + +  +V P+I+ KIP+ +  G+ D     SR Q+ 
Sbjct: 249 LDRPDLVVFTGDQIMGSQCSLDATSALFKVVNPIIRRKIPWTMVWGNHDDEGSLSRVQLS 308

Query: 370 NFISTLPYSLTKF-----STDN----GHLIIPLHKFNDPKGEVSQDELMIYVIDSFHSIE 420
           N   +LPYS+ ++     ++DN    G+ I   HK     G      + +       +  
Sbjct: 309 NLAMSLPYSMFRYNPNFDTSDNTFGTGNYI---HKIRASDGSPLASLIFLDSHKKATTKT 365

Query: 421 NDVKF-----KEIASKPVDWEYA------LAFRSLPIPQY----RPDGLFP-IIGQYNER 464
             VK      KE     V   Y       +AF  +P+P++      +G+   I+G + E 
Sbjct: 366 GKVKLGYDWIKESQLNYVKENYGTETPLNMAFFHIPLPEFLNTKSDEGVKNVIVGLFKEG 425

Query: 465 TSLELRENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQSKNE---MWLCYGGST 521
            +   R N G          D L S KV+ +  GH+H ND CL  K++    WLC+GG+ 
Sbjct: 426 VTAP-RYNSGAL--------DVLKSLKVQVVGVGHDHCNDYCLLEKSKKYGTWLCFGGAA 476

Query: 522 GVGTKRMEGLFA-NVRLFDIDTDIGEITSWKR 552
           G G     G     VRL++I+     I +WKR
Sbjct: 477 GEGGYGGYGGTERRVRLYEINGKDLSIKTWKR 508

>CAGL0B02761g Chr2 (265971..267707) [1737 bp, 578 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361c
          Length = 578

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 108/415 (26%), Positives = 171/415 (41%), Gaps = 72/415 (17%)

Query: 207 DNTKEIVANIEIFLGSLFLESRPYWREVIHEFKPDDKLPLPISITVKIATNVKEET-GEL 265
           DN  +I++++ I  G   ++ RP W  V        K P  +S  +K+ +   E T  ++
Sbjct: 179 DNFFDIISDVNILFGEDAVDPRPNWHLVKSSPYLSYKHPSFMSY-MKLGSQEPEYTKSKV 237

Query: 266 NDGTLKMDSKFKILQVSDVHFRSSINSMPMLKEY----------QTMQFITNTITRELPN 315
                  D  FKI+Q++D+H     N    L EY          +T++F+   +  E P 
Sbjct: 238 LVKKEHEDDGFKIVQLADLHLGVGKNRC--LDEYPHHDKCEADSKTLKFVEEVLDIEKPG 295

Query: 316 LVIVTGDILDSTNSI-DYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFIST 374
            V+ +GD +    S+ D ++ +   V P+I+ +IP+ +  G+ D     SR ++      
Sbjct: 296 FVVFSGDQIMGDRSLQDSESVLYKAVDPVIRRRIPWAMVWGNHDDEGSLSRWELSKLAMK 355

Query: 375 LPYSLTKFS----TDN----GHLIIPLHKFNDPKGEVSQDELMIYVIDSFHSIENDVK-- 424
           LPYS  + S     DN    G+    +   NDP  EV+   L +Y +DS H      K  
Sbjct: 356 LPYSRFQISPHDTKDNTFGVGNYAHQIFYENDP--EVAA--LSLYFMDS-HKYSKTGKIY 410

Query: 425 ---------------------FKEIASKPVDWEYALAFRSLPIPQY-------RPDGLFP 456
                                 K    + +    A+ F  +P+P+Y       RP     
Sbjct: 411 LGYDWLKEEQLEYIQSLYERGMKSHIKENIHRHAAMTFIHIPLPEYLNLDSKKRPGESNE 470

Query: 457 IIGQYNERTSLELRENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQ----SKNE 512
           +IG + E  +   R N G  V         L    V  + CGH+H ND CL     S   
Sbjct: 471 LIGTFKEGVTAP-RYNSGGLVA--------LDKIGVDVVGCGHDHCNDYCLHDDSTSNKN 521

Query: 513 MWLCYGGSTGVGTKRMEGLFAN-VRLFDIDTDIGEITSWKRNMHLIDNVYDYQYI 566
           +WLCYGG  G G     G     +R +  D   G+IT+WKR       ++D+Q +
Sbjct: 522 IWLCYGGGAGEGGYAGYGGTERRIRTYKFDPQTGKITTWKRLNSKPSEIFDFQIV 576

>ABL009W Chr2 (381100..382809) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR361C
          Length = 569

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 89/376 (23%), Positives = 162/376 (43%), Gaps = 53/376 (14%)

Query: 231 WREVIHEFKPDDKLPLPISITVKIATNVKEETGELNDGTLKMDSKFKILQVSDVHF---- 286
           WR      + +  +P+ + +      +V+E+     D     D K K++ ++D+H     
Sbjct: 207 WRRDDTPHRNNGGMPVNVDVARSQVNSVQEKPRVRVD----PDGKVKVVHLADLHLVPGK 262

Query: 287 RSSINSMPMLK----EYQTMQFITNTITRELPNLVIVTGD-ILDSTNSIDYQTCIMNLVQ 341
               +  P  +    + +TM+F+ + +  E P++ + TGD I       D +T ++    
Sbjct: 263 GECRDEFPTTENCEADVKTMKFVNDVLDIERPDMAVYTGDQITGDLCDNDAETPLLKAFA 322

Query: 342 PMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTKFST-DNGHLIIPLHKF-NDP 399
           P  +  IP+ +  G+ D +   +R Q+  ++  LP+SL K    D       +  + +  
Sbjct: 323 PANQRWIPFAVIWGNHDDAGSLNRLQLSQYVEALPFSLFKIGPRDTMDRSFGMGNYVHQV 382

Query: 400 KGEVSQDELMIYVIDSFHSIENDVKFKEIAS--KPVDWEY-------------ALAFRSL 444
            GE    E+  Y +D+ HS   + + + +    K   W+Y             +LAF  +
Sbjct: 383 LGENGHPEITFYFVDT-HSYAPNPRGRRVYDWVKEEQWQYFEDCHAKLEHTELSLAFLHI 441

Query: 445 PIPQY-------RPDGLFPIIGQYNERTSLELRENVGTAVGNVINLQDFLISKKVKSISC 497
           P+P+Y        P      +G + E  +   R N G A        + L    V +++ 
Sbjct: 442 PLPEYLDVKSKKDPQKYNQFLGTFREGVTAP-RHNSGGA--------ERLARLGVSAVTA 492

Query: 498 GHEHNNDCCLQS-----KNEMWLCYGGSTGVGTKRMEGLFA-NVRLFDIDTDIGEITSWK 551
           GH+H ND CLQ+       ++W+CYGG+ G G     G     +R+F+IDT    I +WK
Sbjct: 493 GHDHCNDYCLQTDFRDIDPKIWMCYGGAAGEGGYGGYGGTERRIRIFEIDTREKRIETWK 552

Query: 552 RNMHLIDNVYDYQYIY 567
           R     ++ +D   IY
Sbjct: 553 RLNSSPNDKFDAHLIY 568

>Kwal_55.20333 s55 (355985..357718) [1734 bp, 577 aa] {ON} YLR361C -
           Hypothetical ORF [contig 150] FULL
          Length = 577

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 101/389 (25%), Positives = 167/389 (42%), Gaps = 68/389 (17%)

Query: 212 IVANIEIFLGSLFLESRPYWREVIHEFKPDDKLPLPISITVKIATNVKEETGELNDGTLK 271
            +  I++  G+  +E R  W  +  ++K  D+  +P  +T K        +  L    L+
Sbjct: 184 FITEIDVLFGNDCVEPRLDW-TLSKDWKLKDE-NIPSFLTFKRPALEANHSDTLQ---LR 238

Query: 272 MDSK--FKILQVSDVHFRSSINSMPMLKEY----------QTMQFITNTITRELPNLVIV 319
           +DS+  FKI+Q++D+HF  S++      E+          +T +FI   +  E P LV+ 
Sbjct: 239 VDSENNFKIVQLADLHF--SVDEGRCRDEHPVHETCKADPKTSKFIERVLDLEKPQLVVF 296

Query: 320 TGD-ILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYS 378
           TGD I+      D  T ++ +V P+I+ KIPY +  G+ D     +R ++   + + PYS
Sbjct: 297 TGDQIMGDECRQDSLTALLKVVAPVIERKIPYAMVWGNHDDEGSLNRWELSELVKSFPYS 356

Query: 379 LTKFS----TDNGHLIIP-LHKFNDPKGEVSQDELMIYVIDSFHSIENDVKFKEIA-SKP 432
           L K S     DN   +   +H      G        +Y +DS     N   +      K 
Sbjct: 357 LFKISEHDTQDNSFGVGNYMHYIYGKDGNPVSS---LYFLDSHKYSPNAKAYPGYDWIKE 413

Query: 433 VDWEY---------------ALAFRSLPIPQY-------RPDGLFPIIGQYNERTSLELR 470
             W+Y               ++AF  +P+P+Y        PD + P IG + E  +    
Sbjct: 414 EQWKYLETFEDSFSDQKRSLSMAFFHIPLPEYANFQSTQSPDYMNPSIGSFKEGLTAPKF 473

Query: 471 ENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCL-------QSKNEMWLCYGGSTGV 523
            + G            L    VK+ S GH+H ND CL        +++++WLC+GG+ G 
Sbjct: 474 NSNGIPT---------LRKLGVKATSVGHDHCNDYCLLDDSQSQANEDKIWLCFGGAAGE 524

Query: 524 GTKRMEGLFA-NVRLFDIDTDIGEITSWK 551
           G     G     +R F +D +   I SWK
Sbjct: 525 GGYAGYGGTERRIRTFQLDFEAQSIQSWK 553

>KLTH0E10824g Chr5 (973337..975079) [1743 bp, 580 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361C DCR2
           Protein involved in cell cycle regulation
          Length = 580

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 97/403 (24%), Positives = 169/403 (41%), Gaps = 68/403 (16%)

Query: 211 EIVANIEIFLGSLFLESRPYWREVIHEFKPDDKLPLPISITVKIATNVKEETGELNDGTL 270
           + V  I +  G   ++ RP WR          K+P  +++  + +    ++   L   + 
Sbjct: 186 DFVTEISVLFGEDCVDPRPAWRLSKEWRLEHSKVPCYLTLRTRDSDPHGKKFPTL---SA 242

Query: 271 KMDSKFKILQVSDVHFR----SSINSMP----MLKEYQTMQFITNTITRELPNLVIVTGD 322
            +++ FKI+Q++D+H+        +  P     + + +T+ F+   +  E P LV+ TGD
Sbjct: 243 SLENPFKIVQLADLHYSVGEGRCRDEFPKHENCIADPKTLAFVEKVLDTEKPQLVVFTGD 302

Query: 323 -ILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQIINFISTLPYSLTK 381
            I+ S    D  T ++ +V P+IK +IPY +  G+ D      R +I   + +LP SL K
Sbjct: 303 QIMGSECVQDSVTALLKVVDPIIKRQIPYAMVWGNHDDEGSLDRWEISKLVQSLPLSLFK 362

Query: 382 F----STDN----GHLIIPLHKFNDPKGEVSQDELMIYVIDSFHSIENDVK--------- 424
                + DN    G+ +  ++      GE       +Y +D+ H    + K         
Sbjct: 363 IGDHDTNDNSFGVGNYVHYIY------GEDGNPLSALYFLDA-HKYSPNAKAYPGYDWIK 415

Query: 425 ------FKEIASKPVDWEYAL--AFRSLPIPQY-------RPDGLFPIIGQYNERTSLEL 469
                 F       VD + +L  AF  +P+P+Y        P    P+IG + E  +   
Sbjct: 416 EEQWNFFDGYKDAFVDQKASLSMAFFHIPLPEYLNVDSSSSPGTQNPLIGNFKEGVTAPK 475

Query: 470 RENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQSKNE-------MWLCYGGSTG 522
             + G A          L    VK  S GH+H ND CL   ++       +WLC+GG+ G
Sbjct: 476 YNSKGIAT---------LRELGVKVTSVGHDHCNDYCLLEDSQSPAINERIWLCFGGAAG 526

Query: 523 VGTKRMEGLFA-NVRLFDIDTDIGEITSWKRNMHLIDNVYDYQ 564
            G     G     +R++ +D     I +WK      +  +D+Q
Sbjct: 527 EGGYGGYGGTERRIRVYQLDFSKRSIVTWKVLNSSPEAPFDHQ 569

>TPHA0F01100 Chr6 complement(249205..250881) [1677 bp, 558 aa] {ON}
           Anc_4.200 YLR361C
          Length = 558

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 110/408 (26%), Positives = 172/408 (42%), Gaps = 75/408 (18%)

Query: 209 TKEIVANIEIFLGSLFLESRPYWREV-------IHEFKPDDKLPLPISITVKIATNVKEE 261
           T E +A++++ L +L  + RP W+ V       + +F     +P    IT     + K+ 
Sbjct: 165 TFEPIADVDV-LYNLEFDPRPGWKLVDGITINALTKFSIYKHMPASDKIT-----STKDR 218

Query: 262 TGELNDGTLKMDS-KFKILQVSDVHFRSSINSMPMLKEY----------QTMQFITNTIT 310
           T       LK DS K+KI+Q++D+HF  SI       E+          +T  FI   + 
Sbjct: 219 TL-----VLKQDSAKYKIVQLADMHF--SITDGECHDEFPPTDDCKADRKTQVFIDKVLD 271

Query: 311 RELPNLVIVTGD-ILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQII 369
            E P+LVI TGD I+      D ++ ++ +V P+I  KI + +  G+ D      R ++ 
Sbjct: 272 LEQPDLVIFTGDQIMGDQCKKDSKSALLKVVGPIIARKIKWAMVWGNHDDEGSLDRFELS 331

Query: 370 NFISTLPYSL-----------TKFSTDNGHLIIPLHKFNDPKGEVSQDELMIYVIDSFHS 418
              ++LPYS            T F   N    I   + N P   +    L+   +DS   
Sbjct: 332 QLAASLPYSTFRINAGIDTLDTTFGIGNYVQKIYKEEKNKPDSYIPIGSLIF--MDSHKY 389

Query: 419 IENDVKFKEIA-SKPVDWEYA-----------LAFRSLPIPQYRPDGLFPIIGQYNERTS 466
            ++   F      KP  + Y            +AF  +P+P+Y        +   +E T 
Sbjct: 390 SKSPKSFPGYDWIKPSQYNYIGKHYGLKTPLNMAFFHIPLPEY--------LNIKSESTG 441

Query: 467 LE------LRENVGTAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQSKN---EMWLCY 517
            E       RE V     N   L+       V+ IS GH+H ND CL + +   + WLCY
Sbjct: 442 KENKIVGSGREGVTAPKYNSGTLEFLKKELNVQLISVGHDHCNDYCLSNDDYGSKSWLCY 501

Query: 518 GGSTGVGTKRMEGLFAN-VRLFDIDTDIGEITSWKRNMHLIDNVYDYQ 564
           GG  G G     G     +R+F+ID D   I +WKR      + +D+Q
Sbjct: 502 GGGAGEGGYSGYGGTERRIRVFEIDFDKLSIETWKRKQTNSQDTFDHQ 549

>CAGL0K05225g Chr11 complement(505973..508714) [2742 bp, 913 aa]
           {ON} similar to uniprot|Q12028 Saccharomyces cerevisiae
           YPR029c gamma-adaptin
          Length = 913

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 14/100 (14%)

Query: 416 FHSIENDVKFKEIASKPVDWEYALAFRSLPIPQYRPDGLFPIIGQYNERTSLELRENVGT 475
             ++++D K  E   K ++ +  + +  L   QY              RT+L++   V T
Sbjct: 613 LQALQSDSKLNETYGKTINEKTIVNYLKLKDTQYI-------------RTNLKINHYVLT 659

Query: 476 AVGNV-INLQDFLISKKVKSISCGHEHNNDCCLQSKNEMW 514
           A   + + +QDF + +K++ I  G   N D  LQ+K   +
Sbjct: 660 AALKLSVRIQDFALIEKLRQIIVGQTKNTDLLLQAKATQY 699

>YML047C Chr13 complement(180017..181075) [1059 bp, 352 aa] {ON}
           PRM6Pheromone-regulated protein, predicted to have 2
           transmembrane segments; regulated by Ste12p during
           mating
          Length = 352

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 272 MDSKFKILQVSDVHFRSSINSMPMLKEYQTMQFITNTITRELPNLVIVTGDILDSTNSID 331
           M+S  + L+  D+     IN +P  K    +Q+I  T  + + ++ +   DI      + 
Sbjct: 1   MESSLQKLKFQDI----DINLIPTAKWTTKLQYILYTWCQSILHVAMFFSDIYTCIKLLA 56

Query: 332 YQTCIMNLVQPMIKFKI 348
           + T   N++QP ++F+I
Sbjct: 57  FNTWSNNIIQPFLEFRI 73

>YER116C Chr5 complement(395348..396172) [825 bp, 274 aa] {ON}
           SLX8Subunit of the Slx5-Slx8 SUMO-targeted ubiquitin
           ligase (STUbL) complex; stimulated by prior attachment
           of SUMO to the substrate; contains a C-terminal RING
           domain
          Length = 274

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 251 TVKIATNVKEETGELNDGTLKMDSKF-KILQVSDVHFRSSINSMPMLKEYQTMQFITNTI 309
           T K  TN KE+T +L    + +D++  ++LQ+SD  F+      P  KEY   +     I
Sbjct: 151 TTKPGTNSKEQTVDLTADAIDLDAEEQQVLQISDDDFQEETKEAP--KEYGAAKDYRCPI 208

Query: 310 TRELPNLVIVT 320
             E P   ++T
Sbjct: 209 CFEPPETALMT 219

>Kpol_304.5 s304 complement(14534..16534) [2001 bp, 666 aa] {ON}
           complement(14534..16534) [2001 nt, 667 aa]
          Length = 666

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 366 DQIINFISTL--PYSLTKFST-DNGHLIIPLHKFNDPKGEVSQDELMIYVIDSFHSIEND 422
           D  IN +S    P +LT  S+  N    +P+   N P+G  S +  ++  I    +I+N 
Sbjct: 285 DASINLLSLRHSPAALTHLSSVSNAQSPVPIDDINTPQGRNSMEPDVLRNIHKIKNIKNR 344

Query: 423 VKFKEIASKPVDWEYAL 439
              +  AS+  +W++ L
Sbjct: 345 YSNRPSASRDTEWKFTL 361

>TBLA0A10760 Chr1 complement(2665056..2672045) [6990 bp, 2329 aa]
           {ON} 
          Length = 2329

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 12/79 (15%)

Query: 83  NLSDESLYSMESGPFSRSFLY-VRQDTGEKPISDIAISSDPLMIPVHVTQDINNLLQSSD 141
           +L+D SLY+ +    ++S  Y    DT +     ++I+SD           I++ LQS+D
Sbjct: 579 SLTDGSLYTTDINSATKSESYPATSDTQQGSSGTVSINSD-----------IDSTLQSND 627

Query: 142 SSVYHNHKFHQKGSSWRAS 160
           +SVYH+       +SW  S
Sbjct: 628 NSVYHSKTSTLNSNSWATS 646

>SAKL0D04532g Chr4 complement(362288..363961) [1674 bp, 557 aa] {ON}
           similar to uniprot|P38222 Saccharomyces cerevisiae
           YBR030W Hypothetical ORF
          Length = 557

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 28/61 (45%)

Query: 406 DELMIYVIDSFHSIENDVKFKEIASKPVDWEYALAFRSLPIPQYRPDGLFPIIGQYNERT 465
           +E  + +   F S+EN+ + KE   K V   YA++ R   I  Y    L PI   +N   
Sbjct: 165 EEFGLEIPQDFLSVENEERIKEKYLKFVAVAYAISSRVFEIDNYHESALVPIADLFNHHV 224

Query: 466 S 466
           +
Sbjct: 225 T 225

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,389,533
Number of extensions: 2802352
Number of successful extensions: 7452
Number of sequences better than 10.0: 54
Number of HSP's gapped: 7486
Number of HSP's successfully gapped: 61
Length of query: 570
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 455
Effective length of database: 40,294,809
Effective search space: 18334138095
Effective search space used: 18334138095
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)