Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H022505.473ON42242220470.0
YOR136W (IDH2)5.473ON36935015620.0
NDAI0C014105.473ON36935315610.0
Suva_8.1885.473ON36935015460.0
Smik_15.3165.473ON36935015450.0
Skud_15.3005.473ON36935015340.0
CAGL0I07227g5.473ON36835015230.0
SAKL0G03520g5.473ON36935215090.0
KNAG0B040705.473ON37335314970.0
Ecym_23135.473ON37035214930.0
Kpol_440.125.473ON36835014800.0
Kwal_55.212735.473ON36835214650.0
TDEL0A033705.473ON37135014640.0
KLTH0F15048g5.473ON36835214590.0
KLLA0E03125g5.473ON36835214530.0
AFR137C5.473ON36735114440.0
TBLA0B022405.473ON37334714380.0
KAFR0B063705.473ON37835314220.0
Kpol_543.85.473ON36835014100.0
TPHA0J027705.473ON37635314040.0
ZYRO0D11220g5.473ON36835013880.0
TPHA0E014805.473ON37734812481e-171
Smik_14.2902.278ON3603436985e-88
ADL223W2.278ON3623436932e-87
NDAI0B035902.278ON3593526914e-87
KLLA0F04103g2.278ON3613436881e-86
YNL037C (IDH1)2.278ON3603436853e-86
ZYRO0D02838g2.278ON3613446845e-86
Skud_14.2932.278ON3613436838e-86
SAKL0E07876g2.278ON3613436769e-85
TBLA0B069102.278ON3653446769e-85
Ecym_33162.278ON3623456741e-84
KNAG0A052802.278ON3613456715e-84
Kwal_23.50122.278ON3613436691e-83
KLTH0G10186g2.278ON3603436681e-83
TPHA0D015602.278ON3603456681e-83
CAGL0G02673g2.278ON3583516628e-83
TDEL0C038402.278ON3613476532e-81
NCAS0B062902.278ON3593506532e-81
Kpol_1039.352.278ON3593436472e-80
KAFR0J014102.278ON3503426166e-76
Suva_14.3022.278ON3002855472e-66
TBLA0B059402.287ON3693534191e-46
KNAG0A054202.287ON3723604139e-46
Kpol_1003.392.287ON3703604121e-45
CAGL0G02585g2.287ON3723534121e-45
ADL214C2.287ON3673794093e-45
TPHA0C034102.287ON3713814093e-45
NCAS0B062502.287ON3733534094e-45
NDAI0B035502.287ON3723544032e-44
SAKL0E07656g2.287ON3683593981e-43
YIL094C (LYS12)2.287ON3713603953e-43
ZYRO0A01914g2.287ON3683523945e-43
Suva_9.1052.287ON3713603902e-42
TDEL0G021802.287ON3693523883e-42
Skud_9.792.287ON3713603884e-42
Smik_9.852.287ON3713603884e-42
KLLA0E08339g2.287ON3693593875e-42
KAFR0J013602.287ON3733523842e-41
Ecym_33262.287ON3663663823e-41
Kwal_27.115282.287ON3673643613e-38
KLTH0G10384g2.287ON3673533586e-38
Ecym_12961.402ON3632732321e-20
AAL012C1.402ON3723512252e-19
Skud_3.431.402ON3643592136e-18
NDAI0G042301.402ON3632692101e-17
ZYRO0E04796g1.402ON3622692092e-17
Smik_3.661.402ON3643592082e-17
YCL018W (LEU2)1.402ON3643592065e-17
NCAS0C048701.402ON3653642031e-16
KAFR0I022001.402ON3652691984e-16
TBLA0C015001.402ON3652701976e-16
Kwal_0.2251.402ON3643651969e-16
Suva_3.31.402ON3643661961e-15
CAGL0H03795g1.402ON3653591951e-15
TDEL0B060001.402ON3623571942e-15
KLLA0D04906g1.402ON3623571932e-15
KLTH0H12188g1.402ON3643521862e-14
KNAG0I012801.402ON4473621844e-14
SAKL0D08690g1.402ON3642691791e-13
Kpol_1048.631.402ON3643641728e-13
TPHA0B037301.402ON3653581657e-12
Suva_14.303singletonON53511073e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H02250
         (422 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    793   0.0  
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   606   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   605   0.0  
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   600   0.0  
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   599   0.0  
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   595   0.0  
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   591   0.0  
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   585   0.0  
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   581   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   579   0.0  
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   574   0.0  
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   568   0.0  
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   568   0.0  
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   566   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   564   0.0  
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   560   0.0  
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   558   0.0  
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   552   0.0  
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   547   0.0  
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   545   0.0  
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   539   0.0  
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   485   e-171
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   273   5e-88
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   271   2e-87
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   270   4e-87
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   269   1e-86
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   268   3e-86
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   268   5e-86
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   267   8e-86
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   265   9e-85
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            265   9e-85
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   264   1e-84
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              263   5e-84
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   262   1e-83
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   261   1e-83
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   261   1e-83
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   259   8e-83
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   256   2e-81
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   256   2e-81
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   253   2e-80
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   241   6e-76
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   215   2e-66
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   166   1e-46
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              163   9e-46
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   163   1e-45
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   163   1e-45
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   162   3e-45
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   162   3e-45
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   162   4e-45
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   159   2e-44
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   157   1e-43
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   156   3e-43
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   156   5e-43
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   154   2e-42
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   154   3e-42
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   154   4e-42
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   154   4e-42
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   153   5e-42
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   152   2e-41
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   151   3e-41
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   143   3e-38
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   142   6e-38
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...    94   1e-20
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...    91   2e-19
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)    87   6e-18
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...    86   1e-17
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...    85   2e-17
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)    85   2e-17
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...    84   5e-17
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...    83   1e-16
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...    81   4e-16
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...    80   6e-16
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...    80   9e-16
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)       80   1e-15
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}              80   1e-15
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...    79   2e-15
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...    79   2e-15
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...    76   2e-14
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...    75   4e-14
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...    74   1e-13
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...    71   8e-13
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...    68   7e-12
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    46   3e-06

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/422 (92%), Positives = 389/422 (92%)

Query: 1   MPSRKGYIYIYTNSRQPASLDFNNTYPAAYPSEQHSQLHRNGKQYQYPCNNNIMFXXXXX 60
           MPSRKGYIYIYTNSRQPASLDFNNTYPAAYPSEQHSQLHRNGKQYQYPCNNNIMF     
Sbjct: 1   MPSRKGYIYIYTNSRQPASLDFNNTYPAAYPSEQHSQLHRNGKQYQYPCNNNIMFRSSIL 60

Query: 61  XXXXXXXXXVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIE 120
                    VKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIE
Sbjct: 61  RTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIE 120

Query: 121 WETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFAN 180
           WETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFAN
Sbjct: 121 WETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFAN 180

Query: 181 VRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYA 240
           VRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYA
Sbjct: 181 VRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYA 240

Query: 241 FEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNP 300
           FEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNP
Sbjct: 241 FEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNP 300

Query: 301 SSYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNM 360
           SSYTDAVSVCPNLYGDI                   NIGNEISIFEAVHGSAPDIAGKNM
Sbjct: 301 SSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAPDIAGKNM 360

Query: 361 ANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIK 420
           ANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIK
Sbjct: 361 ANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIK 420

Query: 421 KL 422
           KL
Sbjct: 421 KL 422

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/350 (83%), Positives = 321/350 (91%)

Query: 73  QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFID 132
           QPSIG+YTGKPNPSTGKYTVSFIEGDGIGPEIS SVK+IFSAA VPIEWE+CDV+P+F++
Sbjct: 20  QPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVN 79

Query: 133 GLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFKT 192
           GLTTIP+PAVQSI KNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA+S++GFKT
Sbjct: 80  GLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKT 139

Query: 193 TYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRL 252
           TY NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+ASERVIRYAFEY RAIGRPR+
Sbjct: 140 TYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRV 199

Query: 253 VVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPN 312
           +VVHKSTIQRL+DGLFVNVAKELSKEYPD+  ETELIDN+VLKVV+NPS+YTDAVSVCPN
Sbjct: 200 IVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPN 259

Query: 313 LYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVM 372
           LYGDI                   NIG++ISIFEAVHGSAPDIAG++ ANPTALLLSSVM
Sbjct: 260 LYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVM 319

Query: 373 MLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           MLNHMGL+ HADQI+NAVLSTIASGPE+RTGDLAGTATTS+FT+AVIK+L
Sbjct: 320 MLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/353 (83%), Positives = 320/353 (90%)

Query: 70  VKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPL 129
           VK+QPSIGK+TGKPNPSTGK+TVSFIEGDGIGPEIS SVKQIF AAKVPI+WE CDV+PL
Sbjct: 17  VKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPL 76

Query: 130 FIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKG 189
           FI+GLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA+S++G
Sbjct: 77  FINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEG 136

Query: 190 FKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGR 249
           FKT Y NVDLV+IRENTEGEYSGIEHVVTPGVVQSIKLITR+ASERVIRYA+EY RAIGR
Sbjct: 137 FKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGR 196

Query: 250 PRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309
           PR++VVHKSTIQRL+DGLFV+VAKELS+EYPDIQ ETELIDNTVL VVSNPSSY++AVSV
Sbjct: 197 PRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSV 256

Query: 310 CPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLS 369
           CPNLYGDI                   NIG+E+SIFEAVHGSAPDIAG+N ANPTALLLS
Sbjct: 257 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLS 316

Query: 370 SVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           SVMMLNHMGL+ HAD+IE AVLSTIASGPE RTGDLAG ATTS+FTDAVI +L
Sbjct: 317 SVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/350 (82%), Positives = 317/350 (90%)

Query: 73  QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFID 132
           QPSIG+YTGKP+PSTG+YTVSFIEGDGIGPEIS SVK+IFSAA VPI WE CDV P+F++
Sbjct: 20  QPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVPINWEFCDVNPIFVN 79

Query: 133 GLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFKT 192
           GLTTIP+PAVQSI KNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA+S++GFKT
Sbjct: 80  GLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKT 139

Query: 193 TYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRL 252
           TY NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITREASERVIRYAFEY RAIGRPR+
Sbjct: 140 TYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRPRI 199

Query: 253 VVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPN 312
           +VVHKSTIQRL+DGLFVNVAKELSKEYPDI FETELIDN VL VV+NPS+YT+AVSVCPN
Sbjct: 200 IVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPN 259

Query: 313 LYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVM 372
           LYGDI                   NIG+++SIFEAVHGSAPDIAGK+ ANPTALLLSSVM
Sbjct: 260 LYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVM 319

Query: 373 MLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           MLNHMGL+ HADQI+NAVLSTIASGPE+RTGDLAGTATTS+FT+AVIK+L
Sbjct: 320 MLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/350 (83%), Positives = 318/350 (90%)

Query: 73  QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFID 132
           QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEIS SVK+IFSAA VPIEWE CDV P+F++
Sbjct: 20  QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWEFCDVNPIFVN 79

Query: 133 GLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFKT 192
           GLTTIP+PAVQSI KNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA+SV+GFKT
Sbjct: 80  GLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSVEGFKT 139

Query: 193 TYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRL 252
           TY NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+ASERVIRYAFEY RAIGRPR+
Sbjct: 140 TYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRV 199

Query: 253 VVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPN 312
           +VVHKSTIQRL+DGLFVNVAKELSKEYPDI  ETELIDN+VLKVV+NPS+YT+AVSVCPN
Sbjct: 200 IVVHKSTIQRLADGLFVNVAKELSKEYPDITLETELIDNSVLKVVTNPSAYTNAVSVCPN 259

Query: 313 LYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVM 372
           LYGDI                   NIG++ISIFEAVHGSAPDIAG++ ANPTALLLSSVM
Sbjct: 260 LYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVM 319

Query: 373 MLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           MLNHMGL+ +ADQI+NAVLSTIASGPE+RTGDLAG ATTS+FT+AVIK+L
Sbjct: 320 MLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/350 (81%), Positives = 318/350 (90%)

Query: 73  QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFID 132
           QPSIG++TGKPNPSTG+YTVSFIEGDGIGPEIS SVK+IF+AA VPIEWE+CDV P+F++
Sbjct: 20  QPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVPIEWESCDVNPIFVN 79

Query: 133 GLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFKT 192
           GLTTIP+ AVQSI  NL+ALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA+SV+GFKT
Sbjct: 80  GLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSVEGFKT 139

Query: 193 TYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRL 252
           TY NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+ASERVIRYAFEY RAIGRPR+
Sbjct: 140 TYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRV 199

Query: 253 VVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPN 312
           +VVHKSTIQRL+DGLFVNVAKELSKEYPDI  ETELIDN+VLKVV+NPS+YT+AVSVCPN
Sbjct: 200 IVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPN 259

Query: 313 LYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVM 372
           LYGDI                   NIG++ISIFEAVHGSAPDIAG++ ANPTALLLSSVM
Sbjct: 260 LYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVM 319

Query: 373 MLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           MLNHMGL+ HADQI+NAVLSTIASGPE+RTGDLAGTATTS+FT+AVIK+L
Sbjct: 320 MLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/350 (80%), Positives = 315/350 (90%)

Query: 73  QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFID 132
           QPSIG++TGKPNPSTGK+TVSFIEGDGIGPEIS+SVK+IF AA VP+EWETCDVTP+F++
Sbjct: 19  QPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRIFQAADVPVEWETCDVTPIFVN 78

Query: 133 GLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFKT 192
           GLTTIP+PAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTF LFANVRPA+S++GFKT
Sbjct: 79  GLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFNLFANVRPAKSIEGFKT 138

Query: 193 TYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRL 252
           TY NVDLVLIRENTEGEYSGIEH+V+PGVVQSIKLITR+ASERVIRYA+EY RAIGRPRL
Sbjct: 139 TYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLITRDASERVIRYAYEYARAIGRPRL 198

Query: 253 VVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPN 312
           +VVHKSTIQRL+DGLFVNVAKEL+ EYPDIQ ETELIDNT L VVSNPSSYTDAVSVCPN
Sbjct: 199 IVVHKSTIQRLADGLFVNVAKELAAEYPDIQLETELIDNTCLNVVSNPSSYTDAVSVCPN 258

Query: 313 LYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVM 372
           LYGDI                   NIG+++SIFEAVHGSAPDIAG+N ANPTALLLSSVM
Sbjct: 259 LYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVM 318

Query: 373 MLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           MLNHMG+++HAD+IE AVL TIA G E RTGDL G+A+T++FTDA+IKKL
Sbjct: 319 MLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAIIKKL 368

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/352 (79%), Positives = 314/352 (89%)

Query: 71  KHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLF 130
           K QPSIG++TGKPNPSTGKYTVSFIEGDG+GPEIS SVK IF+AA+VP+EWE+CDVTPLF
Sbjct: 18  KKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPLF 77

Query: 131 IDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGF 190
           I+GLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA+SV+GF
Sbjct: 78  INGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSVEGF 137

Query: 191 KTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRP 250
           KTTY NVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLITR+ASERVIRYAFEY RA+GRP
Sbjct: 138 KTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRP 197

Query: 251 RLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVC 310
           +++VVHKSTIQRL+DGLFV+VAKELS EYPDIQ + +L+DNTVL VVSNP +Y D VSVC
Sbjct: 198 KVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVC 257

Query: 311 PNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSS 370
           PNLYGDI                   NIG+++SIFEAVHGSAPDIAG+N ANPTALLLSS
Sbjct: 258 PNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSS 317

Query: 371 VMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           VMMLNHMGL + AD IE AVLSTIASGPE+RT DLAG+A+TS+FT+AVIK+L
Sbjct: 318 VMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/353 (79%), Positives = 310/353 (87%)

Query: 70  VKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPL 129
           VK+QPSIG++TGKPNP+TGK+ VSFIEGDGIGPEIS SVK IF AA+VPI WE CDVTP+
Sbjct: 21  VKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKAAEVPINWEFCDVTPI 80

Query: 130 FIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKG 189
           F++GLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNLTLRKTF LFANVRPA+S++G
Sbjct: 81  FVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKTFNLFANVRPAKSIEG 140

Query: 190 FKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGR 249
           FKTTY +VDLVLIRENTEGEYSGIEHVV PGVVQSIKLITR+ASERVIRYAFEY +AIGR
Sbjct: 141 FKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGR 200

Query: 250 PRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309
           PR+VVVHKSTIQRL+DGLFVNVAKELSKEYP+I+ ETELIDNTVL VVSNP+ YTDAVSV
Sbjct: 201 PRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSV 260

Query: 310 CPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLS 369
           CPNLYGDI                   NIGNEISIFEAVHGSAPDIAG+N ANPTALLLS
Sbjct: 261 CPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLS 320

Query: 370 SVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           SVMMLNHMGL   A +IE AVL+TIAS  ++RTGDL G+ATTS+FTDAVIK L
Sbjct: 321 SVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/352 (78%), Positives = 312/352 (88%)

Query: 71  KHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLF 130
           + QPSIG++TGKPNP TGKYTVSFIEGDGIGPEIS SVK IFSAAKVP+EWE CDVTP+F
Sbjct: 19  RKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDIFSAAKVPVEWEYCDVTPIF 78

Query: 131 IDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGF 190
           I+GLTTIP+PAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA+S++GF
Sbjct: 79  INGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGF 138

Query: 191 KTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRP 250
           KTTY NVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLITR+ASERVIRYAFEY RA+GRP
Sbjct: 139 KTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRP 198

Query: 251 RLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVC 310
           ++VVVHKSTIQRL+DGLFVNVA+E+ KEYPDI+ + ELIDNTVL VVS P  Y+D+V+VC
Sbjct: 199 KVVVVHKSTIQRLADGLFVNVAQEVGKEYPDIELQPELIDNTVLNVVSKPEKYSDSVAVC 258

Query: 311 PNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSS 370
           PNLYGDI                   NIG+ +SIFEAVHGSAPDIAG+N ANPTALLLSS
Sbjct: 259 PNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLLSS 318

Query: 371 VMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           VMMLNHMGL +HADQIE+AVL+T+AS  ++RT DLAGTATTS+FT AVI++L
Sbjct: 319 VMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/350 (78%), Positives = 311/350 (88%)

Query: 73  QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFID 132
           QP+IG++TGKPNP TGKYTV FIEGDG+GPEIS SVK IF+AAKVPIEWE CDV P+F++
Sbjct: 19  QPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFAAAKVPIEWEPCDVGPIFVN 78

Query: 133 GLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFKT 192
           GLTTIP+ AVQSINK+LVALKGPLATPIGKGHRSLNLTLRKTF LFANVRPARSV  +KT
Sbjct: 79  GLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLNLTLRKTFNLFANVRPARSVPNYKT 138

Query: 193 TYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRL 252
           TY NVDLVLIRENTEGEYSGIEHV++PGV+QSIKLIT++ASERVIRYAFEY RAIGRPRL
Sbjct: 139 TYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLITKDASERVIRYAFEYTRAIGRPRL 198

Query: 253 VVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPN 312
           VVVHKSTIQR++DGLFVNVAKEL+ EYPDI+ +TELIDNT+L VV++P SYTDAVSVCPN
Sbjct: 199 VVVHKSTIQRMADGLFVNVAKELASEYPDIELQTELIDNTILNVVTHPESYTDAVSVCPN 258

Query: 313 LYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVM 372
           LYGDI                   NIG+++SIFEAVHGSAPDIAG+N ANPTALLLSSVM
Sbjct: 259 LYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVM 318

Query: 373 MLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           MLNHMGL++HA +IENA+LSTIASG E+RTGDLAGTATTS+FT+AVI KL
Sbjct: 319 MLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSFTEAVINKL 368

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/352 (76%), Positives = 309/352 (87%)

Query: 71  KHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLF 130
           K QPSIG+YTGKP+P+TGKYTVSFIEGDG+GPEIS +VK IF+AAK PI+WETCDVTPLF
Sbjct: 17  KKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVTPLF 76

Query: 131 IDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGF 190
           I+GLTTIP+PA  SINKNL+ALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA+S++GF
Sbjct: 77  INGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIQGF 136

Query: 191 KTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRP 250
           KT Y NVDLVLIRENTEGEYSGIEHVV PGVVQSIKLIT++ASERVIRYAFEY RA+ RP
Sbjct: 137 KTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERP 196

Query: 251 RLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVC 310
           +++VVHKSTIQRL+DGLFV+VA++L+KEYPDI+ +TELIDNTVL  V +P  Y+D V VC
Sbjct: 197 KVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVC 256

Query: 311 PNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSS 370
           PNLYGDI                   NIG+E+SIFEAVHGSAPDIAG+N ANPTALLLSS
Sbjct: 257 PNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSS 316

Query: 371 VMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           VMMLNHMGL++HAD+IE AV STIASGPE+RTGDLAG+A+TS+F +AVI +L
Sbjct: 317 VMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/350 (77%), Positives = 308/350 (88%)

Query: 73  QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFID 132
           QPSIGKYTGKP+P TGKYTVSFIEGDG+GPEIS SVK IF+AAKVPI WE+C VTPL ++
Sbjct: 22  QPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCPVTPLLVN 81

Query: 133 GLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFKT 192
           G+TTIPE A +SIN+NLVALKGPLATPIGKGHRS+NLTLRKTFGLFANVRPA+SV+GFKT
Sbjct: 82  GVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTLRKTFGLFANVRPAKSVEGFKT 141

Query: 193 TYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRL 252
           TY +VDLVLIRENTEGEY+GIEHV+ PGVVQSIKLITREASERVIRYA+EY RA+GRP+L
Sbjct: 142 TYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRPKL 201

Query: 253 VVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPN 312
           VVVHKSTIQRL+DGLFV VAKEL+ E+PDIQ +TELIDNTVL VVSNPS Y+D V VCPN
Sbjct: 202 VVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPN 261

Query: 313 LYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVM 372
           LYGDI                   NIG+++SIFEAVHGSAPDIAG+N ANPTALLLSSVM
Sbjct: 262 LYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVM 321

Query: 373 MLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           MLNHMGL +HA +IE AVL+TIA+GPESRTGDLAG+A+TS+FT+AVI +L
Sbjct: 322 MLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/352 (75%), Positives = 310/352 (88%)

Query: 71  KHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLF 130
           K QPSIG+YTGKP+P+TGKYTVSFIEGDG+GPEIS +VK IF+AAK PI+WE+CDV+PLF
Sbjct: 17  KKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWESCDVSPLF 76

Query: 131 IDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGF 190
           I+GLTTIP+PA  SINKNL+ALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA+SV+G+
Sbjct: 77  INGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSVQGY 136

Query: 191 KTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRP 250
           KT Y NVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT++ASERVIRYAFEY RA+ RP
Sbjct: 137 KTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITQDASERVIRYAFEYARAVERP 196

Query: 251 RLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVC 310
           ++VVVHKSTIQRL+DGLFV+VA++LSKEYPDI+ +TELIDNTVL  V +P+ Y+D V VC
Sbjct: 197 KVVVVHKSTIQRLADGLFVSVAEQLSKEYPDIELQTELIDNTVLHTVRDPTKYSDVVVVC 256

Query: 311 PNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSS 370
           PNLYGDI                   NIG+++SIFEAVHGSAPDIAG+N ANPTALLLSS
Sbjct: 257 PNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSS 316

Query: 371 VMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           VMMLNHMGL++HAD+IE AV +TIA+GPESRTGDL G+A+TS+F +AVI +L
Sbjct: 317 VMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/352 (75%), Positives = 309/352 (87%)

Query: 71  KHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLF 130
           K QPSIG+YTGKPNP TGKYTVSFIEGDG+GPEIS SVK IFSAAKVPIEWE+CDV+P+F
Sbjct: 17  KKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSAAKVPIEWESCDVSPIF 76

Query: 131 IDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGF 190
           ++GLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA+S++G+
Sbjct: 77  VNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGY 136

Query: 191 KTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRP 250
           KTTY NV+LVLIRENTEGEYSGIEHVV PGVVQSIKLIT++ASERVIRYAFEY RA+ R 
Sbjct: 137 KTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRS 196

Query: 251 RLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVC 310
           +++VVHKSTIQRL+DGLFV+VAK+LS EYPDI+ +TEL+DNTVLK V +P +Y D V VC
Sbjct: 197 KVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVC 256

Query: 311 PNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSS 370
           PNLYGDI                   NIG+ +SIFEAVHGSAPDIAG+N ANPTALLLSS
Sbjct: 257 PNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSS 316

Query: 371 VMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           VMMLNHMGL++HAD+IE AVL+TIAS  ++RTGDL G+A+TS+FTDAVI++L
Sbjct: 317 VMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/351 (76%), Positives = 305/351 (86%), Gaps = 1/351 (0%)

Query: 72  HQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFI 131
            QPSIG+Y GKPN + GKYTVSFIEGDG+GPEIS SVK IFSAA VP+EWE CDVTPL +
Sbjct: 18  RQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLV 76

Query: 132 DGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFK 191
           +GLTTIPEPAV SINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA+S++G+K
Sbjct: 77  NGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGYK 136

Query: 192 TTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPR 251
           TTY +VDLVLIRENTEGEYSGIEHVV+PGVVQSIKLITREASERVIRYAFEY R +GRP+
Sbjct: 137 TTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPK 196

Query: 252 LVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCP 311
           +VVVHKSTIQRL+DGLFVNVA+EL +EYPDI+ +TEL+DNTVL VV+ P +Y D V+VCP
Sbjct: 197 VVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCP 256

Query: 312 NLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSV 371
           NLYGDI                   NIG+++SIFEAVHGSAPDIAG+N ANPTALLLSSV
Sbjct: 257 NLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSV 316

Query: 372 MMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           MMLNHMGL +HA +IE AVLSTIAS  E+RT DLAGTA+TS+FT+AVI++L
Sbjct: 317 MMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/347 (76%), Positives = 304/347 (87%)

Query: 76  IGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLT 135
           +GKY G PNPSTG++TV FIEGDG+GPEIS SVK IF AA+VP++WE CDV+PL I+GLT
Sbjct: 27  VGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLT 86

Query: 136 TIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFKTTYP 195
           TIPEPAVQ INK+ +ALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARS++G++TTY 
Sbjct: 87  TIPEPAVQQINKHKIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSIRGYETTYK 146

Query: 196 NVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVV 255
           NVDLVLIRENTEGEYSGIEHVV PGVVQSIKLITR+ASERVIRYA+EY RAIGRPRLVVV
Sbjct: 147 NVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVV 206

Query: 256 HKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYG 315
           HKSTIQ+L+DGLFVN+AKEL+ E+PDI+ ETELIDNTVL VV +P SYTDAV+VCPNLYG
Sbjct: 207 HKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYG 266

Query: 316 DIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLN 375
           DI                   NIGNE+SIFEAVHGSAPDIAG+N ANPTALLLSS MMLN
Sbjct: 267 DILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLN 326

Query: 376 HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           +MGL  ++++IENA+L+TIASG E+RTGDLAGTATTS+FT++VIK L
Sbjct: 327 YMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/353 (76%), Positives = 304/353 (86%), Gaps = 2/353 (0%)

Query: 72  HQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFI 131
            QPSIG++TGKP+ +TGKYTVSFIEGDGIGPEIS SVK IF AA VPI WETCDV+P+ +
Sbjct: 26  RQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILV 85

Query: 132 DGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFK 191
           DGLTTIP+ AV+SINKNLV LKGPLATPIGKGHRSLNLTLRKTF LFANVRPA+SV+GFK
Sbjct: 86  DGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFNLFANVRPAKSVRGFK 145

Query: 192 TTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPR 251
           TTY NVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITR+ASERVIRYAFEY +AIGRP+
Sbjct: 146 TTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPK 205

Query: 252 LVVVHKSTIQRLSDGLFVNVAKELSKE--YPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309
           ++VVHKSTIQRLSDGLFVNVAKEL KE  + +I+ +TELIDNTVL VV NPS Y+DAV V
Sbjct: 206 VIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFV 265

Query: 310 CPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLS 369
           CPNLYGDI                   NIG++ISIFEAVHGSAPDIAG+N ANPTALLLS
Sbjct: 266 CPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKANPTALLLS 325

Query: 370 SVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           SVMML+HMGL+++ D+IENAVL TIA+  ++RTGDL GTATT++FT+AVI  L
Sbjct: 326 SVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/350 (73%), Positives = 305/350 (87%)

Query: 73  QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFID 132
           QPSIG++TGKP+P+TGK+TV FIEGDG+GPEIS SVK+IFSAAKVPIEW  CDV P+F++
Sbjct: 19  QPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFSAAKVPIEWVPCDVGPIFVN 78

Query: 133 GLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFKT 192
           G TTIPEPAV+ INK+L+ALKGPLATPIGKGHRSLNLTLRKTF LFANVRPARS+  +K+
Sbjct: 79  GQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLNLTLRKTFNLFANVRPARSIPNYKS 138

Query: 193 TYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRL 252
           TY NVDLVLIRENTEGEYSGIEHV+TPGV+QSIKLITREA+ERV+RYAFEY +AIGRPRL
Sbjct: 139 TYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLITREATERVVRYAFEYTQAIGRPRL 198

Query: 253 VVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPN 312
           +V+HKSTIQR++DGLFV VA+EL+ EYPDI+ ETE+ID ++L VVS P  Y+DAVSVCPN
Sbjct: 199 LVIHKSTIQRMADGLFVKVAEELASEYPDIKLETEIIDKSILNVVSKPELYSDAVSVCPN 258

Query: 313 LYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVM 372
           LYGDI                   NIG+++SIFEAVHGSAPDIAG+N ANPTALLLSSVM
Sbjct: 259 LYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVM 318

Query: 373 MLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           ML HMGL +HA++IENAVL+TIASG E+RT DL+GTA+TS+FT+ VI++L
Sbjct: 319 MLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/353 (74%), Positives = 302/353 (85%), Gaps = 1/353 (0%)

Query: 70  VKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPL 129
           + +QP+IG++TGK N S+G YTV FIEGDG+GPEIS SVK IFSAA VPI+W+ CDV P+
Sbjct: 25  ISNQPTIGRFTGKTN-SSGTYTVPFIEGDGVGPEISKSVKDIFSAANVPIQWQPCDVGPI 83

Query: 130 FIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKG 189
           F++GLTTIPEPAV++I ++LVALKGPLATP+GKGHRSLNLTLRKTF LFANVRPA+SV  
Sbjct: 84  FVNGLTTIPEPAVKAIKESLVALKGPLATPVGKGHRSLNLTLRKTFDLFANVRPAKSVPN 143

Query: 190 FKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGR 249
           +K+TY NVDLVLIRENTEGEYSGIEH+VTPGVVQSIKLITREASE+VIRYA+EY  A+GR
Sbjct: 144 YKSTYENVDLVLIRENTEGEYSGIEHIVTPGVVQSIKLITREASEKVIRYAYEYAIAVGR 203

Query: 250 PRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309
           PRL+VVHKSTIQRL DGLFV +A EL  EYP I+ ET+++DNTVL VVSNP+ Y DAVSV
Sbjct: 204 PRLIVVHKSTIQRLGDGLFVQIANELQSEYPSIKLETQILDNTVLNVVSNPTLYKDAVSV 263

Query: 310 CPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLS 369
           CPNLYGDI                   NIG+++SIFEAVHGSAPDIAG+N ANPTALLLS
Sbjct: 264 CPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLS 323

Query: 370 SVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           SVMMLNHMGL +HA +IENAVLSTIASGPESRTGDL G+ATTS+FT+ VIKKL
Sbjct: 324 SVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/350 (73%), Positives = 300/350 (85%)

Query: 73  QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFID 132
           QPSIGK+TGKP+P TG Y VSFIEGDGIGPEIS SVK IF+AAKVP+++E+  V P+ ++
Sbjct: 19  QPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFAAAKVPVDFESVVVKPILVN 78

Query: 133 GLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFKT 192
           G+T+IPE A +SIN NLVALKGPLATP+GKGHRS+NLTLRKTFGLFAN+RPA+SV+GFKT
Sbjct: 79  GVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMNLTLRKTFGLFANLRPAKSVEGFKT 138

Query: 193 TYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRL 252
            Y NV+LVLIRENTEGEY+GIEH + PGVVQSIKLITREASERVIR+A+EY RA  RPRL
Sbjct: 139 IYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLITREASERVIRFAYEYARAAERPRL 198

Query: 253 VVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPN 312
           +VVHKSTIQRLSDGLFV+VAKEL  E+PDI+ ETELIDN VL  V++P+ Y+DAVSVCPN
Sbjct: 199 IVVHKSTIQRLSDGLFVDVAKELQSEFPDIKLETELIDNAVLNTVTDPTKYSDAVSVCPN 258

Query: 313 LYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVM 372
           LYGDI                   NIG+++SIFEAVHGSAPDIAGK+ ANPTALLLSSVM
Sbjct: 259 LYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVM 318

Query: 373 MLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           ML+HMGL +HA QIE AVL+TIA+GPESRTGDL G+A+TS+FT+AVIKKL
Sbjct: 319 MLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  485 bits (1248), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 232/348 (66%), Positives = 274/348 (78%), Gaps = 1/348 (0%)

Query: 75  SIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGL 134
           SIG + GKPNP TG YTV FIEGDG+GPEIS SV+ IF AAKVPI+W  CD+ PL I+G 
Sbjct: 30  SIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFKAAKVPIDWVNCDIGPLLINGE 89

Query: 135 TTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFKTTY 194
           TTIP+ AV  IN +L+ALKGPLATP+G+GHRS+NLTLRKTFGLFANVRPA+S+    +TY
Sbjct: 90  TTIPQTAVDQINNSLIALKGPLATPVGQGHRSINLTLRKTFGLFANVRPAKSIPNLASTY 149

Query: 195 PNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVV 254
            NVDL++IRENTEGEYSGIEH + PGVVQSIKLITR+ASE+VI+YAFEY R+IGR  L+V
Sbjct: 150 ENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLITRKASEKVIKYAFEYTRSIGRSNLIV 209

Query: 255 VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLY 314
           VHK+TIQR  DGLFV  A+E++ +YPD+  + ELIDNTVL  + NP  Y D+VSVCPNLY
Sbjct: 210 VHKATIQRRGDGLFVQTAQEMADKYPDVNLKLELIDNTVLNCIMNPEKYADSVSVCPNLY 269

Query: 315 GDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMML 374
           GDI                   NIG E  ++EAVHGSAPDIAG++ ANPTALLLSSVMML
Sbjct: 270 GDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKANPTALLLSSVMML 328

Query: 375 NHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           NHMGL K+AD IE AVL+TI SG E RT DL G+ATT++FT AVI+ L
Sbjct: 329 NHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  273 bits (698), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 145/343 (42%), Positives = 218/343 (63%), Gaps = 10/343 (2%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAV 142
           P    G++TV+ I GDG+G EI++SVK IF A K+P++WET ++     D    + E AV
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVKTIFEAEKIPVDWETVNIKQ--TDHKEGVYE-AV 78

Query: 143 QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVL 201
           +S+ +N + LKG   TP  + GH SLN+ LRK   ++ANV   +S+KG KT  P++DL++
Sbjct: 79  ESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 202 IRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTIQ 261
           IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R+AF++ +   R  +  VHK+ I 
Sbjct: 139 IRENTEGEFSGLEHESVPGVVESLKIMTRPKTERIARFAFDFAKKYNRKAVTAVHKANIM 198

Query: 262 RLSDGLFVNVAKEL-SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXX 320
           +L DGLF N+  E+  KEYPDI   + ++DN  ++ V+ P  +   V V P++YG I   
Sbjct: 199 KLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-LG 255

Query: 321 XXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHMGL 379
                           N G + ++FE        DI G+N+ANPTA++LSSV+MLNH+GL
Sbjct: 256 NIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGL 315

Query: 380 SKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           +++A +I  AV  TIA G  + T D+ G+++T+ FT+ +I KL
Sbjct: 316 NEYATRISKAVHETIAEGKHT-TKDIGGSSSTTDFTNEIINKL 357

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  271 bits (693), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 149/343 (43%), Positives = 212/343 (61%), Gaps = 9/343 (2%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAV 142
           P    G+YTV+ I GDGIG E+++SV QIF A  VP++WE+ +++ L  +      + AV
Sbjct: 23  PKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEAENVPVDWESVELSALEENHEGV--QKAV 80

Query: 143 QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVL 201
           +S+ +N V LKG   TP  + GH SLN+  RK   +FANV   +S  G KT   +VDLV+
Sbjct: 81  ESLKRNKVGLKGIWHTPADQTGHGSLNVAFRKQLDIFANVALFKSFPGVKTKLQDVDLVI 140

Query: 202 IRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTIQ 261
           IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++     R  +  VHK+ I 
Sbjct: 141 IRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIARFAFDFALKNNRKAVCAVHKANIM 200

Query: 262 RLSDGLFVNVAKEL-SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXX 320
           +L DGLF N   E+ +KEYP++   + ++DN  ++ V+ P  +   V V PNLYG I   
Sbjct: 201 KLGDGLFRNTVSEIGAKEYPEVNVSSIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-LG 257

Query: 321 XXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHMGL 379
                           N G E ++FE        DI G+++ANPTA++LSS +ML H+GL
Sbjct: 258 NIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIKGQDVANPTAMILSSTLMLRHLGL 317

Query: 380 SKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           +++AD+I  A   TIA G  + T D+ GTATT+ FT+AVI KL
Sbjct: 318 NEYADRISRATYETIAEGKRT-TKDIGGTATTTEFTNAVIDKL 359

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  270 bits (691), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 150/352 (42%), Positives = 223/352 (63%), Gaps = 12/352 (3%)

Query: 75  SIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPL-FIDG 133
           ++ K T  P    G++TV+ + GDG+G EI++SV  IF +  VPI+WET D++ L   +G
Sbjct: 13  TLAKETIIPKKYGGRFTVTLLPGDGVGKEITDSVVSIFKSENVPIDWETVDISGLDHTEG 72

Query: 134 LTTIPEPAVQSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKT 192
           +    + AV S+ +N + LKG   TP  + GH SLN+  RK   ++ANV   +S++G KT
Sbjct: 73  V----KAAVDSLKRNKIGLKGIWHTPADQVGHGSLNVAFRKQLDIYANVAIFKSIEGVKT 128

Query: 193 TYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRL 252
             PNVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++ +   R  +
Sbjct: 129 KIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKSKSERIARFAFDFAKRNNRKSV 188

Query: 253 VVVHKSTIQRLSDGLFVN-VAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCP 311
             VHK+ I +LSDGLF N V+K   +EYP+IQ  + ++DN  ++ V+ P  +   V V P
Sbjct: 189 TAVHKANIMKLSDGLFRNTVSKIGEEEYPEIQTSSIIVDNASMQAVAKPHQFD--VMVTP 246

Query: 312 NLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSS 370
           ++YG I                   N G + ++FE        DI G+N+ANPTA+LLS+
Sbjct: 247 SMYGTI-VGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSA 305

Query: 371 VMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
            ++L+H+GL K A++I++AV   IA G ++ T D+ G+A+T+ FT AVI KL
Sbjct: 306 TLLLDHLGLEKSANRIKSAVYDVIAEG-KATTQDIGGSASTTEFTQAVINKL 356

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  269 bits (688), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 148/343 (43%), Positives = 212/343 (61%), Gaps = 10/343 (2%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAV 142
           P    G+YTV+ I GDG+G E+++SV +IF    +PI+WET D++ L     T   + AV
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENENIPIDWETIDISGL---ENTENVQRAV 79

Query: 143 QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVL 201
           +S+ +N V LKG   TP  + GH SLN+ LRK   +FANV   +S+ G KT   N+D+V+
Sbjct: 80  ESLKRNKVGLKGIWHTPADQTGHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVI 139

Query: 202 IRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTIQ 261
           IRENTEGEYSG+EH   PGVV+S+K++TR  SER+ R+AF++     R  +  VHK+ I 
Sbjct: 140 IRENTEGEYSGLEHESVPGVVESLKIMTRAKSERIARFAFDFALKNNRKSVCAVHKANIM 199

Query: 262 RLSDGLFVNVAKEL-SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXX 320
           +L DGLF N   E+ + EYP++  +  ++DN  ++ V+ P  +   V V PNLYG I   
Sbjct: 200 KLGDGLFRNTVNEIGANEYPELDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-LG 256

Query: 321 XXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHMGL 379
                           N G E ++FE        DI G+N+ANPTA++LSS +ML H+GL
Sbjct: 257 NIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHLGL 316

Query: 380 SKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           + +AD+I  A    I+ G +S T D+ G+A+TS FT+AVI+KL
Sbjct: 317 NAYADRISKATYDVISEG-KSTTRDIGGSASTSEFTNAVIEKL 358

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  268 bits (685), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 143/343 (41%), Positives = 216/343 (62%), Gaps = 10/343 (2%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAV 142
           P    G++TV+ I GDG+G EI++SV+ IF A  +PI+WET ++     D    + E AV
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPIDWETINIKQ--TDHKEGVYE-AV 78

Query: 143 QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVL 201
           +S+ +N + LKG   TP  + GH SLN+ LRK   ++ANV   +S+KG KT  P++DL++
Sbjct: 79  ESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 202 IRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTIQ 261
           IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R+AF++ +   R  +  VHK+ I 
Sbjct: 139 IRENTEGEFSGLEHESVPGVVESLKVMTRPKTERIARFAFDFAKKYNRKSVTAVHKANIM 198

Query: 262 RLSDGLFVNVAKEL-SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXX 320
           +L DGLF N+  E+  KEYPDI   + ++DN  ++ V+ P  +   V V P++YG I   
Sbjct: 199 KLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-LG 255

Query: 321 XXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHMGL 379
                           N G + ++FE        DI G+N+ANPTA++LSS +MLNH+GL
Sbjct: 256 NIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGL 315

Query: 380 SKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           +++A +I  AV  TIA G  + T D+ G+++T+ FT+ +I KL
Sbjct: 316 NEYATRISKAVHETIAEGKHT-TRDIGGSSSTTDFTNEIINKL 357

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  268 bits (684), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 145/344 (42%), Positives = 221/344 (64%), Gaps = 11/344 (3%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAV 142
           P    G+YTV+ I GDG+G E+++SV  IF A  VP++W+  D++   +D    + + AV
Sbjct: 22  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKAENVPVDWDRVDISG--VDRAEDV-KSAV 78

Query: 143 QSINKNLVALKGPLAT-PIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLV 200
           +S+ +N + LKG   T P  + GH SLN+ LRK   ++ANV   +S+ G +   P+VDLV
Sbjct: 79  ESLKRNRIGLKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSIPGVQVKIPDVDLV 138

Query: 201 LIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTI 260
           +IRENTEGE+SG+EH   PGVV+S+K++T++  ER+ R+AF+Y +   R ++V VHK+ I
Sbjct: 139 VIRENTEGEFSGLEHESVPGVVESLKIMTQDNIERIARFAFDYAKKNDRKQVVAVHKANI 198

Query: 261 QRLSDGLFVNVAKELS-KEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXX 319
            ++ DGLF N+ +E+  KEYP++Q    ++DN  ++ V+NP  +   V V P++YG I  
Sbjct: 199 MKMGDGLFKNLVQEVGEKEYPELQVGNIIVDNASMQTVANPHQFD--VLVTPSMYGTI-L 255

Query: 320 XXXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHMG 378
                            N G ++++FE        DI G+N+ANPTA++LSSV++LNH+G
Sbjct: 256 GNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKGQNVANPTAMILSSVLLLNHLG 315

Query: 379 LSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           L+  AD+I  AV + IA G +S T D+ GTA+T+ FT+AVI KL
Sbjct: 316 LNTSADRISKAVHAVIAEG-KSVTRDIGGTASTTEFTEAVINKL 358

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  267 bits (683), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 142/343 (41%), Positives = 218/343 (63%), Gaps = 10/343 (2%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAV 142
           P    G++TV+ I GDG+G EI++SV+ IF A ++P++WET ++     D    + E AV
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAERIPVDWETINIKQ--TDHKEGVYE-AV 78

Query: 143 QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVL 201
           +S+ +N + LKG   TP  + GH SLN+ LRK   ++ANV   +S+KG KT  P++DL++
Sbjct: 79  ESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 202 IRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTIQ 261
           IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++ +   R  +  VHK+ I 
Sbjct: 139 IRENTEGEFSGLEHESVPGVVESLKVMTKPKTERIARFAFDFAKKYNRKAVTAVHKANIM 198

Query: 262 RLSDGLFVNVAKELSK-EYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXX 320
           +L DGLF N+  E+ + EYPDI   + ++DN  ++ V+ P  +   V V P++YG I   
Sbjct: 199 KLGDGLFRNIITEIGQTEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-LG 255

Query: 321 XXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHMGL 379
                           N G + ++FE        DI G+N+ANPTA++LSSV+MLNH+GL
Sbjct: 256 NIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGL 315

Query: 380 SKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           +++A +I  AV  TIA G  + T D+ G+++T+ FT+ VI KL
Sbjct: 316 NENATRISKAVHETIAEGKHT-TRDIGGSSSTTDFTNEVINKL 357

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  265 bits (676), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 146/343 (42%), Positives = 209/343 (60%), Gaps = 10/343 (2%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAV 142
           P    G+YTV+ I GDG+G E+++SV  IF A  VPI+WET ++T   +D    + + AV
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFEAENVPIDWETINITG--VDSEEGV-QKAV 79

Query: 143 QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVL 201
           +S+ +N + LKG   TP  + GH SLN+  RK   +FANV   ++V G KT   N+DLV+
Sbjct: 80  ESLKRNKIGLKGIWHTPADQTGHGSLNVAFRKQLDIFANVALFKNVPGVKTKLSNIDLVV 139

Query: 202 IRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTIQ 261
           IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++     R  +  VHK+ I 
Sbjct: 140 IRENTEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFALKNNRKSVCAVHKANIM 199

Query: 262 RLSDGLFVNVAKEL-SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXX 320
           +L DGLF N   E+ + EYP+I  +  ++DN  ++ V+ P  +   V V PNLYG I   
Sbjct: 200 KLGDGLFRNTVNEVGASEYPEIDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-LG 256

Query: 321 XXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHMGL 379
                           N G E ++FE        DI GK++ANPTA++LSS +ML H+GL
Sbjct: 257 NIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAMILSSTLMLRHLGL 316

Query: 380 SKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           + +AD+I  A    IA G  + T D+ G+++T+ FT +VI KL
Sbjct: 317 NGYADRISKATYDVIAEGKHT-TKDIGGSSSTTEFTKSVIDKL 358

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  265 bits (676), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 146/344 (42%), Positives = 215/344 (62%), Gaps = 12/344 (3%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPL-FIDGLTTIPEPA 141
           P    G+YTV+ I GDG+G E+++SV  IF+A  +PI+WE  D++ L   +G+    E A
Sbjct: 27  PKEYGGRYTVTLIPGDGVGKEVTDSVVSIFNAENLPIDWERVDISGLDHEEGV----EAA 82

Query: 142 VQSINKNLVALKGPLATPIGKG-HRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLV 200
           V S+ +N + LKG   T  G+  H SLN+ LRK   ++ANV   +++ G KT  P+VDLV
Sbjct: 83  VNSLKRNKIGLKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLV 142

Query: 201 LIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTI 260
           +IRENTEGEYSG+EH   PGVV+S+K+IT+E SER+ R+AF++ +   R  +  VHK+ I
Sbjct: 143 IIRENTEGEYSGLEHESVPGVVESLKIITKEKSERIARFAFDFAKRFDRKLVTAVHKANI 202

Query: 261 QRLSDGLFVNVAKELSK-EYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXX 319
            +L DGLF N    + + EYPDI+  + ++DN  ++ V+ P  +   V V P++YG I  
Sbjct: 203 MKLGDGLFRNSVTSIGETEYPDIKVSSIIVDNASMQSVAKPHQFD--VLVTPSMYGTI-L 259

Query: 320 XXXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHMG 378
                            N G E ++FE        DI G+N+ANPTA++LSS ++L H+G
Sbjct: 260 GNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILSSTLLLKHLG 319

Query: 379 LSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           L+  A +IE+AV  TIA G  + T D+ G+A+T+ FT+ +IKKL
Sbjct: 320 LNNEAKKIEDAVYKTIAEGKVT-TRDIGGSASTTEFTNEIIKKL 362

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  264 bits (674), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 144/345 (41%), Positives = 213/345 (61%), Gaps = 13/345 (3%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLF--IDGLTTIPEP 140
           P    G+YTV+ I GDG+G E+++SV  IF A  VPI+WE+ +++ L   ++G+    + 
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVNIFEAENVPIDWESVELSGLEENMEGV----QK 78

Query: 141 AVQSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDL 199
           AV+S+ +N V LKG  +TP  + GH SLN+  RK   +FANV   +S  G KT   +VDL
Sbjct: 79  AVESLKRNKVGLKGIWSTPADQTGHGSLNVAFRKQLDIFANVALFKSFPGVKTKLKDVDL 138

Query: 200 VLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKST 259
           V+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++     R  +  VHK+ 
Sbjct: 139 VIIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIARFAFDFALKNNRRSVCAVHKAN 198

Query: 260 IQRLSDGLFVNVAKEL-SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIX 318
           I +L DGLF N   E+ +KEYP+++ ++ ++DN  ++ V+ P  +   V V PNLYG I 
Sbjct: 199 IMKLGDGLFRNTVNEIGAKEYPELEVKSIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 255

Query: 319 XXXXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHM 377
                             N G E ++FE        DI G+++ANPTA++LSS +ML H+
Sbjct: 256 LGNVGAALIGSPGLVPGANFGREYAVFEPGSRHVGLDIKGQDVANPTAMILSSTLMLRHL 315

Query: 378 GLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           GL+ +AD+I  A    IA G  + T D+ G A+T+ FT A++ KL
Sbjct: 316 GLNDYADRISKATYEVIAEGKHT-TKDIGGHASTTQFTKAIVDKL 359

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  263 bits (671), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 147/345 (42%), Positives = 209/345 (60%), Gaps = 13/345 (3%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPL-FIDGLTTIPEPA 141
           PN   G+YTV+ + GDG+G E ++SV  +F+A  +PI+WE  +++ L   +G+      A
Sbjct: 20  PNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIPIDWEIVNISGLDHKEGVAA----A 75

Query: 142 VQSINKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDL 199
           VQS+ +N + LKG   T      GH SLN+  RK   ++ANV   +S+KG KT  P+VDL
Sbjct: 76  VQSLRRNKIGLKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVDL 135

Query: 200 VLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKST 259
           V+IRENTEGE+SG+EH    GVV+S+K+ T   +ER+ R+AF Y +  GR  +  VHK+ 
Sbjct: 136 VVIRENTEGEFSGLEHESVEGVVESLKVTTLPKTERIARFAFNYAQKNGRKAVCAVHKAN 195

Query: 260 IQRLSDGLFVNVAKELS-KEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIX 318
           I +L DGLF N    +  KEYPDI+  + ++DN  ++ V+ P  +   V V P++YG I 
Sbjct: 196 IMKLGDGLFRNTVTSIGEKEYPDIETSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI- 252

Query: 319 XXXXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHM 377
                             N G E ++FE        DI G+N+ANPTA+LLSS +MLNH+
Sbjct: 253 IGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAMLLSSALMLNHL 312

Query: 378 GLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           GL+K   +I +AV   IA G + RT D+ G ATT+ FT AVI+KL
Sbjct: 313 GLTKSGKRISDAVREVIAEG-DVRTKDIGGDATTTEFTQAVIEKL 356

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  262 bits (669), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 145/343 (42%), Positives = 212/343 (61%), Gaps = 10/343 (2%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAV 142
           P    G+YTV+ I GDG+G E+++SV  IF +  +PI+WET +++ L  D    + + AV
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENIPIDWETVEISGL--DNQEGV-QKAV 79

Query: 143 QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVL 201
           +S+ +N V LKG   TP  + GH SLN+ LRK   +FANV   +SV G  + + NVD+V+
Sbjct: 80  ESLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVDMVV 139

Query: 202 IRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTIQ 261
           IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++     R  +  VHK+ I 
Sbjct: 140 IRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIGRFAFDFAVKNNRKSVCAVHKANIM 199

Query: 262 RLSDGLFVNVAKEL-SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXX 320
           +L DGLF N   E+ +KEYP+I  +  ++DN  ++ V+ P  +   V V PNLYG I   
Sbjct: 200 KLGDGLFRNCINEVGAKEYPEIDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-LG 256

Query: 321 XXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHMGL 379
                           N G E ++FE        DI G+N+ANPTA++LSS +ML H+GL
Sbjct: 257 NIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHLGL 316

Query: 380 SKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           + +AD+I  A    IA   ++ T D+ G+A+T+ FT+A+I KL
Sbjct: 317 NAYADRISKATYDVIAE-AKTTTQDIGGSASTTEFTEAIISKL 358

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  261 bits (668), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 145/343 (42%), Positives = 211/343 (61%), Gaps = 10/343 (2%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAV 142
           P    G+YTV+ I GDG+G E+++SV  IF +  VPI+WET +++ L  D    + + AV
Sbjct: 22  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENVPIDWETVEISGL--DNEEGV-QKAV 78

Query: 143 QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVL 201
            S+ +N V LKG   TP  + GH SLN+ LRK   +FANV   ++V G  + + NVDLV+
Sbjct: 79  DSLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDLVV 138

Query: 202 IRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTIQ 261
           IRENTEGEYSG+EH   PGVV+S+K++T+  S+R+ R+AF++     R  +  VHK+ I 
Sbjct: 139 IRENTEGEYSGLEHESVPGVVESLKIMTKAKSDRIGRFAFDFALKNNRKSVCAVHKANIM 198

Query: 262 RLSDGLFVNVAKEL-SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXX 320
           +L DGLF N   E+ +KEYP+I+ +  ++DN  ++ V+ P  +   V V PNLYG I   
Sbjct: 199 KLGDGLFRNCINEIGAKEYPEIEVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-LG 255

Query: 321 XXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHMGL 379
                           N G E ++FE        DI G+N+ANPTA++LSS +ML H+GL
Sbjct: 256 NIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHLGL 315

Query: 380 SKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           + +AD+I  A    IA    + T D+ G+A+T+ FT A+I+KL
Sbjct: 316 NSYADRISKATYDVIAEAKNT-TKDIGGSASTTDFTQAIIEKL 357

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  261 bits (668), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 148/345 (42%), Positives = 213/345 (61%), Gaps = 14/345 (4%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPE--P 140
           P    G+YTV+ I GDGIG E+++SV +IF++  +PI+WE  DV      G++   E   
Sbjct: 22  PKKYGGRYTVTLIPGDGIGKEVTDSVVKIFASQGLPIDWERIDVP-----GMSNENEVKK 76

Query: 141 AVQSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDL 199
           AV+S+ +N + LKG   T   + G+ SLN+ LRK   +FANV   +S+KG KT  P+VDL
Sbjct: 77  AVESLKRNKIGLKGIWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDL 136

Query: 200 VLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKST 259
           V+IRENTEGEYSG+EH   PGVV+S+K+IT+  +ER+ R+AF++     R  +  VHK+ 
Sbjct: 137 VVIRENTEGEYSGLEHESVPGVVESLKIITKPKTERIARFAFDFALENNRSTVTAVHKAN 196

Query: 260 IQRLSDGLFVNVAKEL-SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIX 318
           I +LSDGLF N   E+  KEYPDI+  T ++DN  ++ V+ P  +   V V P++YG I 
Sbjct: 197 IMKLSDGLFKNTVAEVGEKEYPDIKVNTIIVDNASMQAVAKPHQFD--VMVTPSMYGTI- 253

Query: 319 XXXXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHM 377
                             N G E ++FE        DI  +N+ANPTA++LS+ +MLN +
Sbjct: 254 LGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNQL 313

Query: 378 GLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           GL + + +I NAV + I  G ++ T D+ G A+T+ FTDAVI KL
Sbjct: 314 GLREESKRISNAVYAVIEEG-KTTTKDIGGNASTTEFTDAVIDKL 357

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  259 bits (662), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 144/351 (41%), Positives = 212/351 (60%), Gaps = 10/351 (2%)

Query: 75  SIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGL 134
           S+ K    P    G+YTV+ I GDG+G EI++SV  IF A  +P++WE  D++    D +
Sbjct: 12  SMAKELVLPKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIPVDWERVDISTS--DNI 69

Query: 135 TTIPEPAVQSINKNLVALKGPLATPIG-KGHRSLNLTLRKTFGLFANVRPARSVKGFKTT 193
             + + AV+S+ +N + LKG   T      H S N+ LRK   +FA+V   +SV G KT 
Sbjct: 70  QDVSQ-AVESLKRNKIGLKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTK 128

Query: 194 YPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLV 253
            PNVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++ +   R  + 
Sbjct: 129 IPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFAKKYNRKSVC 188

Query: 254 VVHKSTIQRLSDGLFVNVAKEL-SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPN 312
            VHK+ I ++ DGLF N   E+ + EYPDIQ  + ++DN  ++ V+ P  +   V V P+
Sbjct: 189 AVHKANIMKMGDGLFRNTVTEIGANEYPDIQTSSIIVDNASMQAVAKPHQFD--VMVTPS 246

Query: 313 LYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSV 371
           +YG I                   + G E ++FE        DI GKN+ANPTA++LSS 
Sbjct: 247 MYGTI-IGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILSST 305

Query: 372 MMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           +ML H+GL++ A +I  A    I+ G +  T D+ G+A+T+ FT+A+IK+L
Sbjct: 306 LMLQHLGLTESAKRIAKATHDVISLG-QVTTKDIGGSASTTEFTEAIIKRL 355

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  256 bits (653), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 145/347 (41%), Positives = 212/347 (61%), Gaps = 17/347 (4%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPL-FIDGLTTIPEPA 141
           P    G++ V+ I GDG+G E+++SV  IF A  +PI+W+  D++ L   +G+    + A
Sbjct: 22  PKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAENLPIDWDRVDISGLDHEEGV----QAA 77

Query: 142 VQSINKNLVALKG----PLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNV 197
           V S+ +N + LKG      A   GKG  SLN+ LRK   ++ANV   +SV G KT  PNV
Sbjct: 78  VDSLKRNKIGLKGIWHTSAADQAGKG--SLNVALRKELDIYANVALFKSVPGVKTKIPNV 135

Query: 198 DLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHK 257
           DLV+IRENTEGEYSG+EH   PGVV+S+K++T + +ER+ R+AF++ +   R  +  VHK
Sbjct: 136 DLVVIRENTEGEYSGLEHESVPGVVESLKIMTEDKTERIARFAFDFAKKYNRHAVTAVHK 195

Query: 258 STIQRLSDGLFVNVAKELS-KEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGD 316
           + I +L DGLF NV   +  +EYPD++  + ++DN  ++ V+ P  +   V V P++YG 
Sbjct: 196 ANIMKLGDGLFRNVVTRVGEQEYPDVKVGSIIVDNASMQTVAKPHQFD--VLVTPSMYGT 253

Query: 317 IXXXXXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLN 375
           I                   N G E ++FE        DI  KN+ANPTA++LS+ +ML+
Sbjct: 254 I-LGNIGAALIGGPGLVAGANYGREYAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLD 312

Query: 376 HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           H+GLS  A +I NAV   IA G +S T D+ G+A+T+ FT AVI+KL
Sbjct: 313 HLGLSTSATKISNAVHQVIAEG-KSTTPDIGGSASTTEFTQAVIEKL 358

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  256 bits (653), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 145/350 (41%), Positives = 208/350 (59%), Gaps = 11/350 (3%)

Query: 76  IGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPL-FIDGL 134
           I K T  P    G+ TV+ + GDG+G EI++SV  IF A  VPI+WET D++ L   DG+
Sbjct: 15  IPKETILPKKYGGRMTVTLLPGDGVGKEITDSVVSIFQAENVPIDWETVDISQLDHEDGV 74

Query: 135 TTIPEPAVQSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKTT 193
                 AV+S+ +N + LKG   T   + GH SLN+  RK   ++ANV   +S+ G KT 
Sbjct: 75  NA----AVESLKRNKIGLKGIWHTSADQVGHGSLNVAFRKQLDIYANVAFCKSIPGVKTK 130

Query: 194 YPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLV 253
            PNVDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ ++AF++     R  + 
Sbjct: 131 IPNVDLVIIRENTEGEYSGLEHESVPGVVESLKIVTKVNSERIAKFAFDFAMRHDRKMVT 190

Query: 254 VVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNL 313
            VHK+ I +LSDGLF N    + + YP I+ ++ ++DN  ++ V+ P  +   V V P++
Sbjct: 191 AVHKANIMKLSDGLFRNTVARVGEAYPQIKNDSIIVDNASMQAVAKPHQFD--VMVTPSM 248

Query: 314 YGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVM 372
           YG I                   N G E ++FE        DI G+N+ANPTA++LSS +
Sbjct: 249 YGTI-LGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTL 307

Query: 373 MLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           +L H+GL+  A +I  AV   I  G  + T D+ G A+T+ FT AVI KL
Sbjct: 308 LLQHLGLNDTASRISKAVYDVIKEG-NATTKDIGGNASTTEFTKAVIDKL 356

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  253 bits (647), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 140/343 (40%), Positives = 207/343 (60%), Gaps = 11/343 (3%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAV 142
           P    G+YTV+ + GDG+G EI++SV  IF A  +PI+WE  +++ L  + + T    AV
Sbjct: 22  PKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENLPIDWERVELSGLEQEDVHT----AV 77

Query: 143 QSINKNLVALKGPLATPIG-KGHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVL 201
           +S+ +N + LKG   T     GH S N+ LRK   ++ANV   +S KG  T  P+VDLV+
Sbjct: 78  ESLKRNKIGLKGIWHTSADHDGHTSWNVALRKELDIYANVAIFKSFKGVDTRIPDVDLVI 137

Query: 202 IRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTIQ 261
           IRENTEGEYSG+EH   PGVV+S+K++T + +ER+ R+AF+Y     R  +  VHK+ I 
Sbjct: 138 IRENTEGEYSGLEHESVPGVVESLKIMTAQKTERIARFAFDYAMKYNRKSVTAVHKANIM 197

Query: 262 RLSDGLFVNVAKEL-SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXX 320
           +L DGLF N+  E+ +KEYP++   + ++DN  ++ V+ P  +   V V P++YG I   
Sbjct: 198 KLGDGLFRNLVTEIGAKEYPEVGVSSIIVDNASMQAVAKPHQFD--VMVAPSMYGTI-LG 254

Query: 321 XXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHMGL 379
                           N G + ++FE        DI  +N+ANPTA++LS+ +MLNH+G 
Sbjct: 255 NIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNHLGF 314

Query: 380 SKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
              A +I  AV   IA G ++ T D+ G+ATT+ FT+AVI KL
Sbjct: 315 RNDAARISKAVHEVIAEG-KTTTRDIGGSATTTEFTNAVIAKL 356

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  241 bits (616), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 137/342 (40%), Positives = 206/342 (60%), Gaps = 13/342 (3%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAV 142
           P    G++ ++ I G+GIG E+++SV+ IF A  +PI+WE  ++     DG+ T    AV
Sbjct: 16  PKKYGGRFQITLIPGNGIGKEVTDSVRSIFQAENLPIDWEIVNIES-HRDGIKT----AV 70

Query: 143 QSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLI 202
            SI +N +ALKG  ++    G  SLN+ LRK   +FANV   +S     T  PNVDLV+I
Sbjct: 71  DSIKRNKIALKGIWSSDPIDG--SLNVALRKQLDIFANVAIFKSFDNVNTRIPNVDLVVI 128

Query: 203 RENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTIQR 262
           RENTEGE+SG+EH    GVV+S+K++T+  +ER+ R+AF++ +   R  +  VHK+ I +
Sbjct: 129 RENTEGEFSGLEHESVDGVVESLKIVTKPKTERIARFAFDFAKKHNRNHVTAVHKANIMK 188

Query: 263 LSDGLFVNVAKEL-SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXXX 321
           L DGLF N+   + + EYP+I+  + ++DN  ++ V+ P  +   V V P++YG I    
Sbjct: 189 LGDGLFKNIVAHIGNNEYPEIKNSSIIVDNASMQAVAKPHQFD--VLVSPSMYGTI-LGN 245

Query: 322 XXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLS 380
                          N G + ++FE        DI G+N+ANPTA++LS+  ML H+GL+
Sbjct: 246 IGAALIGGPGLVPGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLT 305

Query: 381 KHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
             A++I NAV   IA G  + T D+ GTA+T+ FTDAVI +L
Sbjct: 306 SPAERITNAVKHVIAQGT-TVTKDIGGTASTTEFTDAVINEL 346

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  215 bits (547), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 115/285 (40%), Positives = 173/285 (60%), Gaps = 9/285 (3%)

Query: 83  PNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAV 142
           P    G++TV+ I GDG+G E+++SVK IF A  +PI+WET ++     D    + E AV
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAENIPIDWETINIKQ--TDHKEGVNE-AV 78

Query: 143 QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVL 201
           +S+ +N + LKG   TP  + GH SLN+ LRK   ++ANV   +S+KG KT  P++DL++
Sbjct: 79  ESLRRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 202 IRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTIQ 261
           IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++ +   R  +  VHK+ I 
Sbjct: 139 IRENTEGEFSGLEHESVPGVVESLKIMTKPKTERIARFAFDFAKKYNRKAVTAVHKANIM 198

Query: 262 RLSDGLFVNVAKEL-SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXX 320
           +L DGLF N+  E+  KEYPDI   + ++DN  ++ V+ P  +   V V P++YG I   
Sbjct: 199 KLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-LG 255

Query: 321 XXXXXXXXXXXXXXXXNIGNEISIFE-AVHGSAPDIAGKNMANPT 364
                           N G + ++FE        DI G+N+ANPT
Sbjct: 256 NIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPT 300

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  166 bits (419), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 123/353 (34%), Positives = 176/353 (49%), Gaps = 27/353 (7%)

Query: 91  TVSFIEGDGIGPEISNSVKQIFSA--AKVPIEWETCDVTP---LFIDGLTTIPEPAVQSI 145
           T+  I GDGIG E+  + KQ+      K  + +E  D+      F+D    +P   V  +
Sbjct: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82

Query: 146 -NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLI 202
            NK   AL G + +P  K  G+ S  + LRK  GLFANVRP ++V+G  T    +DLV++
Sbjct: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140

Query: 203 RENTEGEYSGIEHVVT-----PGVVQSIKLITREASERVIRYAFEYC----RAIGRPRLV 253
           RENTE  Y  IE   T       + ++ K IT  A++R+ + A +      +  G   L 
Sbjct: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200

Query: 254 VVHKSTIQRLSDGLFVNVAKELSKE----YPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309
           V HKS +   SDGLF  V KE+ +     Y  + +  +++D+ V ++   P  +   V V
Sbjct: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIV 258

Query: 310 CPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLS 369
            PNLYGDI                   N+G  I I E  HGSAPDIAGK +ANP A + S
Sbjct: 259 APNLYGDILSDGAAALVGSLGLVPSA-NVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317

Query: 370 SVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           +  ML ++G S  A  I  AV + I    + +T DL G +TT    D ++ KL
Sbjct: 318 TAQMLEYLGYSNPAQDIYKAVDANIRDN-KIKTADLGGDSTTQQVIDDILGKL 369

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  163 bits (413), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 118/360 (32%), Positives = 181/360 (50%), Gaps = 27/360 (7%)

Query: 84  NPSTGKYTVSFIEGDGIGPEISNSVKQIFSAA--KVPIEWETCDVTP---LFIDGLTTIP 138
           N +    T+  I GDGIG E+  + KQ+  +   K  + ++  D+      F D    +P
Sbjct: 19  NAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFIDLQAGFQTFQDTGKALP 78

Query: 139 EPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYP 195
           +  VQ + +    AL G + +P  K  G+ S  + LRK  GL+AN+RP +SV+G  +   
Sbjct: 79  DETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLYANIRPVKSVEG--SNER 136

Query: 196 NVDLVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITREASERV----IRYAFEYCRA 246
            VD++++RENTE  Y  IE           V ++ K I+  A++R+    +  A +  + 
Sbjct: 137 PVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQRIATIALDIALQRLQN 196

Query: 247 IGRPRLVVVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSS 302
            G+  L V HKS +   SDGLF  V +E+      +Y  I +  +++D+ V ++   P  
Sbjct: 197 NGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQIVDSMVYRMFREPEC 256

Query: 303 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMAN 362
           +   V V PNLYGDI                   N+G EI I E  HGSAPDIAGK +AN
Sbjct: 257 FD--VIVAPNLYGDILSDGAAALVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIAGKGIAN 313

Query: 363 PTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           P A + S+ +ML  +G ++ A  I  AV + +  G   +T DL G ATT    D ++ +L
Sbjct: 314 PIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGL-VKTADLGGNATTQNVVDDILARL 372

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  163 bits (412), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 114/360 (31%), Positives = 187/360 (51%), Gaps = 27/360 (7%)

Query: 84  NPSTGKYTVSFIEGDGIGPEISNSVKQIFS--AAKVPIEWETCDV---TPLFIDGLTTIP 138
           N +    T+  I GDGIG E+  + K++      K  I+++  D+      F+D    +P
Sbjct: 17  NGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALP 76

Query: 139 EPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYP 195
           +  V  + +    AL G + +P  K  G+ S  + LRK  GL+AN+RP +SV G  T   
Sbjct: 77  DETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDR 134

Query: 196 NVDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITREASERVIRYAFEYC----RA 246
            VD+V++RENTE  Y     + I+      V ++ K I+  A+ ++ + A +      + 
Sbjct: 135 PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKN 194

Query: 247 IGRPRLVVVHKSTIQRLSDGLFVNVAKELSKE----YPDIQFETELIDNTVLKVVSNPSS 302
            G+  L V HKS +   SDGLF  V +++ ++    Y ++ +  +++D+ V ++   P  
Sbjct: 195 TGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPEC 254

Query: 303 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMAN 362
           +   V V PNLYGDI                   N+G +I I E  HGSAPDI+G+ ++N
Sbjct: 255 FD--VVVAPNLYGDILSDGAAALVGSLGVVPSA-NVGPDIIIGEPCHGSAPDISGQGISN 311

Query: 363 PTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           P A + S+ +ML  +G ++ A  I+NAV   I SG + +T DL G ++T+  TD ++ KL
Sbjct: 312 PVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  163 bits (412), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 120/353 (33%), Positives = 181/353 (51%), Gaps = 27/353 (7%)

Query: 91  TVSFIEGDGIGPEISNSVKQIFSAA--KVPIEWETCDV---TPLFIDGLTTIPEPAVQSI 145
           T+  I GDGIG E+  + KQI      K  ++++  D+      F +    +P+  V+ +
Sbjct: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85

Query: 146 NKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLI 202
            ++   AL G + +P  K  G+ S  + LRK  GLFANVRP ++V+G  T    VD+V++
Sbjct: 86  RRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIV 143

Query: 203 RENTEGEYSGIEHVVT-PG----VVQSIKLITREASERV----IRYAFEYCRAIGRPRLV 253
           RENTE  Y  IE   T P     V ++ K I+  A+ R+    +  A +  ++ G   L 
Sbjct: 144 RENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLT 203

Query: 254 VVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309
           V HKS +   SDGLF  + K++      +Y  IQ+  +++D+ V ++   P  +   V V
Sbjct: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVV 261

Query: 310 CPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLS 369
            PNLYGDI                   N+G EI I E  HGSAPDIAG+ +ANP A + S
Sbjct: 262 APNLYGDILSDGAAALVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIAGRGIANPIATIRS 320

Query: 370 SVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           + +ML  +G  + A  I  AV S I    + +T DL G +TT    D ++ K+
Sbjct: 321 TALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  162 bits (409), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 122/379 (32%), Positives = 185/379 (48%), Gaps = 41/379 (10%)

Query: 72  HQPSIGKYTGKPNPSTGK-YTVSFIEGDGIGPEISNSVKQI-----------FSAAKVPI 119
           H+ S      K   +T K  T+  I GDGIG E+  + +++           FS   +  
Sbjct: 2   HRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDA 61

Query: 120 EWETCDVTPLFIDGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFG 176
            W+T      F++    +P   V+++ +    AL G + +P  K  G+ S  + LR+  G
Sbjct: 62  GWQT------FLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLG 115

Query: 177 LFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRE 231
           L+AN+RP +SV G  T  P VDLV++RENTE  Y   E           V ++IK I+  
Sbjct: 116 LYANIRPVKSVSG--TGQP-VDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEP 172

Query: 232 ASERV----IRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQ 283
           A+ER+    +R A +  R  GR  L V HKS +   +DGLF  V +E+     K Y  I+
Sbjct: 173 ATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIE 232

Query: 284 FETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEIS 343
           +  +++D+ V ++   P  +   V V PNLYGD+                   N+GN I 
Sbjct: 233 YNEQIVDSMVYRLFKEPHCFD--VVVAPNLYGDLLSDGAAALVGSLGLVPSV-NVGNNII 289

Query: 344 IFEAVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTG 403
           I E  HGSAPDIAG+ +ANP A + S  +ML  +GL + A  I+ AV   +    +  + 
Sbjct: 290 IGEPCHGSAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSP 348

Query: 404 DLAGTATTSTFTDAVIKKL 422
           DL G  TT    D ++ ++
Sbjct: 349 DLGGKNTTQEVLDDILARI 367

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  162 bits (409), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 127/381 (33%), Positives = 188/381 (49%), Gaps = 48/381 (12%)

Query: 71  KHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQI-----------FSAAKVPI 119
           + Q +IG  + K N      T+  I GDGIG E+  S +Q+           F+   +  
Sbjct: 10  QFQRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQA 64

Query: 120 EWETCDVTPLFIDGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFG 176
            W+T      F+D    +P   V+++ +N   AL G + +P  K  G+ S  + LRK  G
Sbjct: 65  GWQT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELG 118

Query: 177 LFANVRPARSVK--GFKTTYPNVDLVLIRENTEGEYSGIEHV-----VTPGVVQSIKLIT 229
           L+AN+RP +SV   G K     VD+V++RENTE  Y  +E           V  + K I+
Sbjct: 119 LYANIRPVKSVDTPGNK----KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRIS 174

Query: 230 REASERVIRYAFEYC----RAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKE----YPD 281
             A+ R+ + A +      +  G  +L V HKS +   SDGLF  V KE+ +     Y D
Sbjct: 175 EVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSD 234

Query: 282 IQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNE 341
           IQ+  ++ID+ V ++   P  +   V V PNLYGDI                   N+G  
Sbjct: 235 IQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVGSLGVVPSA-NVGPG 291

Query: 342 ISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESR 401
           I I E  HGSAPDIAGK ++NP A + S+ +ML  +G S+ A  I+ AV S +    + +
Sbjct: 292 IVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRE-DKIK 350

Query: 402 TGDLAGTATTSTFTDAVIKKL 422
           T DL G  +TS   + VI++L
Sbjct: 351 TPDLGGKNSTSDVVNDVIRRL 371

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  162 bits (409), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 119/353 (33%), Positives = 178/353 (50%), Gaps = 27/353 (7%)

Query: 91  TVSFIEGDGIGPEISNSVKQIFSA--AKVPIEWETCDVTP---LFIDGLTTIPEPAVQSI 145
           T+  I GDGIG E+  + KQ+     +K  ++++  D+      F+D    +P+  VQ +
Sbjct: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86

Query: 146 NKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLI 202
                 AL G + +P  K  G+ S  + LRK  GLFANVRP +SV G K     VD+V++
Sbjct: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMVIV 144

Query: 203 RENTEGEYSGIEHVVTPG-----VVQSIKLITREASERV----IRYAFEYCRAIGRPRLV 253
           RENTE  Y  IE           V ++ K I+  A+ R+    +  A +  +  G+  L 
Sbjct: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204

Query: 254 VVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309
           V HKS +   SDGLF  + K++      +Y  I +  +++D+ V ++   P  +   V V
Sbjct: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262

Query: 310 CPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLS 369
            PNLYGDI                   N+G EI I E  HGSAPDIAGK +ANP A + S
Sbjct: 263 APNLYGDILSDGAAALVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321

Query: 370 SVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           + +ML  +G +  A  I  AV + +    + +T DL G +TT   T+ V+ +L
Sbjct: 322 TALMLEFLGHNDAAQDIHRAVEANMREN-KIKTPDLGGNSTTQQVTEDVLARL 373

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  159 bits (403), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 116/354 (32%), Positives = 182/354 (51%), Gaps = 28/354 (7%)

Query: 91  TVSFIEGDGIGPEISNSVKQIFSA--AKVPIEWETCDVTP---LFIDGLTTIPEPAVQSI 145
           T+  I GDGIG E+  + KQ+     +K  + ++  D+      F+D    +P+  +Q +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84

Query: 146 -NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLI 202
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP +SV+G  TT   VD+V++
Sbjct: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142

Query: 203 RENTEG------EYSGIEHVVTPGVVQSIKLITREASERV----IRYAFEYCRAIGRPRL 252
           RENT        E + I+      V ++ K I+  A+ R+    +  A +  +  G+  L
Sbjct: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202

Query: 253 VVVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVS 308
            V HKS +   SDGLF  + K++      +Y  I +  +++D+ V ++   P  +   V 
Sbjct: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VV 260

Query: 309 VCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLL 368
           V PNLYGDI                   N+G EI I E  HGSAPDIAGK ++NP A + 
Sbjct: 261 VAPNLYGDILSDGAAALVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319

Query: 369 SSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           S+ +ML  +G ++ A  I  AV + +    + +T DL G +TT   T+ V+ +L
Sbjct: 320 STALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  157 bits (398), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 117/359 (32%), Positives = 180/359 (50%), Gaps = 39/359 (10%)

Query: 91  TVSFIEGDGIGPEISNSVKQI-----------FSAAKVPIEWETCDVTPLFIDGLTTIPE 139
           T+  I GDGIG E+  + K +           F+   +   W+T      F+D    +P+
Sbjct: 22  TIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQT------FLDTGKALPD 75

Query: 140 PAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPN 196
             ++ +  +   AL G + +P  K  G+ S  + LRK  GL+ANVRP +SV+G  T    
Sbjct: 76  ETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRP 133

Query: 197 VDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITREASERVIRYAFEY----CRAI 247
           VD++++RENTE  Y     + I+      V ++IK I+  A+  + + A E      +A 
Sbjct: 134 VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKAN 193

Query: 248 GRPRLVVVHKSTIQRLSDGLFVNVAK---ELSKE-YPDIQFETELIDNTVLKVVSNPSSY 303
           G+  L V HKS +   SDGLF  V K   E +KE Y  I +  +++D+ V ++   P  +
Sbjct: 194 GKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECF 253

Query: 304 TDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANP 363
              V V PNLYGDI                   N+G++  + E  HGSAPDIAGK ++NP
Sbjct: 254 D--VIVAPNLYGDILSDGAAALVGSLGVVPSA-NVGHDFIVGEPCHGSAPDIAGKGISNP 310

Query: 364 TALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
            A + S+ +ML  MG ++ A  I  AV + I    + +T DL G +TT    D ++ K+
Sbjct: 311 IATIRSTALMLEFMGYTEAAQDIHKAVDTNIREN-QIKTPDLGGKSTTQQVVDDILSKM 368

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  156 bits (395), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 118/360 (32%), Positives = 179/360 (49%), Gaps = 27/360 (7%)

Query: 84  NPSTGKYTVSFIEGDGIGPEISNSVKQIFSA--AKVPIEWETCDVTP---LFIDGLTTIP 138
           N +    T+  I GDGIG E+  + KQ+     +K  + +   D+      F +    +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 139 EPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYP 195
           +  V+ + +    AL G + +P  K  G+ S  + LR+  GLFANVRP +SV+G K    
Sbjct: 78  DETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGEKG--K 135

Query: 196 NVDLVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITREASERV----IRYAFEYCRA 246
            +D+V++RENTE  Y  IE           V  + K I+  A+ R+    +  A +  + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQT 195

Query: 247 IGRPRLVVVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSS 302
            G+  L V HKS +   SDGLF  + KE+      +Y  I++  +++D+ V ++   P  
Sbjct: 196 RGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 303 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMAN 362
           +   V V PNLYGDI                   N+G EI I E  HGSAPDIAGK +AN
Sbjct: 256 FD--VIVAPNLYGDILSDGAAALVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIAGKGIAN 312

Query: 363 PTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           P A + S+ +ML  +G ++ A  I  AV + +  G   +T DL G A+T    D V+ +L
Sbjct: 313 PIATIRSTALMLEFLGHNEAAQDIYKAVDANLREG-SIKTPDLGGKASTQQVVDDVLSRL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  156 bits (394), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 112/352 (31%), Positives = 180/352 (51%), Gaps = 27/352 (7%)

Query: 92  VSFIEGDGIGPEISNSVKQIFSA--AKVPIEWETCDVTP---LFIDGLTTIPEPAVQSIN 146
           +  I GDGIG E+  + KQ+  A  +K  ++++  D+      F      +P+  V+ + 
Sbjct: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82

Query: 147 KNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLIR 203
           +    AL G + +P  K  G+ S  + LRK  GL+ANVRP +SV+  K    NVD++++R
Sbjct: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140

Query: 204 ENTEGEY-----SGIEHVVTPGVVQSIKLITREASERVIRYAFEY----CRAIGRPRLVV 254
           ENTE  Y     + ++      V ++IK I+  A+ ++   A +      ++ G   L V
Sbjct: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200

Query: 255 VHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVC 310
            HKS +   SDGLF  + K++      +Y ++++  +++D+ V ++   P  +   V V 
Sbjct: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVA 258

Query: 311 PNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSS 370
           PNLYGDI                   N+G EI I E  HGSAPDIAGK ++NP A + S+
Sbjct: 259 PNLYGDILSDGAAALVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317

Query: 371 VMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
            +ML  +G  + A  I  AV + +  G +  T DL G ATT    D ++ K+
Sbjct: 318 ALMLEFLGHPEPAQDIYKAVDANLIKG-DVNTPDLGGKATTQQVVDDILSKI 368

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  154 bits (390), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 177/360 (49%), Gaps = 27/360 (7%)

Query: 84  NPSTGKYTVSFIEGDGIGPEISNSVKQIFSA--AKVPIEWETCDVTP---LFIDGLTTIP 138
           N +    T+  I GDGIG E+  + KQI     +K  + +   D+      F +    +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 139 EPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYP 195
           +  ++ +      AL G + +P  K  G+ S  + LR+  GL+ANVRP +SV+G K    
Sbjct: 78  DETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--K 135

Query: 196 NVDLVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITREASERVIRYAFEYC----RA 246
            +D+V++RENTE  Y  IE           V  +IK I+  A+ R+ + A +      + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195

Query: 247 IGRPRLVVVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSS 302
            G   L V HKS +   SDGLF  + K++      +Y  I++  +++D+ V ++   P  
Sbjct: 196 RGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 303 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMAN 362
           +   V V PNLYGDI                   N+G +I I E  HGSAPDIAGK +AN
Sbjct: 256 FD--VIVAPNLYGDILSDGAAALVGSLGVVPSA-NVGPDIVIGEPCHGSAPDIAGKGIAN 312

Query: 363 PTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           P A + S+ +ML  +G +  A  I  AV + +  G  + T DL G A+T    D V+ +L
Sbjct: 313 PIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  154 bits (388), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 177/352 (50%), Gaps = 27/352 (7%)

Query: 92  VSFIEGDGIGPEISNSVKQIFS--AAKVPIEWETCDVTP---LFIDGLTTIPEPAVQSI- 145
           +  I GDGIG E+  + KQ+    + K  + ++  D+      F +    +PE  VQ + 
Sbjct: 24  IGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLK 83

Query: 146 NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLIR 203
           N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP +SV+G K     VD+V++R
Sbjct: 84  NQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKDR--PVDMVIVR 141

Query: 204 ENTEGEYSGIEHVVTPG-----VVQSIKLITREASERV----IRYAFEYCRAIGRPRLVV 254
           ENTE  Y  +E           V ++ K I+  A+ R+    +  A +  +  G   L V
Sbjct: 142 ENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTV 201

Query: 255 VHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVC 310
            HKS +   SDGLF  + K++      +Y  + +  +++D+ V ++   P  +   V V 
Sbjct: 202 THKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVA 259

Query: 311 PNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSS 370
           PNLYGDI                   N+G EI I E  HGSAPDIAGK ++NP A + S+
Sbjct: 260 PNLYGDILSDGAAALVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 318

Query: 371 VMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
            +ML  +G +K A  I  AV + +    + +T DL G +TT    + ++ KL
Sbjct: 319 GLMLEFLGHNKPAQDIYRAVDANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  154 bits (388), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 176/360 (48%), Gaps = 27/360 (7%)

Query: 84  NPSTGKYTVSFIEGDGIGPEISNSVKQIFSA--AKVPIEWETCDVTP---LFIDGLTTIP 138
           N +    T+  I GDGIG E+  + KQ+     +K  + +   D+      F +    +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 139 EPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYP 195
           +  V  + K    AL G + +P  K  G+ S  + LR+  GLFANVRP +SV+G +    
Sbjct: 78  DETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGSRN--K 135

Query: 196 NVDLVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITREASERV----IRYAFEYCRA 246
            +D+V++RENTE  Y  IE           V  + K I+  A+ R+    +  A +  + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQT 195

Query: 247 IGRPRLVVVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSS 302
            G   L V HKS +   +DGLF  + KE+      +Y  I++  +++D+ V ++   P  
Sbjct: 196 RGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 303 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMAN 362
           +   V V PNLYGDI                   N+G EI I E  HGSAPDIAGK +AN
Sbjct: 256 FD--VIVAPNLYGDILSDGAAALVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIAGKGIAN 312

Query: 363 PTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           P A + S+ +ML  +G +  A  I  AV + +  G  + T DL G A+T    D V+ +L
Sbjct: 313 PIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  154 bits (388), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 177/360 (49%), Gaps = 27/360 (7%)

Query: 84  NPSTGKYTVSFIEGDGIGPEISNSVKQIFSA--AKVPIEWETCDVTP---LFIDGLTTIP 138
           N +    T+  I GDGIG E+  + KQ+     +K  + +   D+      F +    +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 139 EPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYP 195
           +  V+ + +    AL G + +P  K  G+ S  + LR+  GLFANVRP +SV+G K    
Sbjct: 78  DETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--K 135

Query: 196 NVDLVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITREASERV----IRYAFEYCRA 246
            +D+V++RENTE  Y  IE           V  + K I+  A+ R+    +  A +  + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQT 195

Query: 247 IGRPRLVVVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSS 302
            G   L V HKS +   SDGLF  + KE+      +Y  I++  +++D+ V ++   P  
Sbjct: 196 RGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 303 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMAN 362
           +   V V PNLYGDI                   N+G EI I E  HGSAPDIAGK +AN
Sbjct: 256 FD--VIVAPNLYGDILSDGAAALVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIAGKGIAN 312

Query: 363 PTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           P A + S+ +ML  +G +  A  I  AV + +  G   +T DL G A+T    + V+ +L
Sbjct: 313 PIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA-IKTPDLGGKASTQQVVEDVLSRL 371

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  153 bits (387), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 121/359 (33%), Positives = 171/359 (47%), Gaps = 39/359 (10%)

Query: 91  TVSFIEGDGIGPEISNSVKQI-----------FSAAKVPIEWETCDVTPLFIDGLTTIPE 139
           T+  I GDGIG E+  + K+I           F    +   WET      F +    +P+
Sbjct: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWET------FQNTGKALPD 75

Query: 140 PAVQSI-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPN 196
             +  + N+   AL G + +P  K  G+ S  + LRK  GLFANVRP +SV G K     
Sbjct: 76  ETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--K 133

Query: 197 VDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAI---- 247
           VDLV++RENTE  Y     S I+      V  + K IT  A++ +   A +  +      
Sbjct: 134 VDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQN 193

Query: 248 GRPRLVVVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSSY 303
           G   L V HKS +   SDGLF  V +E       +Y  +Q+  +++D+ V ++   P  +
Sbjct: 194 GHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECF 253

Query: 304 TDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANP 363
              V V PNLYGDI                   N+G  I I E  HGSAPDIAGK ++NP
Sbjct: 254 D--VVVAPNLYGDILSDGAAALVGSLGVVPSA-NVGPNIVIGEPCHGSAPDIAGKGISNP 310

Query: 364 TALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
            A + S+ +ML  +G  + A  I  AV + I  G +  T DL G +TT    + V+ KL
Sbjct: 311 IATIRSTALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  152 bits (384), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 112/352 (31%), Positives = 177/352 (50%), Gaps = 25/352 (7%)

Query: 91  TVSFIEGDGIGPEISNSVKQIFS--AAKVPIEWETCDVTP---LFIDGLTTIPEPAVQSI 145
           T+  I GDGIG E+  + KQ+    +++  + +   D+      F+D    +P+  V+ +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84

Query: 146 NKNLVA-LKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLI 202
            +     L G + +P  +   + S  + LRK   L+AN+RP +SV G  +  P VD+V++
Sbjct: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSGKP-VDMVIV 143

Query: 203 RENTEGEYSGIEHVVTPG----VVQSIKLITREASERVIRYAFEYC----RAIGRPRLVV 254
           RENTE  Y  IE          V ++ K IT  A+ ++ + A +      +  G+  L V
Sbjct: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203

Query: 255 VHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVC 310
            HKS +   SDGLF  + K++      +Y  I +  ++ID+ V ++   P  Y D + V 
Sbjct: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPE-YFDVI-VA 261

Query: 311 PNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSS 370
           PNLYGDI                   N+G +I + E  HGSAPDIAGK +ANP A + S+
Sbjct: 262 PNLYGDILSDGAAALVGSLGVVPSA-NVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320

Query: 371 VMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
            +ML  +G  + A  I  AV S +    + +T DL G ++T    D V++KL
Sbjct: 321 ALMLEFLGHKEAAQDIHKAVESNMREN-KIKTPDLGGNSSTQNVVDDVLEKL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  151 bits (382), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 111/366 (30%), Positives = 181/366 (49%), Gaps = 26/366 (7%)

Query: 77  GKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS--AAKVPIEWETCDVTP---LFI 131
           G+ + +   ++  +T+  I GDGIG E+    +++      K  ++++  D+      F+
Sbjct: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFL 66

Query: 132 DGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVK 188
           D    +P+  V+ +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP +SV 
Sbjct: 67  DTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVD 126

Query: 189 GFKTTYPNVDLVLIRENTE-----GEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEY 243
           G  T    VDLV+ RENTE      E + I+      V ++IK I+  A+  +   A E 
Sbjct: 127 G--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEI 184

Query: 244 C----RAIGRPRLVVVHKSTIQRLSDGLFVNVAKEL---SKEYPDIQFETELIDNTVLKV 296
                +  G   L V HKS +   SDGLF  + K +   +K++ ++Q+  +++D+ V ++
Sbjct: 185 ALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRL 244

Query: 297 VSNPSSYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIA 356
              P  +   V V PNLYGDI                   N+G  I I E  HGSAPDI 
Sbjct: 245 FKEPQCFD--VIVAPNLYGDILSDGAAALVGSLGVVPSV-NVGPNIVIGEPCHGSAPDIV 301

Query: 357 GKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTD 416
           G+ +ANP A + S+ ++L  +GL + A  IE  V   I    + +T DL G +T     +
Sbjct: 302 GQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIREN-KIKTPDLGGNSTGEQVAN 360

Query: 417 AVIKKL 422
            ++ ++
Sbjct: 361 DILSRI 366

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  143 bits (361), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 111/364 (30%), Positives = 173/364 (47%), Gaps = 40/364 (10%)

Query: 86  STGKYTVSFIEGDGIGPEISNSVKQI-----------FSAAKVPIEWETCDVTPLFIDGL 134
           +T   T+  I GDGIG E+  + K +           F+   +   W+T      F+D  
Sbjct: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQT------FLDTG 70

Query: 135 TTIPEPAVQSI-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFK 191
             +P+  +  + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP +SV    
Sbjct: 71  KALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV--LS 128

Query: 192 TTYPNVDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITREASERVIRYAFEYC-- 244
              P +D+V++RENTE  Y     + I+      V ++IK I+  A+  +   A E    
Sbjct: 129 QEKP-IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQ 187

Query: 245 --RAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPD----IQFETELIDNTVLKVVS 298
             +  G   L V HKS +   SDGLF  + +++ +   D    I +  +++D+ V ++  
Sbjct: 188 RQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFR 247

Query: 299 NPSSYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGK 358
            P  +   V V PNLYGDI                   N+G +  + E  HGSAPDIAGK
Sbjct: 248 EPECFD--VIVAPNLYGDILSDGAAALVGSLGVVPSA-NVGFDFVVGEPCHGSAPDIAGK 304

Query: 359 NMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAV 418
            ++NP A + S+ +ML  MG  + A  I  AV + +      +T DL G +TT    D V
Sbjct: 305 GISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNT-VKTPDLGGKSTTQQVVDDV 363

Query: 419 IKKL 422
           + ++
Sbjct: 364 LSRM 367

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  142 bits (358), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 108/353 (30%), Positives = 176/353 (49%), Gaps = 28/353 (7%)

Query: 91  TVSFIEGDGIGPEISNSVKQIFS--AAKVPIEWETCDVTP---LFIDGLTTIPEPAVQSI 145
           T+  I GDGIG E+  + +Q+    ++K  ++++  D+      F +    +P+  +  +
Sbjct: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDIL 81

Query: 146 -NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLI 202
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP +SV       P VD++++
Sbjct: 82  RNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV--LPQERP-VDMIIV 138

Query: 203 RENTEGEY-----SGIEHVVTPGVVQSIKLITREASERVIRYAFEYC----RAIGRPRLV 253
           RENTE  Y     + I+      V ++IK I+  A++ +   A E      +  G   L 
Sbjct: 139 RENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLT 198

Query: 254 VVHKSTIQRLSDGLFVNVAKELSKEYPD----IQFETELIDNTVLKVVSNPSSYTDAVSV 309
           V HKS +   SDGLF  V +++ +   D    I++  +++D+ V ++   P  +   V V
Sbjct: 199 VTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VIV 256

Query: 310 CPNLYGDIXXXXXXXXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLS 369
            PNLYGDI                   N+G +  + E  HGSAPDIAGK ++NP A + S
Sbjct: 257 APNLYGDILSDGAAALVGSLGVVPSA-NVGFDFVVGEPCHGSAPDIAGKGISNPVATIRS 315

Query: 370 SVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           + +ML  MG  + A  I  AV + +      +T DL G +TT    + V+ ++
Sbjct: 316 TALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 82/273 (30%), Positives = 124/273 (45%), Gaps = 23/273 (8%)

Query: 169 LTLRKTFGLFANVRP----ARSVKGFKTTYPNV----DLVLIRENTEGEYSG-IEHVVTP 219
           L +RK  GL+AN+RP    ++S+ G     P +    D V++RE   G Y G  +     
Sbjct: 94  LAIRKELGLYANLRPCSFISKSLLGLSPLKPEIAQGTDFVILRELVGGIYFGERKEDDGD 153

Query: 220 GVVQSIKLITREASERVIRY-AFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKE 278
           GV    +  T    ER+ R  AF   +      L    K+ +   S      V + + +E
Sbjct: 154 GVAWDSEKYTVSEVERITRMGAFLALQHDPPLPLWSFDKANVLASSRLWRRTVNETIKRE 213

Query: 279 YPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 333
           +P +  + +LID+  + ++ NP  + + + +  N++GDI                     
Sbjct: 214 FPQLSVQHQLIDSAAMIMIKNPRKF-NGIVITSNIFGDIISDAASVIPGSLGLLPSASLA 272

Query: 334 XXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLN-HMGLSKHADQIENAVLS 392
              +  N   ++E  HGSAPD+  K  ANP A +LS+ MML   + +      IENAV  
Sbjct: 273 SEPDKNNAFGLYEPCHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVKQ 331

Query: 393 TIASGPESRTGDLAGTATTSTFTDAV---IKKL 422
            I SG   RTGDL G  TT+   DAV   +KKL
Sbjct: 332 VIESG--IRTGDLGGNNTTTEVGDAVTHALKKL 362

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 95/351 (27%), Positives = 158/351 (45%), Gaps = 36/351 (10%)

Query: 97  GDGIGPEISNSVKQIFSAAK-----VPIEWETCDVTPLFIDGL-TTIPEPAVQSINKNLV 150
           GD IG E+     ++  A +     V  +++   V    ID   + +P+ A+ +  +   
Sbjct: 12  GDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAAKEADA 71

Query: 151 ALKGPLATPIGKG-----HRSLNLTLRKTFGLFANVRP----ARSVKGFKTTYPNV---- 197
            L G +  P  +G      + L L LR+  G++AN+RP    A S+       P +    
Sbjct: 72  VLLGAVGGPKWQGGAVRPEQGL-LKLRQELGVYANLRPCNFAADSLLELSPLRPEIARDT 130

Query: 198 DLVLIRENTEGEYSGIEHVVT-PGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVV-- 254
           D++++RE   G Y G  H     GV       T +  +R+ R A  +      P L V  
Sbjct: 131 DIMVVRELLGGSYFGERHEDEGDGVAWDTDKYTVKEVQRIARMA-GFLALQHDPPLPVWS 189

Query: 255 VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLY 314
           + K+ +   S      V +    E+P++Q + +LID+  + +V NP ++ + V V  N++
Sbjct: 190 LDKANVLASSRLWRKTVEETFQSEFPNVQLQHQLIDSAAMILVKNPRAF-NGVVVTSNMF 248

Query: 315 GDIXXXXXXXXXXX-----XXXXXXXXNIGNEISIFEAVHGSAPDI-AGKNMANPTALLL 368
           GDI                        +  +   ++E  HGSAPD+ AGK  ANP   +L
Sbjct: 249 GDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPDLPAGK--ANPIGCIL 306

Query: 369 SSVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAV 418
           S+ MML   + +    + +E AV   + SG   RTGDL G+++TS   DA+
Sbjct: 307 SAAMMLKLSLNMVAAGEAVEQAVQEVLDSG--VRTGDLLGSSSTSEVGDAI 355

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 86.7 bits (213), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 93/359 (25%), Positives = 159/359 (44%), Gaps = 34/359 (9%)

Query: 92  VSFIEGDGIGPEISNSVKQIFSA-----AKVPIEWETCDVTPLFIDGLTT-IPEPAVQSI 145
           +  + GD +G EI+    ++  A     + V  ++E   +    ID     +P+ A+++ 
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 146 NKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----ARSVKGFKTTYPN 196
            K    L G +  P  G G     + L L +RK   L+AN+RP    + S+       P 
Sbjct: 67  KKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPIKPQ 125

Query: 197 ----VDLVLIRENTEGEYSG-IEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPR 251
                D V++RE   G Y G  +     GV    +  T    +R+ R A  +      P 
Sbjct: 126 FAKGTDFVVVRELVGGIYFGERKEDDGDGVAWDCEQYTVPEVQRITRMA-AFMALQHEPP 184

Query: 252 LVV--VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309
           L +  + K+ +   S      V + +  E+P ++ + +LID+  + +V NP+ + + + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNGIII 243

Query: 310 CPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPT 364
             N++GDI                        +      ++E  HGSAPD+  KN  NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPV 302

Query: 365 ALLLSSVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           A +LS+ MML   + L +    IE+AV   + +G   RTGDL G+ +T+   DAV K++
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKRVLDAG--IRTGDLGGSNSTTEVGDAVAKEV 359

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 121/269 (44%), Gaps = 22/269 (8%)

Query: 169 LTLRKTFGLFANVRP----ARSVKGFKTTYPNV----DLVLIRENTEGEYSGI-EHVVTP 219
           L +RK  GL+AN+RP    + S+ G     P +    D +++RE   G Y G  +     
Sbjct: 93  LKIRKELGLYANLRPCNFASESLLGLSPLRPEIAKGTDFMVVRELVGGIYFGKRKEDEGD 152

Query: 220 GVVQSIKLITREASERVIRYAFEYCRAIGRPRLVV--VHKSTIQRLSDGLFVNVAKELSK 277
           GV    +  +    +R+ R A  +      P L +  + K+ +   S      V + +  
Sbjct: 153 GVAWDSEQYSVPEVQRITRMA-AFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKN 211

Query: 278 EYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXX 332
           E+P +  + +LID+  + +V NP+   + + +  N++GDI                    
Sbjct: 212 EFPTLTVQNQLIDSAAMILVKNPTQL-NGIIITSNMFGDIISDEASVIPGSLGLLPSASL 270

Query: 333 XXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLN-HMGLSKHADQIENAVL 391
               +      ++E  HGSAPD+  K   NP A +LS+ MML   + L K  D IE AV 
Sbjct: 271 ASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVK 329

Query: 392 STIASGPESRTGDLAGTATTSTFTDAVIK 420
             + +G   RTGDL G+ +T+   DA+ K
Sbjct: 330 KVLDAG--IRTGDLGGSNSTTEVGDAIAK 356

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 121/269 (44%), Gaps = 22/269 (8%)

Query: 169 LTLRKTFGLFANVRP----ARSVKGFKTTYPN----VDLVLIRENTEGEYSG-IEHVVTP 219
           L +RK   L+AN+RP    + S+       P      D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 220 GVVQSIKLITREASERVIRYAFEYCRAIGRPRLVV--VHKSTIQRLSDGLFVNVAKELSK 277
           GV    +  T+   +R+ R A  +      P L +  + K+ +   S      V + +  
Sbjct: 152 GVAWDSEKYTKPEVQRLTRMA-AFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKN 210

Query: 278 EYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXX 332
           E+P ++   +LID+  + +V +P+   + + +  NL+GDI                    
Sbjct: 211 EFPQLKLNHQLIDSAAMILVKSPTQL-NGIVLTSNLFGDIISDEASVIPGSLGLLPSASL 269

Query: 333 XXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLN-HMGLSKHADQIENAVL 391
               +      ++E  HGSAPD+  K   NP A++LS+ MML   + LSK  + +E AV 
Sbjct: 270 ASLPDTNEAFGLYEPCHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVK 328

Query: 392 STIASGPESRTGDLAGTATTSTFTDAVIK 420
             + SG   RTGDL G+ +TS   DA+ K
Sbjct: 329 QVLDSG--VRTGDLGGSNSTSEVGDAIAK 355

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 93/359 (25%), Positives = 159/359 (44%), Gaps = 34/359 (9%)

Query: 92  VSFIEGDGIGPEISNSVKQIFSA-----AKVPIEWETCDVTPLFIDGLTT-IPEPAVQSI 145
           +  + GD +G EI+    ++  A     + V  ++E   +    ID     +P+ A+++ 
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 146 NKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----ARSVKGFKTTYPN 196
            K    L G +  P  G G     + L L +RK   L+AN+RP    + S+       P 
Sbjct: 67  KKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKPQ 125

Query: 197 ----VDLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPR 251
                D V++RE   G Y G  +     GV    +  T    +R+ R A  +      P 
Sbjct: 126 FAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMA-AFMALQHEPP 184

Query: 252 LVV--VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309
           L +  + K+ +   S      V + +  E+P ++ + +LID+  + +V NP+ + + + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNGIII 243

Query: 310 CPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPT 364
             N++GDI                        +      ++E  HGSAPD+  KN  NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPI 302

Query: 365 ALLLSSVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           A +LS+ MML   + L +    IE+AV   + +G   RTGDL G+ +T+   DAV K++
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG--IRTGDLGGSNSTTEVGDAVAKEV 359

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 92/359 (25%), Positives = 159/359 (44%), Gaps = 34/359 (9%)

Query: 92  VSFIEGDGIGPEISNSVKQIFSA-----AKVPIEWETCDVTPLFIDGLTT-IPEPAVQSI 145
           +  + GD +G EI+    ++  A     + V  ++E   +    ID     +P+ A+++ 
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 146 NKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----ARSVKGFKTTYPN 196
            K    L G +  P  G G     + L L +RK   L+AN+RP    + S+       P 
Sbjct: 67  KKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKPQ 125

Query: 197 ----VDLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPR 251
                D V++RE   G Y G  +     GV    +  T    +R+ R A  +      P 
Sbjct: 126 FAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMA-AFMALQHEPP 184

Query: 252 LVV--VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309
           L +  + K+ +   S      V + +  E+P ++ + +LID+  + +V NP+ + + + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNGIII 243

Query: 310 CPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPT 364
             N++GDI                        +      ++E  HGSAPD+  KN  NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPI 302

Query: 365 ALLLSSVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           A +LS+ MML   + L +    IE+AV   + +G   RTGDL G+ +T+   DAV +++
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG--IRTGDLGGSNSTTEVGDAVAEEV 359

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 94/364 (25%), Positives = 158/364 (43%), Gaps = 36/364 (9%)

Query: 86  STGKYTVSFIEGDGIGPEISNSVKQIFSA------AKVPIEWETCDVTPLFIDGLTT-IP 138
           ST K  V  + GD +G EI+    ++  A      +KV  +++   +    ID     + 
Sbjct: 2   STTKKIV-VLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLT 60

Query: 139 EPAVQSINKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----ARSVKG 189
           + A+++  K    L G +  P  G G     + L L +RK  GL+AN+RP    +  + G
Sbjct: 61  DEALEASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASEPLLG 119

Query: 190 FKTTYPNV----DLVLIRENTEGEYSG-IEHVVTPGVVQSIKLITREASERVIRYAFEYC 244
                P +    D +++RE   G Y G  +     GV    +  +    ER+ R A  + 
Sbjct: 120 LSPLRPEIAKGTDFMVVRELVGGIYFGERKEDDGDGVAWDSEKYSVPEVERITRMA-AFL 178

Query: 245 RAIGRPRLVV--VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSS 302
                P L +  + K+ +   S      V   +  E+P +  + +LID+  + +V NP+ 
Sbjct: 179 ALQHNPPLPIWSLDKANVLASSRLWRKTVEATIKNEFPTLTVQNQLIDSAAMILVKNPTQ 238

Query: 303 YTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGNEISIFEAVHGSAPDIAG 357
             + + +  N++GDI                        +      ++E  HGSAPD+  
Sbjct: 239 L-NGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP- 296

Query: 358 KNMANPTALLLSSVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTD 416
           KN  NP A +LS+ MML   + + K  + +E AV   + +G   RTGDL G+ +T    D
Sbjct: 297 KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVLDAG--VRTGDLGGSNSTQEVGD 354

Query: 417 AVIK 420
           A+ K
Sbjct: 355 AIAK 358

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 119/269 (44%), Gaps = 22/269 (8%)

Query: 169 LTLRKTFGLFANVRPARSVKGF--------KTTYPNVDLVLIRENTEGEYSG-IEHVVTP 219
           L +RK  G++AN+RP + V           +      D V++RE   G Y G  +     
Sbjct: 94  LKIRKELGVYANLRPCQFVSETLLDLSPLKREIVQGTDFVIVRELVGGIYFGERQEAGDD 153

Query: 220 GVVQSIKLITREASERVIRYAFEYCRAIGRPRLVV--VHKSTIQRLSDGLFVNVAKELSK 277
           GV    +  +    +R+ R A  +      P L V  + K+ +   S      V + +  
Sbjct: 154 GVAWDKESYSVPEIQRITRMA-AFLALQHNPPLPVWSLDKANVLATSRLWRKTVEETIKN 212

Query: 278 EYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXX 332
           E+P +     LID+  + +V NP+   + V +  N++GDI                    
Sbjct: 213 EFPTLTINHHLIDSAAMTLVQNPTKL-NGVVITTNMFGDIISDEASVIPGSLGLLPSASL 271

Query: 333 XXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLN-HMGLSKHADQIENAVL 391
               +  + + ++E  HGSAPD+   + ANP A +LS+ MM    + L+K  + IE AV 
Sbjct: 272 ASLPDKNDALGLYEPCHGSAPDLPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVK 330

Query: 392 STIASGPESRTGDLAGTATTSTFTDAVIK 420
            TI +G   +TGDL G  TT+   +AV K
Sbjct: 331 RTIDAG--IKTGDLGGKNTTTEVGNAVAK 357

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 119/270 (44%), Gaps = 21/270 (7%)

Query: 169 LTLRKTFGLFANVRPARSVK----GFKTTYPNV----DLVLIRENTEGEYSG-IEHVVTP 219
           L +RK  GL+ N+RP + +     G       V    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELGLYGNLRPCKFISDKLIGLSPLKEEVCKGTDFVVVRELVGGIYFGERQEDDGS 153

Query: 220 GVVQSIKLITREASERVIRYAFEYCRAIGRPRLVVVHKSTIQRL-SDGLFVNVAKELSKE 278
           GV    +  + E  +R+ + A  +      P L +        L S  L+     E   E
Sbjct: 154 GVAWDSEKYSIEEVKRITKMA-AFLSLQNDPPLPIWSLDKANVLASSRLWRAAVDETIAE 212

Query: 279 YPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 333
           +P+++ + +LID+  + +V NP+   + + +  N++GDI                     
Sbjct: 213 FPNLKVQHQLIDSAAMMLVKNPTQL-NGIILTNNMFGDIISDEASVIPGSLGLLPSASLA 271

Query: 334 XXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLN-HMGLSKHADQIENAVLS 392
              +      ++E  HGSAPD+A +   NP A +LS+ MML   + + +  + IE AV  
Sbjct: 272 SLPDKNKAFGLYEPCHGSAPDLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSV 330

Query: 393 TIASGPESRTGDLAGTATTSTFTDAVIKKL 422
            +  G   RT DL G +TTS   DAV ++L
Sbjct: 331 VLDRG--IRTADLGGNSTTSELGDAVAQEL 358

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 97/365 (26%), Positives = 158/365 (43%), Gaps = 35/365 (9%)

Query: 86  STGKYTVSFIEGDGIGPEISNSVKQIFSAA-----KVPIEWETCDVTPLFIDGLTT-IPE 139
           ST K  V  + GD +G EI+    ++  A      +   E++   +    ID     +P+
Sbjct: 2   STTKKIV-VLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPD 60

Query: 140 PAVQSINKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----ARSVKGF 190
            ++++  K+   L G +  P  G G     + L L +RK   L+AN+RP    + S+   
Sbjct: 61  ASLEAAKKSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDL 119

Query: 191 KTTYPNV----DLVLIRENTEGEYSGIEHVVT-PGVVQSIKLITREASERVIRYAFEYCR 245
               P      D V++RE   G Y G     T  GV    +  +    +R+ R A  +  
Sbjct: 120 SPLKPECARGTDFVVVRELVGGIYFGERKEDTGDGVAWDSEQYSVPEVQRITRMA-AFLA 178

Query: 246 AIGRPRLVV--VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSY 303
               P L V  + K+ +   S      V + +  E+P +  + +LID+  + +V NP+  
Sbjct: 179 LQHSPPLPVWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPTQL 238

Query: 304 TDAVSVCPNLYGDIXXXXXXXX-----XXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGK 358
            + V +  N++GDI                        +      ++E  HGSAPD+  K
Sbjct: 239 -NGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-K 296

Query: 359 NMANPTALLLSSVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDA 417
              NP A +LS+ MML   + + +    +E AV   + SG   RT DL GT+TTS   +A
Sbjct: 297 GKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVLDSG--VRTADLKGTSTTSEVGEA 354

Query: 418 VIKKL 422
           V+K L
Sbjct: 355 VVKAL 359

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 97/366 (26%), Positives = 161/366 (43%), Gaps = 37/366 (10%)

Query: 86  STGKYTVSFIEGDGIGPEISNSVKQIFSAAK-----VPIEWETCDVTPLFIDGLTTIP-- 138
           ST K  V  + GD +G EI+    ++  A       V  ++E   +    ID  T +P  
Sbjct: 2   STTKKIV-VLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDA-TGVPLT 59

Query: 139 EPAVQSINKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----ARSVKG 189
           + A+++  K    L G +  P  G G     + L L +RK   L+AN+RP    + S+  
Sbjct: 60  DEALEASKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLE 118

Query: 190 FKTTYPN----VDLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITREASERVIRYAFEYC 244
                P      D V++RE   G Y G  +     GV    +  T    +R+ R A  + 
Sbjct: 119 LSPIKPQFARGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMA-AFM 177

Query: 245 RAIGRPRLVV--VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSS 302
               +P L +  + K+ +   S      V + +  E+P ++ + +LID+  + +V NP+ 
Sbjct: 178 ALQHQPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPTQ 237

Query: 303 YTDAVSVCPNLYGDIXXXXXX-----XXXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAG 357
             + + +  N++GDI                        +      ++E  HGSAPD+  
Sbjct: 238 L-NGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP- 295

Query: 358 KNMANPTALLLSSVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTD 416
           KN  NP A +LS+ MML   + ++     IE+AV   + +G   RTGDL G+ +T    D
Sbjct: 296 KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVLDAG--IRTGDLGGSNSTIEVGD 353

Query: 417 AVIKKL 422
           AV K++
Sbjct: 354 AVAKEV 359

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 93/359 (25%), Positives = 157/359 (43%), Gaps = 35/359 (9%)

Query: 91  TVSFIEGDGIGPEISNSVKQIFSAA------KVPIEWETCDVTPLFIDGLTT-IPEPAVQ 143
           T+  + GD +G EI+    ++ +A       KV  +++   +    ID     +P+ A++
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 144 SINKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----ARSVKGFKTTY 194
           +  K    L G +  P  G G     + L L +RK   L+AN+RP    + S+       
Sbjct: 66  ASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLK 124

Query: 195 PNV----DLVLIRENTEGEYSG-IEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGR 249
           P +    D V++RE   G Y G  +     GV    +  +    +R+ R A  +      
Sbjct: 125 PEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMA-AFMALQHN 183

Query: 250 PRLVV--VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAV 307
           P L +  + K+ +   S      V + +  E+P +  + +LID+  + +V NP+ + + +
Sbjct: 184 PPLPIWSLDKANVLASSRLWRKTVEETIKNEFPQLTVQHQLIDSAAMILVKNPT-HLNGI 242

Query: 308 SVCPNLYGDIXXXXXXXX-----XXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMAN 362
            +  N++GDI                        +      ++E  HGSAPD+  K   N
Sbjct: 243 IITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KGKVN 301

Query: 363 PTALLLSSVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIK 420
           P A +LS+ MML   + L +  + IE AV   + SG   RT DL GT +T+   DAV K
Sbjct: 302 PVATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSG--IRTADLKGTNSTTEVGDAVAK 358

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 92/357 (25%), Positives = 148/357 (41%), Gaps = 34/357 (9%)

Query: 92  VSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVTPLFIDGLTT------IPEPAVQSI 145
           +  + GD +G EI+    ++  A        T +     I G         +P+ A+++ 
Sbjct: 5   IVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEALEAS 64

Query: 146 NKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAR-------SVKGFKTT 193
            K    L G +  P  G G     + L L +RK   L+AN+RP          +   K  
Sbjct: 65  KKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLELSPLKAQ 123

Query: 194 YPN-VDLVLIRENTEGEYSG-IEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPR 251
           Y    D V++RE   G Y G  +     GV    +  +    +R+ R A  +      P 
Sbjct: 124 YAQGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEQYSVPEVQRITRMA-AFLALQHNPP 182

Query: 252 LVV--VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309
           L +  + K+ +   S      V K + +E+P +    +LID+  + +V NP+   + + +
Sbjct: 183 LPIWSLDKANVLASSRLWRKTVEKTIKEEFPTLSVNHQLIDSAAMILVKNPTQL-NGIII 241

Query: 310 CPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPT 364
             N++GDI                        +      ++E  HGSAPD+A K   NP 
Sbjct: 242 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLA-KGKVNPV 300

Query: 365 ALLLSSVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIK 420
           A +LS+ MML   + + +    IE AV   +  G   RTGDL G+ +TS   DAV K
Sbjct: 301 ATILSAAMMLKLSLNMVEEGVAIEKAVKKVLDDG--IRTGDLGGSNSTSEVGDAVAK 355

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 88/357 (24%), Positives = 156/357 (43%), Gaps = 34/357 (9%)

Query: 92  VSFIEGDGIGPEISNSVKQIFSAA-----KVPIEWETCDVTPLFIDGLTT-IPEPAVQSI 145
           +  + GD +G E+++   ++ +A      ++   ++   +    ID   T +P+ A+++ 
Sbjct: 5   IVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEALEAS 64

Query: 146 NKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAR-------SVKGFKTT 193
            K    L G +  P  G G     + L L +RK  GL+AN+RP          +   K  
Sbjct: 65  KKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASDSLLDLSPLKPE 123

Query: 194 YPN-VDLVLIRENTEGEYSG-IEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPR 251
           Y    D V++RE   G Y G  +     GV    +  +    +R+ R A  +      P 
Sbjct: 124 YAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMA-AFLALQQNPP 182

Query: 252 LVV--VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309
           L +  + K+ +   S      V + +  E+P +  + +LID+  + +V +P+   + V +
Sbjct: 183 LPIWSLDKANVLASSRLWRKTVEETIKTEFPQLTVQHQLIDSAAMILVKSPTKL-NGVVI 241

Query: 310 CPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPT 364
             N++GDI                        +      ++E  HGSAPD+   N  NP 
Sbjct: 242 TNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPDLPA-NKVNPI 300

Query: 365 ALLLSSVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIK 420
           A +LS+ MML   + L +    +E AV + + +G   RTGDL G+ +T+   DA+ K
Sbjct: 301 ATILSAAMMLKLSLDLVEEGRALEEAVRNVLDAG--VRTGDLGGSNSTTEVGDAIAK 355

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 90/352 (25%), Positives = 150/352 (42%), Gaps = 34/352 (9%)

Query: 97  GDGIGPEISNSVKQIFSA-----AKVPIEWETCDVTPLFIDGLTT-IPEPAVQSINKNLV 150
           GD +G EI++   ++  A     + V  E++   +    ID     +P+ ++++  K   
Sbjct: 12  GDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAAKKADA 71

Query: 151 ALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAR-------SVKGFKTTYP-NV 197
            L G +  P  G G     + L L +RK   L+AN+RP          +   K  +    
Sbjct: 72  VLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKAEHARGT 130

Query: 198 DLVLIRENTEGEYSG-IEHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRPRLVV-- 254
           D V++RE   G Y G  +     GV    +  +    +R+ R A  +      P L V  
Sbjct: 131 DFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMA-AFLALQHNPPLPVWS 189

Query: 255 VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLY 314
           + K+ +   S      V + +  E+P +  + +LID+  + +V NP+   + V +  N++
Sbjct: 190 LDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMIMVKNPTQL-NGVIITNNMF 248

Query: 315 GDIXXXXXXXXXXX-----XXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLS 369
           GDI                        +      ++E  HGSAPD+  K   NP A +LS
Sbjct: 249 GDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLE-KGKVNPIATILS 307

Query: 370 SVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIK 420
           + MML   + + +    +E AV   + SG   RTGDL G+ +T    DAV K
Sbjct: 308 AAMMLELSLDMFEEGTAVEEAVRRVLDSG--IRTGDLRGSNSTQEVGDAVAK 357

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 92/362 (25%), Positives = 157/362 (43%), Gaps = 35/362 (9%)

Query: 87  TGKYTVSFIEGDGIGPEISNSVKQIFSAAK-----VPIEWETCDVTPLFIDGLTT-IPEP 140
           T K+ V  + GD +G EI+    ++ +A       V  +++   +    ID     +P+ 
Sbjct: 86  TTKHIV-VLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDE 144

Query: 141 AVQSINKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----ARSVKGFK 191
           A+++  K    L G +  P  G G     + L L +RK   L+AN+RP    + S+    
Sbjct: 145 ALEASKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLS 203

Query: 192 TTYPNV----DLVLIRENTEGEYSG-IEHVVTPGVVQSIKLITREASERVIRYAFEYCRA 246
              P +    D+ ++RE   G Y G  +     GV    +  +    +R+ R A  +   
Sbjct: 204 PLKPEIVKGTDICIVRELVGGIYFGERKEDEGDGVAWDSEKYSVSEVQRITRMA-GFLAL 262

Query: 247 IGRPRLVV--VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYT 304
              P L V  + K+ +   S      V + +  E+P +  + +LID+  + +V NP+ + 
Sbjct: 263 QHNPPLPVWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPT-HL 321

Query: 305 DAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGNEISIFEAVHGSAPDIAGKN 359
           + V +  N++GDI                        +      ++E  HGSAPD+  K 
Sbjct: 322 NGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KG 380

Query: 360 MANPTALLLSSVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAV 418
             NP A +LS  MML   + +++    +E AV   + SG   RT DL G+ +TS   DA+
Sbjct: 381 KVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVLDSG--VRTADLRGSNSTSEVGDAI 438

Query: 419 IK 420
            K
Sbjct: 439 AK 440

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 117/269 (43%), Gaps = 22/269 (8%)

Query: 169 LTLRKTFGLFANVRPAR-------SVKGFKTTYPN-VDLVLIRENTEGEYSG-IEHVVTP 219
           L +RK   L+AN+RP          +   K  Y    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGD 153

Query: 220 GVVQSIKLITREASERVIRYAFEYCRAIGRPRLVV--VHKSTIQRLSDGLFVNVAKELSK 277
           GV    +  +    +R+ R A  +      P L +  + K+ +   S      V + +  
Sbjct: 154 GVAWDSEKYSVPEVQRITRMA-AFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKN 212

Query: 278 EYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDIXXXXXXXX-----XXXXXXX 332
           E+P +  + +LID+  + +V +P+   + + +  N++GDI                    
Sbjct: 213 EFPTLTVQHQLIDSAAMILVKSPTKL-NGIVITSNMFGDIISDEASVIPGSLGLLPSASL 271

Query: 333 XXXXNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLN-HMGLSKHADQIENAVL 391
               +      ++E  HGSAPD+  KN  NP A +LS+ MML   + L +  + +E AV 
Sbjct: 272 ASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVR 330

Query: 392 STIASGPESRTGDLAGTATTSTFTDAVIK 420
             + +G   RT DL G  +TS   DAV+K
Sbjct: 331 RVLDAG--IRTADLRGENSTSEVGDAVVK 357

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 92/364 (25%), Positives = 153/364 (42%), Gaps = 37/364 (10%)

Query: 86  STGKYTVSFIEGDGIGPEISNSVKQIFSAAK------VPIEWETCDVTPLFIDGLTT-IP 138
           ST K  V  + GD +G EI +   ++  A        +  E++   +    ID   T +P
Sbjct: 2   STKKIVV--LPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLP 59

Query: 139 EPAVQSINKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----ARSVKG 189
           + A+ +   +   L G +  P  G G     + L L +RK   L+AN+RP    + S+ G
Sbjct: 60  DEALDAAKNSDAVLLGAVGGPKWGTGDVRPEQGL-LKIRKELQLYANLRPCNFVSDSLLG 118

Query: 190 FKTTYPNV----DLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITREASERVIRYAFEYC 244
                  +    D  ++RE   G Y G  +     G     +  T    +R+ R A  + 
Sbjct: 119 LSPLKEEIAKGTDFTVVRELVGGIYFGDRKEDDGDGSAWDCEKYTIPEVQRITRMA-AFL 177

Query: 245 RAIGRPRLVV--VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSS 302
                P L +  + K+ +   S      V + +  E+P+++ + +LID+  + +V +P  
Sbjct: 178 ALQHDPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPNLKVQHQLIDSAAMILVKSPRQ 237

Query: 303 YTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGNEISIFEAVHGSAPDIAG 357
             + + +  N++GDI                        +      ++E  HGSAPD+  
Sbjct: 238 L-NGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP- 295

Query: 358 KNMANPTALLLSSVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTD 416
           K   NP A +LS+ MML   + L      IE AV   + +G   RT DL G+ +TS   D
Sbjct: 296 KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAG--IRTADLKGSNSTSEVGD 353

Query: 417 AVIK 420
           AV K
Sbjct: 354 AVAK 357

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 86/358 (24%), Positives = 147/358 (41%), Gaps = 35/358 (9%)

Query: 92  VSFIEGDGIGPEISNSVKQIFSAA------KVPIEWETCDVTPLFIDGLTT-IPEPAVQS 144
           +  + GD +G E++    +I  A       KV   +E   +    ID     +P+ ++++
Sbjct: 7   IVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLEA 66

Query: 145 INKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAR-------SVKGFKT 192
             +    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 67  SKRADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLKE 125

Query: 193 TYPN-VDLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITREASERVIRYAFEYCRAIGRP 250
            Y    D  ++RE   G Y G  +     GV    +  +    +R+ R A  +      P
Sbjct: 126 KYAKGTDFTVVRELVGGIYFGKRKEDDGDGVAWDSEQYSVPEVQRITRMA-AFLAMQHNP 184

Query: 251 RLVV--VHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAVS 308
            L +  + K+ +   S      V + +  E+P ++   +LID+  + +V NP+   + + 
Sbjct: 185 PLPIWSLDKANVLASSRLWRKTVEETIQNEFPSLKVSHQLIDSAAMILVKNPTQL-NGII 243

Query: 309 VCPNLYGDIXXXXXXX-----XXXXXXXXXXXXNIGNEISIFEAVHGSAPDIAGKNMANP 363
           +  N++GDI                        +  +   ++E  HGSAPD+  K   NP
Sbjct: 244 ITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLYEPCHGSAPDLP-KGKVNP 302

Query: 364 TALLLSSVMMLN-HMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIK 420
              +LS  MML   + L +    +E AV   + +    RT DL G+ +TS   DAV K
Sbjct: 303 IGTILSVAMMLKLSLNLKEEGIAVEEAVRRVLDN--NIRTADLGGSNSTSDIGDAVAK 358

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (70%), Gaps = 1/51 (1%)

Query: 372 MMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422
           +MLNH+GL++ A +I  AV  TIA G  + T D+ G+++T+ FT+ +I KL
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHT-TRDIGGSSSTTDFTNEIINKL 50

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,731,128
Number of extensions: 1611265
Number of successful extensions: 4478
Number of sequences better than 10.0: 84
Number of HSP's gapped: 4306
Number of HSP's successfully gapped: 84
Length of query: 422
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 310
Effective length of database: 40,638,807
Effective search space: 12598030170
Effective search space used: 12598030170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)