Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H020905.442ON34534516470.0
KLLA0E02355g5.442ON3242846041e-75
Smik_4.6385.442ON3462845973e-74
NCAS0F034305.442ON3322865963e-74
NDAI0B057205.442ON3652855941e-73
Suva_2.5445.442ON3462845913e-73
Ecym_45135.442ON3333025893e-73
YDR372C (VPS74)5.442ON3452845904e-73
ZYRO0F10208g5.442ON3322875816e-72
Kwal_55.213995.442ON3292835806e-72
ACL165C5.442ON3312835806e-72
Kpol_1016.25.442ON3282845791e-71
Skud_4.6415.442ON3462845791e-71
KLTH0F15884g5.442ON3292845737e-71
TDEL0D025905.442ON3302845737e-71
SAKL0G02706g5.442ON3322835669e-70
KAFR0D050605.442ON3262865632e-69
TBLA0A064805.442ON3342835616e-69
KNAG0B042005.442ON3442865582e-68
TPHA0J026105.442ON3292865485e-67
CAGL0A02926g5.442ON3282945362e-65
TBLA0A027805.442ON3872844864e-57
Kpol_1062.245.442ON2762824713e-56
Smik_5.1563.523ON104473780.39
TBLA0D015405.545ON585172686.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H02090
         (345 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   639   0.0  
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   237   1e-75
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   234   3e-74
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   234   3e-74
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   233   1e-73
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   232   3e-73
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   231   3e-73
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   231   4e-73
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   228   6e-72
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   228   6e-72
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   228   6e-72
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   227   1e-71
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   227   1e-71
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   225   7e-71
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   225   7e-71
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   222   9e-70
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   221   2e-69
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   220   6e-69
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   219   2e-68
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   215   5e-67
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   211   2e-65
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   191   4e-57
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   186   3e-56
Smik_5.156 Chr5 complement(222965..226099) [3135 bp, 1044 aa] {O...    35   0.39 
TBLA0D01540 Chr4 complement(383878..385635) [1758 bp, 585 aa] {O...    31   6.4  

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/345 (91%), Positives = 317/345 (91%)

Query: 1   MVSSSEQRESVNDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXLYHVKTHHTIDSEVFKEP 60
           MVSSSEQRESVNDL                            LYHVKTHHTIDSEVFKEP
Sbjct: 1   MVSSSEQRESVNDLSRRRSSMSSTSSHASSASSSSHRSRRNSLYHVKTHHTIDSEVFKEP 60

Query: 61  GTPELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDL 120
           GTPELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDL
Sbjct: 61  GTPELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDL 120

Query: 121 APHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHV 180
           APHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHV
Sbjct: 121 APHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHV 180

Query: 181 RKRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKY 240
           RKRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKY
Sbjct: 181 RKRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKY 240

Query: 241 FPDTVSYRVLRTIVLACAAYGADILDKGFFQTENETVIGKGRARVLLSLFSKFPFELNQA 300
           FPDTVSYRVLRTIVLACAAYGADILDKGFFQTENETVIGKGRARVLLSLFSKFPFELNQA
Sbjct: 241 FPDTVSYRVLRTIVLACAAYGADILDKGFFQTENETVIGKGRARVLLSLFSKFPFELNQA 300

Query: 301 VQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVLIKTLF 345
           VQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVLIKTLF
Sbjct: 301 VQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVLIKTLF 345

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  237 bits (604), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 127/284 (44%), Positives = 185/284 (65%), Gaps = 9/284 (3%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAE-GKKKKDLA 121
           P+LTLM+E+ L+ LKDK+GY+S W+  +SY LR C++IELALRGKI+ V +  +K+ D++
Sbjct: 44  PKLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVS 103

Query: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181
             E  IEVIDGS TG+ LLD++L LMK +    S+  WI LLSGE+ N LK +YQL  VR
Sbjct: 104 --ERLIEVIDGSKTGEVLLDESLSLMKNDPPT-SIVGWIDLLSGETWNLLKINYQLKQVR 160

Query: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241
           +R+ + LV+ G+L  + K      + THPI D  CK +I+ R+  IL +   +L    YF
Sbjct: 161 ERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYF 220

Query: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFELNQ- 299
           P  VS++ +RT+ L C AYGA++L+      + E    G  RA  +L+ FS+FPF L++ 
Sbjct: 221 PQDVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQ 280

Query: 300 ---AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
               V  +LN+++S+EL+ HP    QLEVVAG  +V + +DT+L
Sbjct: 281 TSTGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  234 bits (597), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 121/284 (42%), Positives = 187/284 (65%), Gaps = 9/284 (3%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKK-DLA 121
           P LTLM+E+ L+ L+D+EGY+S W+  +SY LR C+IIELALRGKI+ + +  +K+ DL+
Sbjct: 66  PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFDLS 125

Query: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181
             E  IEVIDGS TG+ LLD+TL LMK ++   ++S+WI LLSGE+ N LK +YQL  VR
Sbjct: 126 --ERLIEVIDGSKTGEVLLDETLQLMKNDEP-LTISNWIDLLSGETWNLLKINYQLKQVR 182

Query: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241
           +R+ + LV+ G+L  + K      + THPI D  CK AI+ R+  +L +  ++L   +YF
Sbjct: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242

Query: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFELNQ- 299
           P+T S++++RT+ L C +YGA++L+      E E       RA  +++ FS+FPF+L + 
Sbjct: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLEKE 302

Query: 300 ---AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
               +  +LN++V +E+  +P    QLEV+AG  +V + +D +L
Sbjct: 303 TELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  234 bits (596), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 121/286 (42%), Positives = 183/286 (63%), Gaps = 13/286 (4%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAP 122
           P LTLM+E+ L+ L+DKEGY+S W+  +SY LR C++IELALRGKIQ + +  +K+    
Sbjct: 52  PVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKR-FEL 110

Query: 123 HECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRK 182
            E  ++VIDG+ TG+ LLD+TL LMK ++   S++ WI LLSGE+ N +K +YQL  VR+
Sbjct: 111 SERLVQVIDGTKTGEVLLDETLQLMKNDEP-LSIASWIDLLSGETWNIMKINYQLKQVRE 169

Query: 183 RIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFP 242
           R+ + LV+ G+L  + K      + THP+ D  CK AI+ R+  IL +  ++L    YFP
Sbjct: 170 RLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFP 229

Query: 243 DTVSYRVLRTIVLACAAYGADILDKGF----FQTENETVIGKGRARVLLSLFSKFPFELN 298
           +T  ++++RTI L C AYGA++L+       F+  +  +    RA  L++ FSKFPF+L 
Sbjct: 230 ETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAI---ARADELIAQFSKFPFDLE 286

Query: 299 Q----AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
                 +  +LN +V +EL + P    QLEV+AG I+V + +DT+L
Sbjct: 287 TPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  233 bits (594), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 124/285 (43%), Positives = 184/285 (64%), Gaps = 9/285 (3%)

Query: 62  TPELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKK-DL 120
           TP LTLM+E+ L+ L+DKEGY+S W+  +SY LR C++IELALRGKI+ + +  +K+ DL
Sbjct: 84  TPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIRILDDSARKRFDL 143

Query: 121 APHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHV 180
           +  E  IEV DGS TG+ LLD+TL LMK ++   ++++WI LLSGE+ N +K +YQL  V
Sbjct: 144 S--ERLIEVKDGSKTGEVLLDETLQLMKNDEP-LTIANWIDLLSGETWNIMKINYQLKQV 200

Query: 181 RKRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKY 240
           R+R+ + LV+ G+L  + K      + THP+ D  CK AI+ R+  +L +  ++    +Y
Sbjct: 201 RERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSVLVSRNMEFNYNEY 260

Query: 241 FPDTVSYRVLRTIVLACAAYGADILDKGFFQTENETVIGK-GRARVLLSLFSKFPFEL-- 297
           FP    ++++RTI L C AYGA++L+      + E       RA  L++ FSKFPF+L  
Sbjct: 261 FPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNAIARADELIAQFSKFPFDLEK 320

Query: 298 --NQAVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
             N  V  +LN  V +EL E+P    QLEV+AG I+V + +DT+L
Sbjct: 321 TTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSRMDTLL 365

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  232 bits (591), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 187/284 (65%), Gaps = 9/284 (3%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKK-DLA 121
           P LTLM+E+ L+ L+D+EGY+S W+  +SY LR C++IELALRGKI+ + +  +K+ DL+
Sbjct: 66  PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRFDLS 125

Query: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181
             E  +EVIDGS TG+ LLD+TL LMK ++   ++S+WI LLSGE+ N LK +YQL  VR
Sbjct: 126 --ERLVEVIDGSKTGEVLLDETLQLMKNDEP-LTISNWIDLLSGETWNLLKINYQLKQVR 182

Query: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241
           +R+ + LV+ G+L  + K      + THPI D  CK AI+ R+  +L +  ++L   +YF
Sbjct: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242

Query: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTENETVIGK-GRARVLLSLFSKFPFELNQ- 299
           P+T S++++RT+ L C +YGA++L+      E E       RA  ++S FS++PF+L + 
Sbjct: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLEKD 302

Query: 300 ---AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
               V  +LN++V +E+  +P    QLEV+AG  +V + +D +L
Sbjct: 303 TDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  231 bits (589), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 189/302 (62%), Gaps = 9/302 (2%)

Query: 45  HVKTHHTIDSEVFKEPGTPELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELAL 104
           H   +   D ++ +    P LTLM+E+ L+ LKDKEGY+S W+  +SY LR C++IELAL
Sbjct: 35  HKVAYDPEDQKLRENTKEPTLTLMEEVLLMGLKDKEGYLSFWNDSISYSLRGCILIELAL 94

Query: 105 RGKIQAVAEGKKKK-DLAPHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLL 163
           RGKI+ V +  +K+ DL+  E  +EVI+ S TG+ LLD+TL LMK  +   S+ +WI LL
Sbjct: 95  RGKIRVVEDAARKRFDLS--ERLVEVIETSKTGEALLDETLSLMKSNEP-LSIVNWIDLL 151

Query: 164 SGESMNFLKASYQLLHVRKRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSR 223
           SGE+ N LK SYQL  VR+R+ + LV+ G+L  + K      + THP+ D  CK +I+ R
Sbjct: 152 SGETWNLLKISYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVADSSCKESIKRR 211

Query: 224 MQYILTANKVDLPSTKYFPDTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGR 282
           M  +L    V L  T+YFP++V+++ LRTI L C AYGA++L+      + E    G  R
Sbjct: 212 MLSVLVPRNVSLDYTEYFPESVAFKYLRTIALICGAYGANVLENVLSSLDYEKRERGFSR 271

Query: 283 ARVLLSLFSKFPFELNQAVQP----DLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDT 338
           A  +L+ FS++PF L++ V+     +L  +V +E+ ++P    QLEVVAG  +V + +D 
Sbjct: 272 AEEILTQFSQYPFALDKDVETGISVNLYNQVKEEIGKNPGTGLQLEVVAGVFEVFSRMDN 331

Query: 339 VL 340
            L
Sbjct: 332 FL 333

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  231 bits (590), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 121/284 (42%), Positives = 186/284 (65%), Gaps = 9/284 (3%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKK-DLA 121
           P LTLM+E+ L+ L+D+EGY+S W+  +SY LR C+IIELALRGKI+ + +  +K+ DL+
Sbjct: 65  PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFDLS 124

Query: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181
             E  IEVID S TG+ LLD+TL LMK ++   S+S+WI LLSGE+ N LK +YQL  VR
Sbjct: 125 --ERLIEVIDSSKTGEVLLDETLQLMKNDEP-LSISNWIDLLSGETWNLLKINYQLKQVR 181

Query: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241
           +R+ + LV+ G+L  + K      + THPI D  CK AI+ R+  +L +  ++L   +YF
Sbjct: 182 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 241

Query: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTENETVIGK-GRARVLLSLFSKFPFELNQ- 299
           P+T S++++RT+ L C +YGA++L+      E E       RA  +++ FS++PF+L + 
Sbjct: 242 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEKE 301

Query: 300 ---AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
               V  +LN++V +E+  +P    QLEV+AG  +V + +D +L
Sbjct: 302 TELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  228 bits (581), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 121/287 (42%), Positives = 183/287 (63%), Gaps = 15/287 (5%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAP 122
           P+LTLM+E+ LL L+DKEGY+S W+  +SY LR C++IELALRGKI+ V +  +K+    
Sbjct: 52  PKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKR-FDV 110

Query: 123 HECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRK 182
            E  IEV D S TG+ LLD+ L LMK ++   S+++WI LLSGE+ N LK +YQL  VR+
Sbjct: 111 SERLIEVTDSSKTGEVLLDEALQLMKCDEP-LSITNWIDLLSGETWNPLKINYQLKQVRE 169

Query: 183 RIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFP 242
           R+ + LV+ G+L  + K      + THP+ D  CK AI+ R+  +L    ++L    YF 
Sbjct: 170 RLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFS 229

Query: 243 DTVSYRVLRTIVLACAAYGADILDK-----GFFQTENETVIGKGRARVLLSLFSKFPFEL 297
           + VS++++RTI L C AY A++L+      G+ + +N      GRA  +L  FS++PF+L
Sbjct: 230 ERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNAI----GRADEILKQFSEYPFDL 285

Query: 298 N----QAVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
           +      +  +LN++V +EL +HPE   QLEV+AG  +V + +D +L
Sbjct: 286 DTQTESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  228 bits (580), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 118/283 (41%), Positives = 182/283 (64%), Gaps = 7/283 (2%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAP 122
           P+L LM+E+ L+ LKDKEGY+S W+  +SY LR C++IELALRGKIQ V +  +K+    
Sbjct: 49  PKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKR-FDV 107

Query: 123 HECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRK 182
            E  +EVI+ + TG+ LLD+ L LMK ++   ++++WI LLSGE+ NF+K SYQL  VR+
Sbjct: 108 SERLVEVINATKTGEVLLDEALNLMKNDEP-LTIANWIDLLSGETWNFMKISYQLKQVRE 166

Query: 183 RIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFP 242
           R+ + LV+ G+L  + K      + THPI D  CK AI+ R+  +L +  + L   +YFP
Sbjct: 167 RLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFP 226

Query: 243 DTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFELNQAV 301
            +VS+++LRT+ L C AYGA++L+      + E       RA  +L+ FS+FPF L++  
Sbjct: 227 ASVSFKLLRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQT 286

Query: 302 QPDLNEKVSKELHEHPEEAS----QLEVVAGAIDVINTIDTVL 340
           +  ++  ++KE+ E  +  S    +LEVVAG  +V + +DT+L
Sbjct: 287 ETGISVNINKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  228 bits (580), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 122/283 (43%), Positives = 182/283 (64%), Gaps = 7/283 (2%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAP 122
           P LTLM+E+ L+ LKDKEGY+S  +  +SY LR C++IELALRG+IQ V +  +++   P
Sbjct: 51  PTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRR-FDP 109

Query: 123 HECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRK 182
            E  IEV+DGS TG+ LLD+ L LMK  +   ++ +W+ LLSGE+ NFLK +YQL  VR+
Sbjct: 110 SERLIEVVDGSKTGEALLDEALTLMKGSEP-LTIVNWMDLLSGETWNFLKINYQLRQVRE 168

Query: 183 RIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFP 242
           R+ + LV+ G+L  + K      + THP+ D  CK +I+ R+  +L    V+L  T+ FP
Sbjct: 169 RLAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFP 228

Query: 243 DTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFELNQAV 301
           +TV+++ LRTI L C+A+GA++L+K     + E    G  RA  LL  FS++PF L++ +
Sbjct: 229 ETVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDI 288

Query: 302 QP----DLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
           +     +LN  V +EL  +P  A  LEVVAG + V + +D +L
Sbjct: 289 ETGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  227 bits (579), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 121/284 (42%), Positives = 183/284 (64%), Gaps = 9/284 (3%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAE-GKKKKDLA 121
           P LTLM+E+ LL L DK+GY+S W+  +SY LR C+IIELALR KI+ + +  +K+ DL+
Sbjct: 48  PTLTLMEEVVLLGLGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARKRFDLS 107

Query: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181
             E  +EV+DGS TG+ LLD+ L LMK ++   S+++WI LLSGE+ NF K +YQL  VR
Sbjct: 108 --ERLVEVVDGSKTGEVLLDEALQLMKNDEP-LSIANWIDLLSGETWNFFKINYQLKQVR 164

Query: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241
           +RI + LV+ G+L  + K      + THP+ D  CK AI+ R+   L +  ++L   +YF
Sbjct: 165 ERISKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNEYF 224

Query: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTENETVIGK-GRARVLLSLFSKFPFELNQA 300
           P+T  Y+V+RTI L C++Y A++L+      E E       R+  +LS F+++PF+L++A
Sbjct: 225 PETTQYKVIRTIALICSSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLDKA 284

Query: 301 ----VQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
               V  +L++ V  E+ ++P  A QLE VAG  DV + +D +L
Sbjct: 285 SDIKVSINLSKLVEDEIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  227 bits (579), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 186/284 (65%), Gaps = 9/284 (3%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKK-DLA 121
           P LTLM+E+ L+ L+D+EGY+S W+  +SY LR C++IELALRGKI+ + +  +K+ DL+
Sbjct: 66  PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRFDLS 125

Query: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181
             E  +EV+DGS TG+ LLD+TL LMK ++   ++S+WI LLSGE+ N LK +YQL  VR
Sbjct: 126 --ERLVEVVDGSKTGEVLLDETLQLMKNDEP-LTISNWIDLLSGETWNLLKINYQLKQVR 182

Query: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241
           +R+ + LV+ G+L  + K      + THPI D  CK AI+ R+  +L +  ++L   +YF
Sbjct: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242

Query: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTENETVIGK-GRARVLLSLFSKFPFELNQ- 299
           P+T S++++RT+ L C +YGA++L+      E E       RA  +++ FS++PF+L + 
Sbjct: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFDLEKE 302

Query: 300 ---AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
               V  +LN++V +E+  +     QLEV+AG  +V + +D +L
Sbjct: 303 TELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  225 bits (573), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 116/284 (40%), Positives = 183/284 (64%), Gaps = 7/284 (2%)

Query: 62  TPELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLA 121
           TP+L LM+E+ L+ LKDKEGY+S W+  +SY LR C++IELALRGKIQ + +  +K+   
Sbjct: 48  TPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKR-FD 106

Query: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181
             E  +EVI+ + TG+ LLD+ L LMK ++   ++++WI LLSGE+ NF+K SYQL  VR
Sbjct: 107 VSERLVEVINATKTGEVLLDEALNLMKNDEP-LTIANWIDLLSGETWNFMKISYQLKQVR 165

Query: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241
           +R+ + LV+ G+L  + K      + THPI D  CK AI+ R+  +L +  + L   +YF
Sbjct: 166 ERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYF 225

Query: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFELNQ- 299
           P +V ++++RT+ L C AYGA++L+      + E       RA  +L+ FS+FPF L++ 
Sbjct: 226 PSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQ 285

Query: 300 ---AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
               +  +LN++V +E+  + + + QLE VAG  +V + +DT+L
Sbjct: 286 TETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  225 bits (573), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 116/284 (40%), Positives = 185/284 (65%), Gaps = 7/284 (2%)

Query: 62  TPELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLA 121
            P+LTLM+E+ LL L+DKEGY+S W+  +SY LR C+IIELALRGKI+ + +  +K+   
Sbjct: 49  NPKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKR-FD 107

Query: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181
             E  IEV+D S TG+ LLD+TL LMK ++   ++++WI LLSGE+ N LK +YQL  VR
Sbjct: 108 VSERLIEVVDASKTGEVLLDETLQLMKYDEP-LTIANWIDLLSGETWNLLKINYQLKQVR 166

Query: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241
           +R+ + LV+ G+L  + K      + THP+ D  CK A++ R+  +L +  ++L   +YF
Sbjct: 167 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYF 226

Query: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFELNQA 300
           PDT S++++RTI L C +Y A++L+      + E       RA  +L  ++++PF+L++A
Sbjct: 227 PDTTSFKLIRTIALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKA 286

Query: 301 VQP----DLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
            +     +LN++V +EL ++ +   QLEVVAG  +V + +D +L
Sbjct: 287 TESGLSINLNKEVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  222 bits (566), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 185/283 (65%), Gaps = 7/283 (2%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAP 122
           P+LTLM+E+ L+ LKDKEGY+S W+  +SY LR C++IELALR KI+ + +  +K+    
Sbjct: 52  PKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKR-FDV 110

Query: 123 HECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRK 182
            +  IEVIDGS TG+ LLD+ L L+K ++    +++WI LLSGE+ N LK +YQL  VR+
Sbjct: 111 SDRLIEVIDGSKTGEVLLDEALNLIKNDEP-LPIANWIDLLSGETWNLLKINYQLKQVRE 169

Query: 183 RIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFP 242
           R+ + LV+ G+L  + K      + THPI D  CK AI+ R+  +L +  ++L   +YF 
Sbjct: 170 RLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFS 229

Query: 243 DTVSYRVLRTIVLACAAYGADILDKGFFQTE-NETVIGKGRARVLLSLFSKFPFELNQAV 301
           + ++++++RT+ L C AYGA++L+      + ++      RA  +L+ FS+FPF L++A 
Sbjct: 230 ENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKAT 289

Query: 302 QP----DLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
           +     +LN++V  E+ ++P +  QLEVVAG  +V + +DT+L
Sbjct: 290 ESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  221 bits (563), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 184/286 (64%), Gaps = 13/286 (4%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAP 122
           P+LTLM+E+ L+ L+D+EGY+S W+  +SY LR C++IELALR KI+ + +  +K+    
Sbjct: 46  PKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDSARKR-FDV 104

Query: 123 HECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRK 182
            E  +EVIDGS TG+ LLD+ L LMK ++   ++++WI LLSGE+ N LK +YQL  VR+
Sbjct: 105 SERLVEVIDGSKTGEVLLDEALQLMKNDEP-LTIANWIDLLSGETWNLLKINYQLKQVRE 163

Query: 183 RIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFP 242
           R+ + LV+ G+L  + K      + THP+ D  CK AI+ R+   L +  ++L    YF 
Sbjct: 164 RLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNSYFA 223

Query: 243 DTVSYRVLRTIVLACAAYGADILDKGF----FQTENETVIGKGRARVLLSLFSKFPFELN 298
           +T S++ +R + L C +YGA++L+       ++  +  +    RA  +L+ F+++PF+L+
Sbjct: 224 ETTSFKYIRIVALVCCSYGANVLENVLSSLDYEKRDRAI---SRAEEILAQFAQYPFDLS 280

Query: 299 Q----AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
           +     +  +LN++V  E++E+P+   QLEV+AG I+V + +D +L
Sbjct: 281 KNTELGISVNLNKEVENEVNENPQFTLQLEVIAGVIEVFSRMDMLL 326

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  220 bits (561), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 117/283 (41%), Positives = 176/283 (62%), Gaps = 7/283 (2%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAP 122
           P+LTLM+E+ LL L+DKEGY+S W+  +SY LR C+IIELALRGKI+ + +  +K+    
Sbjct: 54  PQLTLMEEVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDDPARKR-FEL 112

Query: 123 HECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRK 182
            E  +EV+D S TG+ LLD+ L +M+ ++   ++S+W+ LLSGE+ N  K +YQL  VR+
Sbjct: 113 SERLVEVVDSSKTGEVLLDEALQIMRNDEP-LAISNWVDLLSGETWNVFKINYQLKQVRE 171

Query: 183 RIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFP 242
           RI + LV+ G+L  + K      + THP+ D  CK AI+ R+  IL     +     YFP
Sbjct: 172 RISKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEFTYNDYFP 231

Query: 243 DTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFELNQAV 301
           +T S++ +RTI L C+AYGA++L+      E +    G  RA  LL  FS++PF+L +  
Sbjct: 232 ETTSFKYIRTISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYPFDLEKQT 291

Query: 302 Q----PDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
           +     +LN  V +E+   P+ A  LEVVAG  +V + +D +L
Sbjct: 292 EFGTSINLNALVKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  219 bits (558), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 180/286 (62%), Gaps = 13/286 (4%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAP 122
           P+LTLM+E+ L+ L+D+EGY+S W+  +SY LR C++IELALR KI+ + +  +K+    
Sbjct: 64  PKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKR-FDI 122

Query: 123 HECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRK 182
            E  +EV+DGS TG+ LLD+TL LMK ++   ++++WI LLSGE+ N +K +YQL  VR+
Sbjct: 123 SERLVEVVDGSKTGEVLLDETLQLMKNDEP-LTIANWIDLLSGETWNLMKINYQLKQVRE 181

Query: 183 RIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFP 242
           R+ + LV+ G+L  + K      + THP+ D  CK AI+ R+   + +  ++L    YFP
Sbjct: 182 RLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYFP 241

Query: 243 DTVSYRVLRTIVLACAAYGADILDKGF----FQTENETVIGKGRARVLLSLFSKFPFEL- 297
           ++ S++ +RT+ L C+ YGA +L+       ++  +  V    RA  LL  F ++PF+L 
Sbjct: 242 ESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAV---SRAEELLEKFGQYPFDLE 298

Query: 298 ---NQAVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
              +  +  +LN++  +E+ E P  A  LEVVAG I+V + +D +L
Sbjct: 299 KQGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  215 bits (548), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 175/286 (61%), Gaps = 9/286 (3%)

Query: 61  GTPELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKK-D 119
             P+LTLM+E+ LL L D EGY+S W+  +SYVLR C++IELALRGKI+ + +  +K  D
Sbjct: 47  SVPKLTLMEEVVLLGLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARKSFD 106

Query: 120 LAPHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLH 179
           L+  E  IEVID S TG+ LLD+TL LMK ++   S+  WI LLSGE+ NF K +YQL  
Sbjct: 107 LS--ERLIEVIDASKTGEVLLDETLQLMKNDEPQ-SIVSWIDLLSGETWNFFKVNYQLKQ 163

Query: 180 VRKRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTK 239
           VR+R+ + LV+ G+L  + K      + THP+ D  CK +++ R+   L    + L   +
Sbjct: 164 VRERLSKGLVDKGVLRTEMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNE 223

Query: 240 YFPDTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFEL- 297
           YFP++ +++V+RT+ L   AY A++L+      E E       RA  LL+ F  +PF+L 
Sbjct: 224 YFPESTTFKVIRTVSLIITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLV 283

Query: 298 ---NQAVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
              +  +  +LN+ V  E+  +P+ A QLEV+AG  DV   +D ++
Sbjct: 284 NEPDNRISINLNQLVEDEIKANPKTALQLEVLAGVFDVFAKMDVII 329

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  211 bits (536), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 187/294 (63%), Gaps = 9/294 (3%)

Query: 53  DSEVFKEPGTPELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAV- 111
           +S++  +   P LTLM+E+ L+ L+D+EGY+S W+  +SY LR C++IELALR KI+ + 
Sbjct: 38  ESKLQNDSKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILD 97

Query: 112 AEGKKKKDLAPHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFL 171
           A  + + D++  E  IEVID S TG+ LLD+TL LM  ++   S+++WI LLSGE+ N L
Sbjct: 98  APARMRFDIS--ERLIEVIDSSKTGEVLLDETLQLMVNDEP-LSIANWIDLLSGETWNLL 154

Query: 172 KASYQLLHVRKRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTAN 231
           K +YQL  VR+R+ + LV+ G+L  + K      + THP+ D  CK AI+ R+  +L + 
Sbjct: 155 KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSR 214

Query: 232 KVDLPSTKYFPDTVSYRVLRTIVLACAAYGADILDKGFFQTE-NETVIGKGRARVLLSLF 290
            +++    YFP++ +++++RT+ L   AYGA++L+      E ++      RA  +L+ F
Sbjct: 215 NMEISYNSYFPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQF 274

Query: 291 SKFPFELNQ----AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
           S++PF+L +     +  +LN+++ +EL  +P    +LEV+AG  +V + +D +L
Sbjct: 275 SQYPFDLQKESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  191 bits (486), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 168/284 (59%), Gaps = 8/284 (2%)

Query: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEG-KKKKDLA 121
           P L LM+E+ LL LKDK+GY+S W+  +SYVLR C++IELALR KI+ + +  +   D++
Sbjct: 106 PPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELALRKKIKVIDDPVRNMYDVS 165

Query: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181
               ++ V+  + TG+ LLD+ L +M KE+   S+ +WI LLSGE+ N  K + QL +VR
Sbjct: 166 ARIIEV-VMPITKTGNHLLDEALNMMAKERPE-SIMNWIDLLSGETWNVFKNNLQLKNVR 223

Query: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241
           +R+ + LV+ GIL   T       + THP+ DI  K +++ R+  IL      L    YF
Sbjct: 224 ERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSILVPKHSYLLYNNYF 283

Query: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTE-NETVIGKGRARVLLSLFSKFPFELNQ- 299
           P+ V+++++R++ L C AYGAD+LD        +++     +A  L    S FP  L+Q 
Sbjct: 284 PENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLFETISDFPINLDQR 343

Query: 300 ---AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
               V  D+ + +  EL +H  E+  LEVVAG + VI  +D++L
Sbjct: 344 EGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  186 bits (471), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 166/282 (58%), Gaps = 15/282 (5%)

Query: 68  MDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKK-DLAPHECK 126
           M+E+ LL ++DKEGY+S W+  LS+VLR C++IELA RG IQ + +  +K+ DL+     
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDR--L 58

Query: 127 IEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRKRIER 186
           IEV++   TG+ LLD+TL +MK E+   S+S WI LLSGE+ N  K + QL  VR+RI +
Sbjct: 59  IEVVNPKKTGEFLLDETLQMMKSEESQ-SISTWIDLLSGETWNIFKINLQLKQVRERISK 117

Query: 187 ILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFPDTVS 246
            LV+ GIL  + K      + THP++D+KCK  I+ R+  +L      + + +YFP+TV 
Sbjct: 118 GLVDKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQ 177

Query: 247 YRVLRTIVLACAAYGADILDKGF----FQTENETVIGKGRARVLLSLFSKFPFELNQA-- 300
            R LRTI L  +AY   +L+       +Q +++  +   R   +L   S +PFE +    
Sbjct: 178 LRCLRTIALILSAYAGSVLENVASDLDYQKKDDLFV---RTSEILDQSSVYPFEFDNKSS 234

Query: 301 --VQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340
             +  +LN+ V  EL +      +LE +AG  +V   +D+++
Sbjct: 235 TNIATNLNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276

>Smik_5.156 Chr5 complement(222965..226099) [3135 bp, 1044 aa] {ON}
           YER033C (REAL)
          Length = 1044

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 54  SEVFKEPGTPELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAE 113
           +E+ K+P    +   D+LF L+ +D+EGY S+ +  +     C +   +AL GK   +  
Sbjct: 568 NELIKKP----IKRYDDLFDLSDEDEEGYASEPESHMFSDEACSIESGVALSGKPTPMIY 623

Query: 114 GKKKKDLAPHECK 126
            +  K++  H+ K
Sbjct: 624 SQSNKNIKMHDLK 636

>TBLA0D01540 Chr4 complement(383878..385635) [1758 bp, 585 aa] {ON}
           Anc_5.545 YDR434W
          Length = 585

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 79/172 (45%), Gaps = 28/172 (16%)

Query: 174 SYQLLHVRKRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKV 233
           S++ +H+ + + + +     L+K TK+   + +  + + D+K    IR     I++A K+
Sbjct: 387 SFKRIHLLQNLFKAIETLKSLTKLTKQFEQMSIPKNVLNDVKQTLNIRDE---IISALKI 443

Query: 234 DLPSTKYFPDTVSYRVL-----RTIVLA-CAAYGADILDKGFFQTENETVI-----GKGR 282
           +  +     DT+++  L     + I L+  A +  +++ + FF  E++  +     G   
Sbjct: 444 NAENN----DTINWEGLLSQSNQMIKLSESAFFNGEMVQQNFFPQEHKIAVYLPMLGPLT 499

Query: 283 ARVLLSLFSKFPFELNQAVQPDLNEKVSKELHEHPEEASQ---LEVVAGAID 331
             +  SLF  F        +  ++E + KE+ E  E+ +Q   +E+    ID
Sbjct: 500 MMIFTSLFKIFK-------EKPIDENIMKEIKEDDEKFNQREKIEITDSNID 544

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,612,569
Number of extensions: 1307198
Number of successful extensions: 3690
Number of sequences better than 10.0: 31
Number of HSP's gapped: 3716
Number of HSP's successfully gapped: 31
Length of query: 345
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 235
Effective length of database: 40,868,139
Effective search space: 9604012665
Effective search space used: 9604012665
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)