Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H020805.440ON43543517280.0
NDAI0C015905.440ON47037410631e-141
Suva_8.1755.440ON4533579271e-121
KAFR0D050505.440ON4193719041e-118
CAGL0K10230g5.440ON4462248991e-117
TDEL0D026105.440ON4403718971e-117
YOR123C (LEO1)5.440ON4643578991e-116
Smik_15.3005.440ON4633648821e-114
SAKL0G02662g5.440ON4792258641e-111
KNAG0B042105.440ON4632648531e-110
Skud_15.2855.440ON4873628521e-109
ZYRO0F10164g5.440ON4232248451e-109
Kpol_1062.265.440ON4572318451e-109
TPHA0E017305.440ON4692268221e-105
KLLA0E02311g5.440ON4172257881e-100
TBLA0A064905.440ON4282337724e-98
KLTH0F15928g5.440ON4232257653e-97
Ecym_45115.440ON4612207642e-96
ACL167C5.440ON4392267595e-96
Kwal_55.214085.440ON4362227586e-96
NCAS0B068204.95ON37872712.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H02080
         (435 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   670   0.0  
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   414   e-141
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   361   e-121
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   352   e-118
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   350   e-117
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   350   e-117
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   350   e-116
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   344   e-114
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   337   e-111
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   333   e-110
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   332   e-109
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   330   e-109
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   330   e-109
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   321   e-105
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   308   e-100
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   301   4e-98
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   299   3e-97
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   298   2e-96
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   296   5e-96
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   296   6e-96
NCAS0B06820 Chr2 complement(1300705..1301841) [1137 bp, 378 aa] ...    32   2.9  

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/435 (78%), Positives = 341/435 (78%)

Query: 1   MSQEEVKENISTPIEEETPVVDNTSPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSQEEVKENISTPIEEETPVVDNTSPT                                 
Sbjct: 1   MSQEEVKENISTPIEEETPVVDNTSPTEITEENKKEVAEEEADGMDDLFGDEEEEDENKS 60

Query: 61  XXXQSEDDDIGSRPRRTDIDEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRH 120
              QSEDDDIGSRPRRTDIDEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRH
Sbjct: 61  VDEQSEDDDIGSRPRRTDIDEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRH 120

Query: 121 MVPYKTSSEKTDETTVYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLI 180
           MVPYKTSSEKTDETTVYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLI
Sbjct: 121 MVPYKTSSEKTDETTVYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLI 180

Query: 181 DENTVRWRYSRDANQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQ 240
           DENTVRWRYSRDANQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQ
Sbjct: 181 DENTVRWRYSRDANQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQ 240

Query: 241 QELMQCYNGGEITKTLMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKR 300
           QELMQCYNGGEITKTLMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKR
Sbjct: 241 QELMQCYNGGEITKTLMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKR 300

Query: 301 ELEKXXXXXXXXXXXXXXXXXXXXXSPDTTMDVSGGYETRKRNTPNPSLGSRRQXXXXXX 360
           ELEK                     SPDTTMDVSGGYETRKRNTPNPSLGSRRQ      
Sbjct: 301 ELEKKQGQIIRDRRRRQLKEKELLESPDTTMDVSGGYETRKRNTPNPSLGSRRQDEYEED 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAERLRNAKRSGYDEDNQESGTENESSSS 420
                                          KAERLRNAKRSGYDEDNQESGTENESSSS
Sbjct: 361 DFLVDDEDEEDFIEDDEEEEEEEEEEDNDEEKAERLRNAKRSGYDEDNQESGTENESSSS 420

Query: 421 KKRRVAVINDDEDDE 435
           KKRRVAVINDDEDDE
Sbjct: 421 KKRRVAVINDDEDDE 435

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  414 bits (1063), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 224/374 (59%), Positives = 270/374 (72%), Gaps = 9/374 (2%)

Query: 66  EDDDIGSRPRRTDIDEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYK 125
           E+DD  ++ R  D+D+EEAMYTRKFYGD D  +YS ++++A H FKE NVE+IRHMVPYK
Sbjct: 102 EEDDESAQRRPEDMDDEEAMYTRKFYGDTD--KYSDNEEDA-HDFKEANVEIIRHMVPYK 158

Query: 126 TSSEKTDETTVYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTV 185
           TSS++ D TT+YYAKVPPFLTI+P+PFDP++FE+ V+DRL++YSS+EDQLGDRLIDENT+
Sbjct: 159 TSSDQAD-TTIYYAKVPPFLTIDPIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENTI 217

Query: 186 RWRYSRDANQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQ 245
           RWRYSRD NQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVN+T+NTFL VSHDQQELMQ
Sbjct: 218 RWRYSRDQNQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELMQ 277

Query: 246 CYNGGEITKTLMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKX 305
           CYNGGEITKT+MFIPTSTNSKIHQQLSKAVTRRNQR++LGPGTMII +DPE+EK+ELEK 
Sbjct: 278 CYNGGEITKTMMFIPTSTNSKIHQQLSKAVTRRNQRQNLGPGTMIIEKDPELEKKELEKK 337

Query: 306 XXXXXXXXXXXXXXXXXXXXSPDTTMDVSGGYETRKRNTPNPS--LGSRRQX--XXXXXX 361
                               SPDTT DV G   ++ R +P PS   GSR+          
Sbjct: 338 QGQILRERRKRQLKEREIQESPDTTFDVRGSASSKNR-SPAPSSYRGSRQDEYEEDDFLV 396

Query: 362 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAERLRNAKRSGYDEDNQESGTENESSSSK 421
                                         KA+RL+  K+ G  E      ++ E  SSK
Sbjct: 397 DDDEEEEFVGDEDEEEEEEEEEEEEDEDDRKAKRLKEIKKGGAQEYADREESDMEEGSSK 456

Query: 422 KRRVAVINDDEDDE 435
           +R+VAV++DDE+DE
Sbjct: 457 RRKVAVLSDDEEDE 470

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  361 bits (927), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 195/357 (54%), Positives = 237/357 (66%), Gaps = 11/357 (3%)

Query: 81  EEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTS-SEKTDETTVYYA 139
           EE+AMYTRKFYG+D  N +S DQD A H FKEENVEL+RH++P K + +E      ++YA
Sbjct: 106 EEQAMYTRKFYGED-ANDFS-DQDEATHTFKEENVELVRHIIPSKANVNETASHNEIFYA 163

Query: 140 KVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFK 199
           ++P FLTI+P+PFDP +FE+ V +R +N  SKEDQL DRLIDENTVRWRYSRD +Q VFK
Sbjct: 164 RIPNFLTIDPIPFDPPSFEAKVNERANNSISKEDQLDDRLIDENTVRWRYSRDNDQHVFK 223

Query: 200 ESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFI 259
           ESN QIVQWSDGS+SLK+G+EYTDILVN+T+NTFL VSHDQQELMQCY GGEI KTLMFI
Sbjct: 224 ESNTQIVQWSDGSYSLKVGEEYTDILVNDTSNTFLTVSHDQQELMQCYEGGEIKKTLMFI 283

Query: 260 PTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKXXXXXXXXXXXXXXX 319
           PTST+SKIHQ+LSKAV R+NQR++ GPGT IIN DPEVEKRELEK               
Sbjct: 284 PTSTSSKIHQKLSKAVVRKNQRQNQGPGTYIINMDPEVEKRELEKKQSQILRDRRKRQLK 343

Query: 320 XXXXXXSPDTTMDVSGGYETRKRNTPNP-SLGSRRQXXXXXXXXXXXXXXXXXXXXXXXX 378
                 SPD       G+ET  R   +P + G+ R+                        
Sbjct: 344 EKEKQESPDV------GFETAFRKQSSPTAYGATRRNEYEEDDFLVDDDEEEEAEFDDDD 397

Query: 379 XXXXXXXXXXXXXKAERLRNAKRSGYDEDNQESGTENESSSSKKRRVAVINDDEDDE 435
                         A RLRN KR G     +E G +++S+ SK+RRVAVI DDED++
Sbjct: 398 DNEEEEEEEADEDNAARLRNLKREGAAMYKEEGG-DDDSNESKRRRVAVIEDDEDED 453

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  352 bits (904), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 193/371 (52%), Positives = 235/371 (63%), Gaps = 22/371 (5%)

Query: 75  RRTDIDEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDET 134
           R + IDEEEAMY RKFYG++  +  S  ++ AL  FKE +VEL+RH+VPYKT  E  D+ 
Sbjct: 61  RTSYIDEEEAMYNRKFYGEEGSD-MSDHEEEAL--FKEADVELVRHVVPYKTFPENEDDK 117

Query: 135 TVYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDAN 194
           T+YY KVP FL+I+P+PFDP +FE+ V++R SN+SS EDQLGDRLIDENT+RWRYSRDA 
Sbjct: 118 TIYYTKVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAE 177

Query: 195 QRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITK 254
           QRVFKESNAQIVQWSDGS+SLKLG EYTDILVN T+NTFL VSHDQQELMQC +GG+I K
Sbjct: 178 QRVFKESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINK 237

Query: 255 TLMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKXXXXXXXXXX 314
           TL+FIPTSTNSKIHQ+LSKA+ RR+QR H GPGTMI+N DPEVEKRELEK          
Sbjct: 238 TLIFIPTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEKKQTQIIRERR 297

Query: 315 XXXXXXXXXXXSPDTTMDVSGGYETRKRNTPNPSLGSRR----------QXXXXXXXXXX 364
                      SP+      G +    R +  PS G  R                     
Sbjct: 298 RRQMKEQERLESPEL-----GAFSHSNRRSQTPSQGYERTHREDEYEEDDFLVDDDEEDE 352

Query: 365 XXXXXXXXXXXXXXXXXXXXXXXXXXXKAERLRNAKRSGYDEDNQESGTENESSSSKKRR 424
                                      +AERL+  KRS    +      EN+ +S K+R+
Sbjct: 353 SVELESGADEEDDEEEEEAQFSDEDEARAERLKEMKRS----NKVVIEEENDENSPKRRK 408

Query: 425 VAVINDDEDDE 435
             VI+DDED++
Sbjct: 409 GPVISDDEDED 419

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  350 bits (899), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 193/224 (86%), Gaps = 3/224 (1%)

Query: 81  EEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDETTVYYAK 140
           +E+ MYTRKFYG+D  N YS D +   H FKE NV+LIRH++PYKT +   +   ++YAK
Sbjct: 107 KEQEMYTRKFYGEDAVN-YSDDDEP--HTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAK 163

Query: 141 VPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFKE 200
           VP FLTI+PVPFDP  FE+ V +RLS  +SKEDQLGDRLIDENT+RWRYSRDA Q VFKE
Sbjct: 164 VPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKE 223

Query: 201 SNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFIP 260
           SNAQIVQWSDGSFSLKLGDEYTDI+VN+T+NTFL VSHDQQELMQCY+GGEITKT+MFIP
Sbjct: 224 SNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIP 283

Query: 261 TSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEK 304
           TSTNSKIHQ+LSKAV+RRN R++LGPG+ II +DPE+EK+ELEK
Sbjct: 284 TSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEK 327

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  350 bits (897), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 197/371 (53%), Positives = 236/371 (63%), Gaps = 30/371 (8%)

Query: 81  EEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDE-TTVYYA 139
           +E AMYTRKFYG+D  N   SDQ+ + +HF EENVEL+RH+VPYKT  E  DE +T+YYA
Sbjct: 84  QEHAMYTRKFYGEDADN--MSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYA 141

Query: 140 KVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFK 199
           KVP FLTI+PVPFDP +FES V++RL N SS+EDQLGDRLIDENT+RWRYSRD NQ+V+K
Sbjct: 142 KVPEFLTIDPVPFDPPSFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDENQQVYK 200

Query: 200 ESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFI 259
           ESNAQIVQWSDG  SLKLG EYTDILVN+T+NTF AVSHD+QELMQC  GGE+TK+LMFI
Sbjct: 201 ESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFI 260

Query: 260 PTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKXXXXXXXXXXXXXXX 319
           PTSTNSK+HQ+L+KAV RR+QR+  GPG   +N+DPE+EK ELEK               
Sbjct: 261 PTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVVRERRKRQLK 320

Query: 320 XXXXXXSPDTTMDVSGGYETRKRNTP-------NPSLGSRR-----QXXXXXXXXXXXXX 367
                 SPD +  ++G      R TP       +   GS +     Q             
Sbjct: 321 EIESRNSPDISTGLNG-----YRKTPVTASDEQDSYYGSSKRNEYEQDDFLVDDDEEEEA 375

Query: 368 XXXXXXXXXXXXXXXXXXXXXXXXKAERLRNAKRSG---YDEDNQESGTENESSSSKKRR 424
                                   KAERLR  KR G   Y E   ES       S+K+R+
Sbjct: 376 GYSEEDDVLDDNNDDQEAEDEEDAKAERLRQLKRQGTERYTEPEPES-----DPSTKRRK 430

Query: 425 VAVINDDEDDE 435
           VA+I DDEDDE
Sbjct: 431 VAII-DDEDDE 440

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  350 bits (899), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 189/357 (52%), Positives = 232/357 (64%), Gaps = 8/357 (2%)

Query: 81  EEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTS-SEKTDETTVYYA 139
           EE+AMYTRKFYG+D  N   SDQD   H FKEENVEL+RH++P K + +E      ++YA
Sbjct: 114 EEQAMYTRKFYGEDANN--FSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEIFYA 171

Query: 140 KVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFK 199
           ++P FLTI+P+PFDP +FE+ V +R SN +S+EDQL DRLIDENTVRWRYSRD +Q VFK
Sbjct: 172 RIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQHVFK 231

Query: 200 ESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFI 259
           ESN QIVQWSDG++SLK+G+E TDILVN+T+NTFL VSHDQQEL+QCY GGEI KTLMFI
Sbjct: 232 ESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFI 291

Query: 260 PTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKXXXXXXXXXXXXXXX 319
           PTSTNSKIHQ+LSKAV RRNQR+  GPGT I++ DPEVEK+ELE+               
Sbjct: 292 PTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQSQILRDRRRRQLK 351

Query: 320 XXXXXXSPDTTMDVSGGYETRKRNTPNPSLGSRR-QXXXXXXXXXXXXXXXXXXXXXXXX 378
                 SPD   +   G+  RK+N+P     SRR +                        
Sbjct: 352 EKEKQESPDAAFET--GF--RKQNSPTTYGASRRNEYEEDDFLVDDDEEEEAAFDDEEDD 407

Query: 379 XXXXXXXXXXXXXKAERLRNAKRSGYDEDNQESGTENESSSSKKRRVAVINDDEDDE 435
                         A RLRN KR G     +E   E + S +K+RRVAVI DDED++
Sbjct: 408 NEEEEEEEDADEENASRLRNLKREGAAMYREEEEEEKDRSETKRRRVAVIEDDEDED 464

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  344 bits (882), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 190/364 (52%), Positives = 233/364 (64%), Gaps = 17/364 (4%)

Query: 81  EEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYK-TSSEKTDETTVYYA 139
           EE+AMYTRKFYG+D  N +S DQD A H FKEENVEL+RH++P K   +E      ++YA
Sbjct: 108 EEQAMYTRKFYGED-LNDFS-DQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYA 165

Query: 140 KVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFK 199
           ++P FLTI+PVPFDP +FE+ V +R SN +SKEDQL DRLIDENTVRWRYSRD +Q VFK
Sbjct: 166 RIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFK 225

Query: 200 ESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFI 259
           ESN QIVQWSDG++SLK+G+E TDILVN+T+NTFL VSHDQQEL+QCY GGEI KTLMFI
Sbjct: 226 ESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFI 285

Query: 260 PTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKXXXXXXXXXXXXXXX 319
           PTSTNSKIHQ+LSKAV RRNQR++ GPGT I++ DPEVEKRELEK               
Sbjct: 286 PTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKKQSQILRDRRRRQLK 345

Query: 320 XXXXXXSPDTTMDVSGGYETRKRNTPNPSLGSRRQX--------XXXXXXXXXXXXXXXX 371
                 SPD   +   G+  RK+++P     SRR                          
Sbjct: 346 EKEKQESPDAAFET--GF--RKQSSPTAYGTSRRNEYEEDDFLVDDDEEEEAEFDDDDDN 401

Query: 372 XXXXXXXXXXXXXXXXXXXXKAERLRNAKRSGYDEDNQESGTENESSSSKKRRVAVINDD 431
                                A RLR+ K+ G     QE   +N  + +K+RRVAVI DD
Sbjct: 402 EEEEEEEEEEEEEEEDADEANAARLRSLKKEGAAMYRQEENEDN--NETKRRRVAVIEDD 459

Query: 432 EDDE 435
           E+++
Sbjct: 460 EEED 463

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  337 bits (864), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 192/225 (85%), Gaps = 3/225 (1%)

Query: 80  DEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDETTVYYA 139
           DEE+AMY RKFYGDD  N   SD +++   FKE +VE+ +H+VPYKT+S   D+  VYYA
Sbjct: 129 DEEQAMYNRKFYGDDVDN--DSDAEDSQREFKEADVEIAKHIVPYKTTSNSQDKE-VYYA 185

Query: 140 KVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFK 199
           KVP FLTI+PVPFDP +F+ +V  RL+ +SSKEDQL DRLIDENT+RWRYSRD+ Q+VFK
Sbjct: 186 KVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFK 245

Query: 200 ESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFI 259
           ESNAQI+QWSDG+FSL+LGDE++D+L+N+T+NTFL VSH+QQELMQC  GGEITKT+MFI
Sbjct: 246 ESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFI 305

Query: 260 PTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEK 304
           PTST+SKIHQ+LSKAV RR QREHLGP T I+ +DPE+E+RELEK
Sbjct: 306 PTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEK 350

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  333 bits (853), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 165/264 (62%), Positives = 191/264 (72%), Gaps = 6/264 (2%)

Query: 71  GSRPRR--TDIDEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSS 128
           GS PRR   D+DEEE MY RKFYG+D      SD + A H FKE NVEL++H+VPYK   
Sbjct: 86  GSSPRRKRLDMDEEEEMYNRKFYGED---VDMSDTEQAEHEFKEANVELVKHIVPYKLVP 142

Query: 129 EKTDETT-VYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRW 187
           +    T  +Y AKVPPFL I+P PFDP +FE  V DRL    SKED+LGDRLIDENTVRW
Sbjct: 143 DDAIGTNDIYVAKVPPFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRW 202

Query: 188 RYSRDANQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCY 247
           RYSRD NQ VFKESN QIVQWSDGS+SLKLG+EYTDIL+N+T+NTFL VSHDQQELMQC 
Sbjct: 203 RYSRDTNQSVFKESNTQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCV 262

Query: 248 NGGEITKTLMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKXXX 307
            GG + KTLMFIPTST+SKIHQ+LSKAV RRN  +  GPGT I++ DPE+EK+ELE+   
Sbjct: 263 EGGLVNKTLMFIPTSTSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDPEIEKKELERKQG 322

Query: 308 XXXXXXXXXXXXXXXXXXSPDTTM 331
                             SPDTT+
Sbjct: 323 QIFKERRRRQLREKELAESPDTTI 346

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  332 bits (852), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/362 (53%), Positives = 236/362 (65%), Gaps = 17/362 (4%)

Query: 81  EEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTS-SEKTDETTVYYA 139
           EE+AMYTRKFYG+D  N YS DQD A H FKEEN+E++RH++P K + +E      ++YA
Sbjct: 136 EEQAMYTRKFYGED-ANDYS-DQDEAAHTFKEENIEIVRHIIPNKANVNETASHNEIFYA 193

Query: 140 KVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFK 199
           ++P FLTI+ VPFDP +FE+ V +R  N +SKEDQL DRLIDENTVRWRYSRD +Q VFK
Sbjct: 194 RIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDKDQHVFK 253

Query: 200 ESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFI 259
           ESN QIVQWSDGS+SLK+G+E TDILVN+T+NTFL VSHDQQEL+QCY GGEI KTLMFI
Sbjct: 254 ESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFI 313

Query: 260 PTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKXXXXXXXXXXXXXXX 319
           PTSTNSKIHQ+LSKAV RRNQR++ GPGT I+N DPEVEK+ELEK               
Sbjct: 314 PTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVLRDRRRRQLK 373

Query: 320 XXXXXXSPDTTMDVSGGYETRKRNTPNPSLGSRR---QXXXXXXXXXXXXXXXXXXXXXX 376
                 SPD   +   G+  RK+++P     SRR   +                      
Sbjct: 374 EREKQESPDAAFET--GF--RKQSSPTSYGISRRNEYEEDDFLVDDDEEEEAGFDDGDDE 429

Query: 377 XXXXXXXXXXXXXXXKAERLRNAKRSG---YDEDNQESGTENESSSSKKRRVAVINDDED 433
                           A RLRN KR G   Y    +E   +++S+ +K+RRVAVI DDED
Sbjct: 430 EEEEEEEEEEEADQENAARLRNLKREGAAMY----KEEEKDDDSNETKRRRVAVIEDDED 485

Query: 434 DE 435
           +E
Sbjct: 486 EE 487

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  330 bits (845), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 194/224 (86%), Gaps = 4/224 (1%)

Query: 81  EEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDETTVYYAK 140
           EE AMYTRKFYG+D  +R S +++      +EE+VEL+RH+VPY+ +++ TD+  +YYAK
Sbjct: 87  EEHAMYTRKFYGED-VDRVSDEEEAQEF--REEDVELVRHIVPYR-ATQGTDKPVLYYAK 142

Query: 141 VPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFKE 200
           +P FLTI+PVPFDP +FE+ V++RL N +SKEDQLGDRLIDENTVRWRYSRDANQ+VFKE
Sbjct: 143 IPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKE 202

Query: 201 SNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFIP 260
           SNAQIVQWSDG+FSLKLGDEYTDIL N+T+NTF AVSHDQQELMQCY GGE+TKTLMFIP
Sbjct: 203 SNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIP 262

Query: 261 TSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEK 304
           TST+S++HQ+L+KAV RR+ ++  GPGT I+ +DPE+E+ ELEK
Sbjct: 263 TSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGELEK 306

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 10/42 (23%)

Query: 393 AERLRNAKRSGYDEDNQESGTENESSSSKKRRVAVINDDEDD 434
           AERLR  KR G           N     K+RRVAVI+D+ED+
Sbjct: 392 AERLRRLKREGA----------NNYEERKRRRVAVIDDEEDE 423

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  330 bits (845), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 157/231 (67%), Positives = 193/231 (83%), Gaps = 6/231 (2%)

Query: 69  DIGSRPRR---TDIDEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYK 125
           +IG R R     D DEE+AMYTRKFYG+DDY++  SDQ+   H F+EE+V L RH+VP K
Sbjct: 76  NIGRRRRNYVDEDEDEEQAMYTRKFYGEDDYDK--SDQEEDKHEFREEDVVLTRHVVPTK 133

Query: 126 TSSEKTD-ETTVYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENT 184
            +SE+ D +TT+YYAKVPPFLTI+P+PFDP  FE+ VR+RL+N  SKE+QL DRLID+NT
Sbjct: 134 ITSEENDADTTIYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNT 193

Query: 185 VRWRYSRDANQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELM 244
           +RWRYSRD NQRVFKESNA IVQWSDGS+SLKLGDEYTDIL+N+T+NTFL VSHDQQELM
Sbjct: 194 IRWRYSRDDNQRVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELM 253

Query: 245 QCYNGGEITKTLMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDP 295
           QC +GGEI+K+L+F+P ST SK+HQ+LSKA+ RRN  E +GP +MI+N DP
Sbjct: 254 QCVHGGEISKSLLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDP 304

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%), Gaps = 6/45 (13%)

Query: 392 KAERLRNAKRSGYDE--DNQESGTENESSSSKKRRVAVINDDEDD 434
           +AERLR  KR G     D+++SG+E    S K+R+VAVI DDEDD
Sbjct: 417 RAERLRELKRQGTAAYNDDEKSGSE----SPKRRKVAVIEDDEDD 457

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  321 bits (822), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 146/226 (64%), Positives = 184/226 (81%), Gaps = 10/226 (4%)

Query: 78  DIDEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDET--- 134
           D DEE AMYTRKFYGD+D N+Y  D+D  +H FKE +VEL+RH+VPYK   +K D +   
Sbjct: 107 DEDEEHAMYTRKFYGDEDVNKY--DEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDD 164

Query: 135 -----TVYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRY 189
                + YYA++PPFLTI+PVPFDP  FES+V++RL N ++ +D++GDRLIDENT+RWRY
Sbjct: 165 ATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRY 224

Query: 190 SRDANQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNG 249
           SRDANQ VFKESNAQI+QWSDGS+SLKLGD+YTD+LVN+ +NTFL VSHDQQELMQC +G
Sbjct: 225 SRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDG 284

Query: 250 GEITKTLMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDP 295
           GEI+K+ MF+P STNS++HQ+LSKA+ RR+Q     P +MIIN DP
Sbjct: 285 GEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDP 330

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  308 bits (788), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 146/225 (64%), Positives = 183/225 (81%), Gaps = 4/225 (1%)

Query: 80  DEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDETTVYYA 139
           DEE+AMY RKF G+D Y   S ++    +     +VE+++H+VPYKT++   D+ T+YYA
Sbjct: 67  DEEQAMYNRKFLGED-YEGQSEEEYEKKYKEV--DVEIVKHVVPYKTAN-GADDKTIYYA 122

Query: 140 KVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFK 199
           KVP FLTI+PVPFDP +F+  V DR+S YSSKEDQLGDRLI+ENT+RWRYSRD ++RVFK
Sbjct: 123 KVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFK 182

Query: 200 ESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFI 259
           ESNAQIV+WSDG+FSLK+GDEYTDILVN T NT+L VSH++QEL+QC  GGEITK++MF+
Sbjct: 183 ESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFV 242

Query: 260 PTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEK 304
           PTSTNSK+H+ LSKAV RR++R   GP T I   DPE+EKRELEK
Sbjct: 243 PTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEK 287

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  301 bits (772), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 142/233 (60%), Positives = 186/233 (79%), Gaps = 7/233 (3%)

Query: 77  TDIDEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKT---SSEKTDE 133
           +D ++++AMY +KFYG+D +NR  SD D+  + +KE ++EL+RH+VPYKT   + E    
Sbjct: 50  SDDEQDKAMYEKKFYGEDGFNR--SDDDDNEYEYKESDIELVRHIVPYKTRPSNKELDKH 107

Query: 134 TTVYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDA 193
             +YYAKVPPFL ++PVPFD   FES V++R+ N  +++ Q+ DRL DENT+RWRYSRD+
Sbjct: 108 RELYYAKVPPFLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRDS 167

Query: 194 NQ--RVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGE 251
           N   +VFK+SNAQI+QWSDGS+SLKLG++YTDIL NET+N FL VSHDQQELMQCYNGGE
Sbjct: 168 NDNDKVFKQSNAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGGE 227

Query: 252 ITKTLMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEK 304
           ITKTLMFIP+ST SKIHQ+L+ AV  R+++   GPG M+IN DPE+EK+ LEK
Sbjct: 228 ITKTLMFIPSSTKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEIEKKLLEK 280

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 30/47 (63%), Gaps = 7/47 (14%)

Query: 395 RLRNAKRSGYDEDNQESGTENESSS------SKKRRVAVINDDEDDE 435
           RLRNAKR GY ED+ E    NE         +K+R++AVI DDEDDE
Sbjct: 383 RLRNAKRQGYQEDDDERDARNEEEQSSSSEVTKRRKIAVI-DDEDDE 428

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  299 bits (765), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 178/225 (79%), Gaps = 5/225 (2%)

Query: 80  DEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDETTVYYA 139
           D+E+AMY RKFYGD    +     D     F+E ++++++H+VPY T   + D+T +YY 
Sbjct: 65  DDEQAMYNRKFYGD----KGEDSNDEGSQEFREADIDIMKHIVPYSTEPSQGDKT-IYYT 119

Query: 140 KVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFK 199
           KVP FLTI+P+PFDP AF+S + +R +  +S EDQ+ DRLI+ENTVRWRYSRD NQRVFK
Sbjct: 120 KVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFK 179

Query: 200 ESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFI 259
           ESNA IVQWSDG++SL+LGDEYTD+L+N+T +T+LAVSHDQQEL+Q   GGE+TK ++FI
Sbjct: 180 ESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFI 239

Query: 260 PTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEK 304
           PTSTNSK HQ+LSKAV R+ Q+EH GP T I+  DPE+E++ELEK
Sbjct: 240 PTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPELEQKELEK 284

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 8/50 (16%)

Query: 393 AERLRNAKRSGYDEDNQESGTEN-------ESSSSKKRRVAVINDDEDDE 435
           AERLR  KR G  + N +  ++N       E S+ K+R+VAV+ DDEDDE
Sbjct: 375 AERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVL-DDEDDE 423

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  298 bits (764), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 134/220 (60%), Positives = 173/220 (78%), Gaps = 2/220 (0%)

Query: 77  TDIDEEEAMYTRKFYGDD-DYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDETT 135
           +D ++E+ MY RKFYGDD     Y SD +      KE NV++++H+VPY T++    +++
Sbjct: 81  SDEEDEQEMYNRKFYGDDLKKTSYESDVEEE-REIKEANVQIMKHVVPYYTTNASEKDSS 139

Query: 136 VYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQ 195
           +YYAKVP FLTI+P+PFDP  F+S +  RL  +SSKEDQLGDRLIDENT+RWRYSR ANQ
Sbjct: 140 LYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQ 199

Query: 196 RVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKT 255
           +VFKESNAQI+QWSDG+FSLKLGDE++DIL+N+  NT++ VSH+Q+ELMQC  GGEI K+
Sbjct: 200 QVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKS 259

Query: 256 LMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDP 295
           ++FIPTSTNSK HQ+LS A+ RR  REH GP T I+  DP
Sbjct: 260 MLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDP 299

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  296 bits (759), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 135/226 (59%), Positives = 175/226 (77%), Gaps = 2/226 (0%)

Query: 80  DEEEAMYTRKFYGDDDYNRYS-SDQDNALHHFKEENVELIRHMVPYKTSSEKTDETTVYY 138
           +EE+ MY RKFYGDD       SD+D A    KE ++EL++H+VP   +     +  +YY
Sbjct: 79  NEEQEMYNRKFYGDDLQQASDLSDEDEA-REIKEADLELVKHVVPLLYNKPLEGKRLLYY 137

Query: 139 AKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVF 198
            KVP FLTI+PVPFDP +F+  +  R++ +SSKEDQLGD LIDENT+RWRYSR ++QRVF
Sbjct: 138 TKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRVF 197

Query: 199 KESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMF 258
           KESNAQ+++WSDG+ SLKLGDEYTDIL NE  NT+L VSH+QQE+MQC  GG I+ +++F
Sbjct: 198 KESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLF 257

Query: 259 IPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEK 304
           IPTSTNSKIH++L+KA+ RR  REH GP T I+ +DPE+EKREL+K
Sbjct: 258 IPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQK 303

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  296 bits (758), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 135/222 (60%), Positives = 178/222 (80%), Gaps = 4/222 (1%)

Query: 83  EAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDETTVYYAKVP 142
           +AMY RKFYGD   N   S+ + +   F+E +V++++H+VPY T   + D+T ++YAKVP
Sbjct: 81  QAMYNRKFYGD---NAEDSNDEGSQREFREADVDVVKHVVPYSTVPSEGDKT-IFYAKVP 136

Query: 143 PFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFKESN 202
            FLTI+P+PFDP AF++ +  R +  SS EDQ+ DRLI+ENTVRWRYSRD+ Q+VFKESN
Sbjct: 137 QFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESN 196

Query: 203 AQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFIPTS 262
           AQIVQWSDG+FSL+LGDE+TD+L+N+T +T+L VSHDQQEL+Q   GGE+TK ++FIPTS
Sbjct: 197 AQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTS 256

Query: 263 TNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEK 304
           TNSK HQ+LSKAV R+ QREH GP T I+  DPE+E++ELEK
Sbjct: 257 TNSKSHQRLSKAVARKEQREHHGPNTYILRVDPELEQKELEK 298

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 8/50 (16%)

Query: 393 AERLRNAKRSGYD-------EDNQESGTENESSSSKKRRVAVINDDEDDE 435
           AERLR  KRSG         ED+  +  E + S+ K+R+VAV+ DDEDDE
Sbjct: 388 AERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVL-DDEDDE 436

>NCAS0B06820 Chr2 complement(1300705..1301841) [1137 bp, 378 aa]
           {ON} Anc_4.95 YBL013W
          Length = 378

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 90  FYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTD--ETTVYYAKVPPFL-- 145
           F+G D+++  S    NALH  K ++ E I H+      S+      +T+Y   + PF+  
Sbjct: 26  FFGTDEFSNLSL---NALHQIKTQHPETIEHLQVVTKPSKWCGRHHSTLYTPAITPFVES 82

Query: 146 ---TINPVPFDP 154
                 P+P++P
Sbjct: 83  LPDMPAPIPYEP 94

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.127    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,911,140
Number of extensions: 1738933
Number of successful extensions: 7513
Number of sequences better than 10.0: 38
Number of HSP's gapped: 7620
Number of HSP's successfully gapped: 54
Length of query: 435
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 322
Effective length of database: 40,524,141
Effective search space: 13048773402
Effective search space used: 13048773402
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)