Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H020605.434ON32232217100.0
NDAI0C016005.434ON31330713270.0
Suva_8.1735.434ON31231211651e-161
KNAG0C049105.434ON31331311651e-161
Skud_15.2835.434ON31230611421e-157
Smik_15.2985.434ON31230611391e-157
YOR120W (GCY1)5.434ON31230611261e-155
CAGL0A02816g5.434ON31031011221e-154
CAGL0I01100g5.434ON31030611011e-151
TBLA0A065105.434ON31230610831e-148
Suva_2.5405.434ON31230610791e-148
Kpol_1062.295.434ON31131110741e-147
YDR368W (YPR1)5.434ON31230610721e-147
Smik_4.6345.434ON31230610721e-147
Skud_4.6375.434ON31230610661e-146
NDAI0B056705.434ON31831110631e-145
SAKL0G02530g5.434ON31230610501e-143
NCAS0F033805.434ON31330510501e-143
KAFR0E03850singletonON31129610341e-141
TBLA0A02825singletonON31131210281e-140
KAFR0E038405.434ON31031310201e-139
TPHA0E017605.434ON31031210111e-137
TDEL0E019105.434ON31131210061e-137
KLLA0B14707gsingletonON31031010051e-137
Kwal_47.18084na 1ON30930310031e-136
KLTH0E00220gsingletonON30630210001e-136
KLTH0A00528gsingletonON30630210001e-136
ZYRO0F10032g5.434ON3103109971e-135
KLTH0E15532gsingletonON3093049951e-135
TDEL0D00230singletonON3123089611e-130
TPHA0G00210singletonON3113079581e-129
KLTH0A03476gna 1ON3083089501e-128
KLTH0F16060g5.434ON3093029431e-127
TBLA0A02835singletonON3113109031e-121
Kwal_55.214265.434ON3083038911e-119
KLLA0D10109gsingletonON3093098751e-117
AER401W5.434ON3133078061e-106
NDAI0A070003.108ON3202986012e-75
NCAS0I024203.108ON3203035891e-73
SAKL0C10626gsingletonON3222955621e-69
KNAG0K020703.108ON3233025516e-68
KAFR0G013503.108ON3243025446e-67
YBR149W (ARA1)3.108ON3443175432e-66
Skud_2.2763.108ON3443165327e-65
Smik_2.289singletonON3443225327e-65
Smik_2.2883.108ON3443155311e-64
KLTH0C10010g3.108ON3213115254e-64
KLLA0F02728g3.108ON3302995255e-64
Suva_4.3983.108ON3443175267e-64
ZYRO0B06138g3.108ON3283115231e-63
SAKL0C09922g3.108ON3223045212e-63
TDEL0D051603.108ON3253195212e-63
Kwal_56.226113.108ON3213085002e-60
Ecym_55085.409ON3263134385e-51
ZYRO0A06336g5.409ON3273074315e-50
KLTH0F16610g5.409ON3293144309e-50
ACL107C5.409ON3543164311e-49
SAKL0F14278g7.468ON2862874242e-49
KLLA0F03256g7.468ON2852914154e-48
KNAG0B03780singletonON3263134175e-48
SAKL0F02574gna 2ON2893114148e-48
NCAS0A066605.409ON3263074141e-47
TBLA0F01720singletonON3263074142e-47
KNAG0D013707.468ON2822914084e-47
Ecym_7160na 3ON2712934059e-47
KLTH0G02420gna 2ON2893194051e-46
Kwal_47.182197.468ON2932954052e-46
KLTH0G05786g7.468ON2862954042e-46
YJR096W7.468ON2822914033e-46
TDEL0C033207.468ON2832904016e-46
Kwal_47.18893na 2ON2892954007e-46
TBLA0A00630singletonON3283144038e-46
TDEL0E021505.409ON3293104011e-45
ZYRO0G17600g7.468ON2832943962e-45
KAFR0C05320singletonON3273083967e-45
Smik_10.3847.468ON2822913929e-45
CAGL0I01122g5.409ON3263123951e-44
NDAI0D016005.409ON3273113951e-44
SAKL0G01914g5.409ON3293163914e-44
Skud_10.3187.468ON2822913884e-44
Kpol_1013.827.468ON2852863884e-44
KLLA0E21627g5.409ON3293103881e-43
NCAS0H005607.468ON2842943851e-43
Kwal_55.215365.409ON3293153862e-43
TPHA0E018605.409ON3263103854e-43
KLTH0F01892gna 4ON3022843825e-43
Suva_15.3005.409ON3273073837e-43
Suva_12.1847.468ON2822913781e-42
KAFR0G009207.468ON2862933772e-42
KLLA0F05775g7.285ON3093093782e-42
ABL209Cna 3ON3102903774e-42
CAGL0C04543g7.468ON2872913702e-41
Kpol_1020.137.285ON3133263722e-41
Kwal_33.13276na 4ON3022833694e-41
YHR104W (GRE3)5.409ON3273073697e-41
Skud_4.1317.285ON3123033625e-40
Smik_8.1825.409ON3273093627e-40
Skud_8.1655.409ON3273073574e-39
Smik_4.1137.285ON3123123557e-39
NCAS0A137407.285ON3093183531e-38
YDL124W7.285ON3123143433e-37
CAGL0J09394g7.285ON3113083425e-37
KNAG0C041107.285ON3113103408e-37
Kpol_381.8singletonON3093243303e-35
ZYRO0E09614gna 5ON3082713276e-35
NDAI0A023007.285ON3133113251e-34
KAFR0B012007.285ON3153013233e-34
TDEL0D02790singletonON3293023164e-33
KLTH0G00638gna 5ON3132763146e-33
SAKL0F00704gna 5ON3152843121e-32
SAKL0F09746g7.285ON3123093084e-32
Kwal_47.19278na 5ON3142843032e-31
TBLA0F019807.285ON3023233005e-31
ZYRO0C09196g7.285ON3123222999e-31
Ecym_32647.285ON3113232762e-27
Kwal_33.13274singletonON108851675e-14
Suva_4.1227.285ON2061961216e-07
TBLA0G01120singletonON3433291078e-05
Ecym_22962.604ON3401821051e-04
TBLA0E05040singletonON3423451032e-04
NCAS0C02450singletonON3433181023e-04
Suva_12.272singletonON2652701013e-04
Kpol_449.4singletonON3413241014e-04
KNAG0M023402.604ON3091801005e-04
TDEL0A08000singletonON319183996e-04
Kpol_400.9singletonON341347950.002
KAFR0F03890singletonON319312940.003
NCAS0A129502.604ON32386940.003
ABR094W2.604ON359157940.003
KLTH0E01474gsingletonON313209920.004
KAFR0C03670singletonON343334910.008
KAFR0D04230singletonON342331900.010
YNL331C (AAD14)na 6ON376118890.012
Skud_10.383na 7ON376118860.030
TBLA0G00960singletonON321128850.039
YDL243C (AAD4)singletonON329105840.048
KAFR0J00220singletonON343327830.068
Kwal_26.93223.462ON331188830.069
Suva_14.10na 6ON376119810.11
TBLA0B10110singletonON34583810.11
SAKL0H09438g8.565ON342299810.11
KLTH0E16852gsingletonON375130790.24
NCAS0F04070singletonON344269780.25
YFL056C (AAD6)singletonON212105770.27
Smik_14.1na 6ON376106770.37
KAFR0C04240singletonON34383760.48
KNAG0L01560singletonON34083750.57
NCAS0C019908.565ON343222750.70
YCR107W (AAD3)singletonON363106731.2
NCAS0J01740singletonON34596711.8
ZYRO0F04840gsingletonON37983712.3
ZYRO0F00858g2.604ON34691702.6
NDAI0B009305.76ON94073703.5
NDAI0H02960singletonON34481693.5
KNAG0C056202.547ON400174693.9
ADR215C5.674ON33956684.3
Smik_3.210singletonON362121675.4
Smik_79.1singletonON253121675.8
KLLA0A03531g7.22ON73284676.4
NDAI0D007906.19ON401106677.3
Suva_9.17singletonON308156667.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H02060
         (322 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     663   0.0  
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   515   0.0  
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   453   e-161
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   453   e-161
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   444   e-157
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   443   e-157
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   438   e-155
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   436   e-154
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   428   e-151
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   421   e-148
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   420   e-148
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   418   e-147
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   417   e-147
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   417   e-147
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   415   e-146
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   414   e-145
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   409   e-143
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     409   e-143
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     402   e-141
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     400   e-140
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   397   e-139
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   394   e-137
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   392   e-137
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   391   e-137
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   390   e-136
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   389   e-136
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   389   e-136
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   388   e-135
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   387   e-135
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   374   e-130
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 373   e-129
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   370   e-128
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   367   e-127
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     352   e-121
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   347   e-119
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   341   e-117
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   315   e-106
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   236   2e-75
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   231   1e-73
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   221   1e-69
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   216   6e-68
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   214   6e-67
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   213   2e-66
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   209   7e-65
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   209   7e-65
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   209   1e-64
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   206   4e-64
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   206   5e-64
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   207   7e-64
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   206   1e-63
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   205   2e-63
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   205   2e-63
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   197   2e-60
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   173   5e-51
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   170   5e-50
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   170   9e-50
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   170   1e-49
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   167   2e-49
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   164   4e-48
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               165   5e-48
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   164   8e-48
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             164   1e-47
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     164   2e-47
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   161   4e-47
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   160   9e-47
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   160   1e-46
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   160   2e-46
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   160   2e-46
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   159   3e-46
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   159   6e-46
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   158   7e-46
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     159   8e-46
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   159   1e-45
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   157   2e-45
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   157   7e-45
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   155   9e-45
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   156   1e-44
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               156   1e-44
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   155   4e-44
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   154   4e-44
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   154   4e-44
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   154   1e-43
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   152   1e-43
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   153   2e-43
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   152   4e-43
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   151   5e-43
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   152   7e-43
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   150   1e-42
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   149   2e-42
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   150   2e-42
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   149   4e-42
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   147   2e-41
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   147   2e-41
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   146   4e-41
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   146   7e-41
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   144   5e-40
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   144   7e-40
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   142   4e-39
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   141   7e-39
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   140   1e-38
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   136   3e-37
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   136   5e-37
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   135   8e-37
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   131   3e-35
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   130   6e-35
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     129   1e-34
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   129   3e-34
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     126   4e-33
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   125   6e-33
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   124   1e-32
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   123   4e-32
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   121   2e-31
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   120   5e-31
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   119   9e-31
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   110   2e-27
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    69   5e-14
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    51   6e-07
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    46   8e-05
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    45   1e-04
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             44   2e-04
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    44   3e-04
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    44   3e-04
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    44   4e-04
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    43   5e-04
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              43   6e-04
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    41   0.002
KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON}      41   0.003
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    41   0.003
ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic ho...    41   0.003
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    40   0.004
KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {O...    40   0.008
KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {O...    39   0.010
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    39   0.012
Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331...    38   0.030
TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON}      37   0.039
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    37   0.048
KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON}      37   0.068
Kwal_26.9322 s26 complement(1163928..1164923) [996 bp, 331 aa] {...    37   0.069
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    36   0.11 
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    36   0.11 
SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly...    36   0.11 
KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]...    35   0.24 
NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {O...    35   0.25 
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    34   0.27 
Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON} YNL...    34   0.37 
KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON}               34   0.48 
KNAG0L01560 Chr12 (276747..277769) [1023 bp, 340 aa] {ON}              33   0.57 
NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565     33   0.70 
YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putati...    33   1.2  
NCAS0J01740 Chr10 complement(321825..322862) [1038 bp, 345 aa] {...    32   1.8  
ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly...    32   2.3  
ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar ...    32   2.6  
NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.7...    32   3.5  
NDAI0H02960 Chr8 (721089..722123) [1035 bp, 344 aa] {ON}               31   3.5  
KNAG0C05620 Chr3 (1086573..1087775) [1203 bp, 400 aa] {ON}             31   3.9  
ADR215C Chr4 complement(1080543..1081562) [1020 bp, 339 aa] {ON}...    31   4.3  
Smik_3.210 Chr3 (309527..310615) [1089 bp, 362 aa] {ON} YNL331C ...    30   5.4  
Smik_79.1 Chr79 complement(3..761) [759 bp, 253 aa] {ON} YNL331C...    30   5.8  
KLLA0A03531g Chr1 (320828..323026) [2199 bp, 732 aa] {ON} simila...    30   6.4  
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...    30   7.3  
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     30   7.3  

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/322 (100%), Positives = 322/322 (100%)

Query: 1   MPTSIAKHEKQMSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHI 60
           MPTSIAKHEKQMSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHI
Sbjct: 1   MPTSIAKHEKQMSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHI 60

Query: 61  DTAAIYGNEGQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYL 120
           DTAAIYGNEGQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYL
Sbjct: 61  DTAAIYGNEGQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYL 120

Query: 121 MHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSN 180
           MHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSN
Sbjct: 121 MHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSN 180

Query: 181 FSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPIL 240
           FSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPIL
Sbjct: 181 FSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPIL 240

Query: 241 TEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINN 300
           TEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINN
Sbjct: 241 TEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINN 300

Query: 301 ISKEKGERRIVQPHWEPFVPFV 322
           ISKEKGERRIVQPHWEPFVPFV
Sbjct: 301 ISKEKGERRIVQPHWEPFVPFV 322

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  515 bits (1327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/307 (78%), Positives = 274/307 (89%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75
           NST T+KLNTGATI AVGLGTWQSTNENEGYEAV+ ALKAGYRHIDTAAIY NE QVGKA
Sbjct: 7   NSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNEDQVGKA 66

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
           INDSG+PREEIFVTTKLW TQH DP   LN SL+RLGLDYVDLYLMHWPV   P SIKDG
Sbjct: 67  INDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKPDSIKDG 126

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195
           N+ ++P+LP+G+RD+++ TW++VKTWELMQELPKTGKTRAVGVSNFSINNLK +LSSPGN
Sbjct: 127 NYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKALLSSPGN 186

Query: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255
           K+VPA NQVE HPLLPQ+EL ++C  KGI+LEAYSPLGSTNAPILTEP +I +AKKH VQ
Sbjct: 187 KLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIAKKHNVQ 246

Query: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315
            AQ+VISWHVQ+G++VLPKSVH ERI+ANF+T +LS +EM  +NN+SKEKGERRIVQP+W
Sbjct: 247 PAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERRIVQPNW 306

Query: 316 EPFVPFV 322
            PFVPFV
Sbjct: 307 APFVPFV 313

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  453 bits (1165), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 216/312 (69%), Positives = 255/312 (81%), Gaps = 3/312 (0%)

Query: 12  MSAS--NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNE 69
           MSA+   ST T  LNTGA I  VGLGTWQS  +N+ Y++V+AALK GYRHIDTAAIYGNE
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQS-KDNDAYKSVVAALKDGYRHIDTAAIYGNE 59

Query: 70  GQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNP 129
            QVG+AI DSGVPREEIFVTTKLW TQHH+PA  L+ SLKRLGLDYVDLYLMHWPV L+P
Sbjct: 60  DQVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDP 119

Query: 130 RSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKV 189
             IKDG+ LSIP   DG R V+I  W+++KTWELMQELPKT KTRAVGVSNFSINNLK +
Sbjct: 120 NYIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDL 179

Query: 190 LSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLA 249
           L+SPGN++ PA NQVE+HPLLPQ EL+++C SKGI++EAYSPLGST+AP+L EPV++ +A
Sbjct: 180 LASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIA 239

Query: 250 KKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERR 309
           KK+ VQ   +VISWH QRGY+VLPKSV+ +RI+ N K   LSDE+   INNISKEKGE+R
Sbjct: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKR 299

Query: 310 IVQPHWEPFVPF 321
           +V P W PF  F
Sbjct: 300 VVNPDWSPFEAF 311

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  453 bits (1165), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 209/313 (66%), Positives = 260/313 (83%), Gaps = 2/313 (0%)

Query: 12  MSA--SNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNE 69
           MSA  S +T+  KLNTGATI A+GLGTW+S    + Y++VIAAL+AGYRHIDTAAIYGNE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 70  GQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNP 129
            +VG+AI +SGVPR EIFVTTKLW TQH +P   L+ SLKRLGLDYVDLYLMHWPV +  
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 130 RSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKV 189
            ++ +G+ +  P LP+GKRD++I  W++VKTWELMQ+LP+TGKTRA+GVSNFSINNLK +
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 190 LSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLA 249
           L+SPGNK+VPA NQVE+HPLLPQ+EL+++CH KGI++EAYSPLGS +APIL EPV+I +A
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 250 KKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERR 309
           KK+GV  AQ+VISW+VQRGYIVLPKSV+ ERI+AN  T  L+ E+   +NNISK +G +R
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 310 IVQPHWEPFVPFV 322
           I+ P WEPF PFV
Sbjct: 301 IIDPDWEPFKPFV 313

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  444 bits (1142), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 207/306 (67%), Positives = 249/306 (81%), Gaps = 1/306 (0%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75
           +ST T  LNTGA I  VGLGTWQS  +N+ Y++V+AALK GYRHIDTAAIY NE QVG+A
Sbjct: 7   DSTRTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQA 65

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
           I DSGVPRE+IFVTTKLW TQHH+PA  L+ SL+RLGLDYVDLYLMHWPV L+P  IKDG
Sbjct: 66  IRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDG 125

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195
           N LS+P   DG R V+I  W+++KTWELMQELPKTGK +AVGVSNFSINNLK +L+S GN
Sbjct: 126 NILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKGN 185

Query: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255
           K+ PA NQVEIHPLLPQ EL+++C  KGI++E YSPLGST+AP+L EPV++ +AKK+ VQ
Sbjct: 186 KLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNVQ 245

Query: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315
            A +VISWH QRGY+VLPKSV+ +R++AN K   LSDE+   IN ISK KGE+R+V P+W
Sbjct: 246 PAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVHPNW 305

Query: 316 EPFVPF 321
            PF  F
Sbjct: 306 SPFEAF 311

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  443 bits (1139), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 205/306 (66%), Positives = 251/306 (82%), Gaps = 1/306 (0%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75
           +ST T  LNTGA I  VGLGTWQS  +N+ Y++V+AALKAGY+HIDTAAIY NE QVG+A
Sbjct: 7   DSTKTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQA 65

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
           I DSGVPREEIFVTTKLWSTQHH+PA  L++SL+RLGLDYVDLYL+HWP  L+   IKDG
Sbjct: 66  IKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDG 125

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195
           + LS+P   DG R V++  W+++KTWELMQELPKTGKT+A+GVSNFSINNLK +L+SPGN
Sbjct: 126 DILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPGN 185

Query: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255
           K+ PA NQVEIHPLLPQ EL+ +C SK I++EAYSPLGST+AP+L EP ++ +AKK+ VQ
Sbjct: 186 KLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKNNVQ 245

Query: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315
              +VISWH QRGY+VLPKSV+ +RI+ N K   LS+E+   INNISKEKGE+R+V P+W
Sbjct: 246 PGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVNPNW 305

Query: 316 EPFVPF 321
            PF  F
Sbjct: 306 SPFEAF 311

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  438 bits (1126), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 207/306 (67%), Positives = 247/306 (80%), Gaps = 1/306 (0%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75
           +ST    LNTGA I  +GLGTWQS  EN+ Y+AV+ ALK GYRHIDTAAIY NE QVG+A
Sbjct: 7   DSTKILSLNTGAQIPQIGLGTWQS-KENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQA 65

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
           I DSGVPREEIFVTTKLW TQHH+P   L+ SLKRLGLDYVDLYLMHWP  L+P  IK+ 
Sbjct: 66  IKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNE 125

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195
           + LS+P   DG R V+I  W+++KTWELMQELPKTGKT+AVGVSNFSINNLK +L+S GN
Sbjct: 126 DILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGN 185

Query: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255
           K+ PA NQVEIHPLLPQ+EL+ +C SKGI++EAYSPLGST+AP+L EPV++ +AKK+ VQ
Sbjct: 186 KLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNNVQ 245

Query: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315
              +VISWHVQRGY+VLPKSV+ +RI+ N K   LS E+   INNISKEKGE+R+V P+W
Sbjct: 246 PGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVHPNW 305

Query: 316 EPFVPF 321
            PF  F
Sbjct: 306 SPFEVF 311

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  436 bits (1122), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 205/310 (66%), Positives = 246/310 (79%), Gaps = 1/310 (0%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ 71
           MS  NST T KLNTGA I  VGLGTW+S   N+GY++V+AALK GYRHID AAIYGNE Q
Sbjct: 1   MSLKNSTATLKLNTGAEIPVVGLGTWRSA-ANDGYDSVLAALKLGYRHIDAAAIYGNEDQ 59

Query: 72  VGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRS 131
           VG+AI DSGVPR+EIF+TTKLW T+H +PA  L+ SLKRLGLDYVDLYLMHWPV L    
Sbjct: 60  VGRAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHG 119

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
            ++ + L+IP  PDGK D++I+ WD++KTWELMQELPKTGKT+A+GVSNFSINNLK + +
Sbjct: 120 SEEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKN 179

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
           SP    VPA NQVEIHPL PQ EL+E+C S+ IL+EAYSP GS +AP+L EP L  LA+K
Sbjct: 180 SPKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEK 239

Query: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIV 311
           + + TAQ++ISW VQRGY+VLPKSVHAERI+AN K L L DE+M  I N+SK KGE+R+V
Sbjct: 240 YNISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLV 299

Query: 312 QPHWEPFVPF 321
           Q  W PF  F
Sbjct: 300 QLDWSPFPTF 309

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  428 bits (1101), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 204/306 (66%), Positives = 244/306 (79%), Gaps = 2/306 (0%)

Query: 17  STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI 76
           +T+T KLNTGA I  +GLGTWQS+ ENEGY A + ALKAGYRHIDTAAIY NE ++G+AI
Sbjct: 7   NTSTLKLNTGAHIPVIGLGTWQSS-ENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAI 65

Query: 77  NDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136
            DS +PR E+FVTTKLW TQH +P   L+ SLKRLGLDYVDLYLMHWPV L    IKDGN
Sbjct: 66  RDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGN 125

Query: 137 FLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNK 196
            L IP   DG RDV+++ W++VKTWELMQELPK  K RA+GVSNFSINNLK++L+S GNK
Sbjct: 126 LLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSKGNK 184

Query: 197 VVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQT 256
           VVPA NQ+EIHPLLPQ+EL+ +C  KGI+LEAYSPLGST+APIL E  +  +AKK+GV  
Sbjct: 185 VVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGVNA 244

Query: 257 AQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHWE 316
            Q+VISWH QRGY+VLPKSV  ERI  N +T KLSDE+   ++N +K+ GERR+V P+W 
Sbjct: 245 GQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPNWG 304

Query: 317 PFVPFV 322
           PF PFV
Sbjct: 305 PFKPFV 310

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  421 bits (1083), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 243/306 (79%), Gaps = 1/306 (0%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75
           NS T   LN G  I +VGLGTW+S  EN+GY +VI ALKAGYRHIDTAAIY NEG+VG+A
Sbjct: 7   NSDTYVTLNNGEKIPSVGLGTWKS-QENDGYNSVIYALKAGYRHIDTAAIYRNEGEVGRA 65

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
           I DSGVPR++IF+TTKLW T+  +P   L  SLKRLGLDYVDLYLMHWPV LNPR IKD 
Sbjct: 66  IKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPRYIKDD 125

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195
           ++L +P LPDG RDV+++TWDY+KTWEL+QELP TG TR+VGVSNFSINNL+KVLSSPGN
Sbjct: 126 DYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVLSSPGN 185

Query: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255
           K+ PAVNQVE+HPLLPQ EL ++C SK I LEAYSP GS NAP L +  ++++A K+GV 
Sbjct: 186 KLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAAKNGVS 245

Query: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315
            AQ++ SW VQR  +VLPKSVH ER+ +NFK   LS E++ EI+ ++K  GE+RI +P W
Sbjct: 246 PAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRINKPDW 305

Query: 316 EPFVPF 321
           +PF  F
Sbjct: 306 DPFPVF 311

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  420 bits (1079), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 195/306 (63%), Positives = 243/306 (79%), Gaps = 1/306 (0%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75
           NS+ T KLNTGA+I  +G GTW+S  +N GY +VIAALKAGYRHID AAIY NE +VGKA
Sbjct: 7   NSSATLKLNTGASIPVLGFGTWRSV-DNSGYHSVIAALKAGYRHIDAAAIYLNEEEVGKA 65

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
           I DSGVPREEIF+TTKLW T+  DP A L+ SLKRLGLDYVDLYLMHWPV L   +I DG
Sbjct: 66  IKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTDTITDG 125

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195
           +FL IP L DG  DV+   W++VKTW+LMQ+LPKTGKT+AVGVSNFSINN+K++L SP N
Sbjct: 126 DFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELLKSPSN 185

Query: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255
           K+VPA NQ+EIHPLLPQ+EL+ +C  KGI++EAYSP GS NAP+L E  +I++AKKHGV+
Sbjct: 186 KLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVE 245

Query: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315
            AQ++ISW +QRGY+VL KSV+ ER+ +NFK   L +++ + I+N+SK  GE+R+V   W
Sbjct: 246 PAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRVVNMQW 305

Query: 316 EPFVPF 321
             F  F
Sbjct: 306 NSFPIF 311

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  418 bits (1074), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 244/311 (78%), Gaps = 2/311 (0%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ 71
           MS  N  T  KLNTGA + AVGLGTWQS  EN+ Y+AV+ ALK GYRHID AAIY NEG+
Sbjct: 1   MSLKNCETRVKLNTGAELPAVGLGTWQSL-ENDAYKAVLTALKTGYRHIDGAAIYCNEGE 59

Query: 72  VGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRS 131
           VGKAI DSGVPR EIFVTTKLW TQ   P   L  SL+RLGLDYVDLYL+HWP+ LNP  
Sbjct: 60  VGKAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQ 119

Query: 132 IKD-GNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVL 190
            ++ GN+L+ P LP+GKRDV++DTW++VKTWELMQELP TGK +AVGVSNFSINN+K++L
Sbjct: 120 CEESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELL 179

Query: 191 SSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAK 250
           SSPGNK+VPAVNQ+E+HPLLPQ EL+ +C  KGI++EAYSPLG T A IL EP++  LAK
Sbjct: 180 SSPGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAK 239

Query: 251 KHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRI 310
           K+ +  A +V+SW VQRG +VLPKSV   RI +N +TL L+ E++ +I N+SKEKGE+R 
Sbjct: 240 KYNIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRT 299

Query: 311 VQPHWEPFVPF 321
             P + PF  F
Sbjct: 300 CAPDFSPFNTF 310

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  417 bits (1072), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 195/306 (63%), Positives = 240/306 (78%), Gaps = 1/306 (0%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75
           NS+ T KLNTGA+I  +G GTW+S  +N GY +VIAALKAGYRHID AAIY NE +VG+A
Sbjct: 7   NSSATLKLNTGASIPVLGFGTWRSV-DNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRA 65

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
           I DSGVPREEIF+TTKLW T+  DP A LN SLKRLGLDYVDLYLMHWPV L    + DG
Sbjct: 66  IKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDG 125

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195
           N L IP L DG  D++   W+++KTWELMQELPKTGKT+AVGVSNFSINN+K++L SP N
Sbjct: 126 NVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNN 185

Query: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255
           KVVPA NQ+EIHPLLPQ+EL+ +C  KGI++EAYSP GS NAP+L E  +I++AKKHGV+
Sbjct: 186 KVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVE 245

Query: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315
            AQ++ISW +QRGY+VL KSV+ ERI +NFK   L +++ + I+N+SK  G +R+V   W
Sbjct: 246 PAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKW 305

Query: 316 EPFVPF 321
             F  F
Sbjct: 306 GSFPIF 311

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  417 bits (1072), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 195/306 (63%), Positives = 240/306 (78%), Gaps = 1/306 (0%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75
           NS+ + KLNTGA+I  +G GTW+S  EN GY +VIAALKAGYRHID AAIY NE +VG+A
Sbjct: 7   NSSASLKLNTGASIPVLGFGTWRSV-ENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRA 65

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
           I DSGVPRE+IF+TTKLW T+  DP A LN+SLKRLGLDYVDLYLMHWPV L   +I DG
Sbjct: 66  IKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITDG 125

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195
           N L IP L DG  DV+   W+++KTW+LMQELPKTGKT+AVGVSNFSINN+K +L SP N
Sbjct: 126 NVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSN 185

Query: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255
           K+VPA NQ+EIHPLLPQ EL+ +C  KGI++EAYSP GS NAP+L E  +I++AKKHGV 
Sbjct: 186 KLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGVA 245

Query: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315
            AQ++ISW +QRGY+VL KSV+ ERI +NFK   L +++ + I+N+SK  GE+R+V   W
Sbjct: 246 PAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDMKW 305

Query: 316 EPFVPF 321
             F  F
Sbjct: 306 SSFPIF 311

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  415 bits (1066), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 192/306 (62%), Positives = 241/306 (78%), Gaps = 1/306 (0%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75
           NS+ T KLNTGA+I A+G GTW+S  +N GY +VIAALK GYRHID AAIY NE +VG+A
Sbjct: 7   NSSATLKLNTGASIPALGFGTWRSV-DNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRA 65

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
           I DSG+ REEIF+TTKLW T+  DP A LN+SLKRLGLDYVDLYLMHWPV L   ++ DG
Sbjct: 66  IKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDG 125

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195
           N L IP L DG  DV+   W+++KTW+LMQELPKTGKTRAVGVSNFSINN+K++L SP N
Sbjct: 126 NVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPSN 185

Query: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255
           K+VPA NQVEIHPLLPQ+EL+ +C  KGI++EAYSP GS NAP+L E  +I++AKKHGV+
Sbjct: 186 KLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVE 245

Query: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315
            +Q++ISW +QRGY+VL KSV+ ER+ +NFK   L +++ + I ++SK  GE+R+V   W
Sbjct: 246 PSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVNMKW 305

Query: 316 EPFVPF 321
             F  F
Sbjct: 306 ASFPIF 311

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  414 bits (1063), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 238/311 (76%), Gaps = 6/311 (1%)

Query: 17  STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI 76
           S    KL+TGA+I  +GLGTW+S   N+ Y +VIAALK GYRHIDTAAIYGNE QVGKAI
Sbjct: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66

Query: 77  NDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136
            DSGVPR EIFVT+KLW  Q HDP   LN +LKRLGLDY+DLYLMHWPVT NPRSIKD +
Sbjct: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126

Query: 137 -----FLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
                F++IP   +G  DVE+DTW+++KTWELMQ LP++GKT+AVGVSNFSINNL  +L+
Sbjct: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
           +   KVVPA NQ+E+HPLL Q ELL++C  K IL+EAYSP GS NAPIL +  +  +AKK
Sbjct: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246

Query: 252 HGVQTAQIVISWHVQR-GYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRI 310
             +Q  Q+V+SWH+QR GY+VLPKSVH ERI AN K + L DE+ + INN+ KEKGE R+
Sbjct: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306

Query: 311 VQPHWEPFVPF 321
           V P W PF  F
Sbjct: 307 VDPDWSPFPLF 317

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  409 bits (1050), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 188/306 (61%), Positives = 247/306 (80%), Gaps = 1/306 (0%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75
           NS+ T KLNTGA I  +GLGTW+S++E E Y +V++A+K GYRHID+AAIYGNE  VGKA
Sbjct: 7   NSSATVKLNTGAIIPQLGLGTWRSSDE-EAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKA 65

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
           I DSGVPR E+FVTTKLW TQ  +P   L+ SLKRLGLDYVDLYL+HWP+     +IKD 
Sbjct: 66  IRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDD 125

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195
           ++L++P   DGK DV++  W++VKTWEL+QELP TGK +AVGVSNFS+NNLK++L+SPGN
Sbjct: 126 DYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPGN 185

Query: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255
           K+VPA NQVE+HPLLPQ+EL+E+  SKGI++EAYSPLGS  +P+L EPV+I +AKK+GV+
Sbjct: 186 KLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGVE 245

Query: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315
            AQ++I+W +QRGY++LPKSV+ +R+++NFK   LS E++  I+ ISKE+G +R V P W
Sbjct: 246 PAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPDW 305

Query: 316 EPFVPF 321
             F  F
Sbjct: 306 PSFPIF 311

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  409 bits (1050), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 201/305 (65%), Positives = 244/305 (80%)

Query: 17  STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI 76
           ST T KLNTGA I  + LGTW+S    +GY++VIAALKAGYRHIDTAAIYGNE QVGKAI
Sbjct: 8   STATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAI 67

Query: 77  NDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136
            DSG+PREEIFVT+KLW+TQ H+PA  L D+L RLGLDY+DLYLMHWPVT N R++K  +
Sbjct: 68  RDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGTD 127

Query: 137 FLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNK 196
           F+ IP   +GK D+E+DTW++VKTWELMQELP TG T+AVGVSNFSINNLK++L+SPGNK
Sbjct: 128 FMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSPGNK 187

Query: 197 VVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQT 256
           + PA NQ+EIHPLLP+ +L+++C  KGI++EAYSPLGS NAPIL EP +I ++KK  V  
Sbjct: 188 LTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKLDVPP 247

Query: 257 AQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHWE 316
           AQ++ISWHVQRGY+VL KS H ERI AN K   LS E+   I N++KEKG  R+V P W 
Sbjct: 248 AQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVVDPDWS 307

Query: 317 PFVPF 321
           PF  F
Sbjct: 308 PFPLF 312

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 186/296 (62%), Positives = 233/296 (78%), Gaps = 2/296 (0%)

Query: 26  GATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAINDSGVPREE 85
           GA++  +GLGTW++T++ EGY AV +AL+AGYRHIDTAAIY NE  VG+AI +SG+PR+E
Sbjct: 17  GASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNEEVVGRAIRESGIPRDE 76

Query: 86  IFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPD 145
           IFVTTKLW TQH DPAA L+ SL+RLGLDYVDLYLMHWPV +  +  K  + L  P  PD
Sbjct: 77  IFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEAKYSKSSSLLEFPYRPD 136

Query: 146 GKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNKVVPAVNQVE 205
           G   VE D WD++KTWELMQELPKT KTRA+GVSNFSINN+  +L SPGNK+VPA NQVE
Sbjct: 137 GSLAVESD-WDFIKTWELMQELPKT-KTRAIGVSNFSINNINDLLKSPGNKIVPAANQVE 194

Query: 206 IHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQTAQIVISWHV 265
           +HPLLPQ EL+ +C  KGI++EAYSP GS +AP+L+E  +I +AKKH V  AQ+++SWH+
Sbjct: 195 LHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVAKKHDVSAAQVILSWHI 254

Query: 266 QRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHWEPFVPF 321
           +RG  VLPKSVH ER+ +NFKT  L +++   INN+SKEKGE+R+V   W PF  F
Sbjct: 255 KRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKRVVNFDWSPFKIF 310

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  400 bits (1028), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 191/312 (61%), Positives = 236/312 (75%), Gaps = 4/312 (1%)

Query: 12  MSAS--NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNE 69
           MSA+  N T T KLNTGA I A+GLGTW+S N N+GY++VIAA K GYRHIDTAAIYGNE
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRSEN-NDGYDSVIAAAKVGYRHIDTAAIYGNE 59

Query: 70  GQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNP 129
            QVGKAIN+ GV R E+FVTTKLW TQ  DP   LN SLKRLGLDYVDLYL+HWPV    
Sbjct: 60  DQVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKT 119

Query: 130 RSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKV 189
            +IKDGN L+IP   DG+ D++   W+++KTWELMQ L KTGKT+A+G+SNFSINN+K++
Sbjct: 120 DTIKDGNLLTIPK-KDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKEL 178

Query: 190 LSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLA 249
           L++P   V PA NQVE+HPLLPQ+EL+ +C  KGI++EAYSPLG  NAP+L +  +I +A
Sbjct: 179 LAAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIA 238

Query: 250 KKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERR 309
           K++ V   Q+V SWHVQRGY+VLPKSV   RI +N KT  LSD++M +INN+ K KGE R
Sbjct: 239 KRNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENR 298

Query: 310 IVQPHWEPFVPF 321
                 + F  F
Sbjct: 299 TCDLGIKGFPMF 310

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  397 bits (1020), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 243/313 (77%), Gaps = 5/313 (1%)

Query: 12  MSAS--NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNE 69
           MSA+  NST T KLN G+ I  VGLGTWQ+T+E + Y AV AAL AGYRHIDTAAIY NE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 70  GQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNP 129
            QVG+AI DSGVPREEIFVTTKLW+ QHH+P   L++SL+RLGLDYVDLYLMHWPV+L+ 
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 130 RSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKV 189
             +K+   L +   PDG R VE D W ++ TWELMQ+LPK  K R++GVSNFS+NNLK +
Sbjct: 121 SYMKESP-LELMKRPDGTRPVETD-WTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177

Query: 190 LSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLA 249
           L +P   VVP +NQVE+HPLLPQ EL+++C    I +EAYSPLGST+AP+L+EP++I++A
Sbjct: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237

Query: 250 KKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERR 309
           KK+GVQ A +V+SW VQR  IVLPKSVHAER+ AN KT  L +E+   I  IS+++GERR
Sbjct: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297

Query: 310 IVQPHWEPFVPFV 322
           I  P++EPF  FV
Sbjct: 298 INNPNFEPFKTFV 310

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  394 bits (1011), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 239/312 (76%), Gaps = 3/312 (0%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ 71
           M+ SNST    LN G  +  VGLGTWQS  EN+ Y+AV+AALKAGYRHIDTAAIYGNE +
Sbjct: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQS-KENDAYKAVVAALKAGYRHIDTAAIYGNEEE 59

Query: 72  VGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLN-PR 130
           VG+AI DSGV R EIFVTTKLW TQH  P   LN SL+RLGLDYVDLYLMHWPV +N  +
Sbjct: 60  VGRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQ 119

Query: 131 SIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVL 190
             KD N+L IP+  DG RD+++ +WD++KTWELMQ LPK+ K +++GVSNFSINN+K +L
Sbjct: 120 CKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLL 178

Query: 191 SSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAK 250
           +SPGNK VP VNQVE+HPLLPQ EL+E+C SK I++EAYSPLGST APIL    +  ++K
Sbjct: 179 ASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSK 238

Query: 251 KHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRI 310
           K  +  A +V SW +QR  +VLPKSV   RI +N +T++L  EE  ++NNIS E GE+R 
Sbjct: 239 KLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRS 298

Query: 311 VQPHWEPFVPFV 322
           V+P+W PF+PFV
Sbjct: 299 VKPNWTPFIPFV 310

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  392 bits (1006), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 193/312 (61%), Positives = 234/312 (75%), Gaps = 4/312 (1%)

Query: 12  MSA--SNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNE 69
           MSA  SN+T+T KLNTG TI  VGLGTW+S  E +GY+AV AALKAGYRHID AAIY NE
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRS-KEGDGYKAVTAALKAGYRHIDGAAIYLNE 59

Query: 70  GQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNP 129
            +VGKAI DSG+PREE+F+TTKLW+TQ  +P   L  SL+RLGL+YVDLYLMHWPV L  
Sbjct: 60  EEVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKT 119

Query: 130 RSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKV 189
           + I DGN LS P   DGK DV+ + WD+VKTWELMQELPKT K R+VGVSNFSINNLK++
Sbjct: 120 KRITDGNLLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178

Query: 190 LSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLA 249
           L+SPGNK+VPAV QVEIHPLLPQ  L ++C    I +EAYSPLG   AP+L +P++  +A
Sbjct: 179 LASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIA 238

Query: 250 KKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERR 309
            +H      +V+SW VQRG + LPKS   ER+ +N +T KLSDEEM  INN+SK +G++R
Sbjct: 239 DRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKR 298

Query: 310 IVQPHWEPFVPF 321
              P   PF  F
Sbjct: 299 TNAPDMSPFPLF 310

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  391 bits (1005), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 238/310 (76%), Gaps = 1/310 (0%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ 71
           MS SN + + KLNTGA+I  VGLGTW+S  E + Y AV++AL+ GYRHIDTAAIYGNE  
Sbjct: 1   MSTSNESPSLKLNTGASIPVVGLGTWKSPEE-DAYNAVVSALQNGYRHIDTAAIYGNEEA 59

Query: 72  VGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRS 131
           VGK I DSGVPREEIFVTTKLW TQ  DP A L+ SL+RLGLDYVDLYL+HWPV LN  S
Sbjct: 60  VGKGIRDSGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASS 119

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
           I DGN+L+ P   DGK D++I+ W+++KTWE MQ LPK+GKT+A+GVSNFSI N++ +L+
Sbjct: 120 ITDGNYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLA 179

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
           +  + +VPA NQ+EIHP LPQ EL+++C SKGIL+EAYSPLGS+++ ILT+P +  +A K
Sbjct: 180 ANPDFIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASK 239

Query: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIV 311
           +  + A I+ISW   RGY+VLPKSV+ +RI+ N K L LS E++ +IN +++  G +R V
Sbjct: 240 YNAEPANILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYV 299

Query: 312 QPHWEPFVPF 321
            P + PF  F
Sbjct: 300 APDFSPFAIF 309

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  390 bits (1003), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 233/303 (76%), Gaps = 2/303 (0%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75
           N+T   KLNTGATI  +G GTW+ST E EGY AV++A+K GYRHID+AA+YGNE  VG+A
Sbjct: 6   NNTDIGKLNTGATIPLLGFGTWRSTEE-EGYNAVLSAIKDGYRHIDSAAVYGNEAAVGRA 64

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
           I DSGVPREE+FVTTKLW+TQ  +PA  L+ SL+RLGLDYVDLYL+HWP+ +    I DG
Sbjct: 65  IRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTDRITDG 124

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195
           N  SIP   DGK DV+ + WDY+KTW+LMQELP TGKTRAVGVSN S++ L+K+L+  GN
Sbjct: 125 NLFSIPTKEDGKPDVDTE-WDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADKGN 183

Query: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255
           KVVPAV QVE HPLLPQ +LL++C    ILLEAYSPLGS  +P++ EPV+  +AKK+   
Sbjct: 184 KVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKYNAD 243

Query: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315
            AQI+ISW ++RGY+VLPKSV   RI++N +TL L DE+  +IN +  EKGE+R+  P W
Sbjct: 244 PAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRVNDPEW 303

Query: 316 EPF 318
             F
Sbjct: 304 FTF 306

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  389 bits (1000), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 181/302 (59%), Positives = 237/302 (78%), Gaps = 1/302 (0%)

Query: 17  STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI 76
           +T   ++NTG  I  +GLGTW++ +  + Y AV+AAL++GYRHIDTAAIY NE  VG+AI
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAAD-GDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAI 60

Query: 77  NDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136
            DSGVPRE+IFVTTKLW TQ  DP + LN SL+RLGLDYVDLYLMH+PV L    IKDGN
Sbjct: 61  RDSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGN 120

Query: 137 FLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNK 196
            LSIP+  DG RDV+ID W +VKTW+LMQ+LPK+GKT+A+GVSNFSI N++++L      
Sbjct: 121 VLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGL 180

Query: 197 VVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQT 256
            VPA NQ+EIHP LPQ+EL+E+C SKGI++EAYSPLGS+ + +LT+P LI LA+KH V+ 
Sbjct: 181 SVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEP 240

Query: 257 AQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHWE 316
           AQI+ISW V RGY +LPKSV+++R+Q+N K +KLS  ++++I+ I ++ G +R V P W 
Sbjct: 241 AQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWA 300

Query: 317 PF 318
           PF
Sbjct: 301 PF 302

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  389 bits (1000), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 181/302 (59%), Positives = 237/302 (78%), Gaps = 1/302 (0%)

Query: 17  STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI 76
           +T   ++NTG  I  +GLGTW++ +  + Y AV+AAL++GYRHIDTAAIY NE  VG+AI
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAAD-GDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAI 60

Query: 77  NDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136
            DSGVPRE+IFVTTKLW TQ  DP + LN SL+RLGLDYVDLYLMH+PV L    IKDGN
Sbjct: 61  RDSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGN 120

Query: 137 FLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNK 196
            LSIP+  DG RDV+ID W +VKTW+LMQ+LPK+GKT+A+GVSNFSI N++++L      
Sbjct: 121 VLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGL 180

Query: 197 VVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQT 256
            VPA NQ+EIHP LPQ+EL+E+C SKGI++EAYSPLGS+ + +LT+P LI LA+KH V+ 
Sbjct: 181 SVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEP 240

Query: 257 AQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHWE 316
           AQI+ISW V RGY +LPKSV+++R+Q+N K +KLS  ++++I+ I ++ G +R V P W 
Sbjct: 241 AQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWA 300

Query: 317 PF 318
           PF
Sbjct: 301 PF 302

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  388 bits (997), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 236/310 (76%), Gaps = 2/310 (0%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ 71
           ++  NST+T KLNTG TI  VGLGTW+S  ENEGY+AVI ALKAGYRHID AA+YGNEG+
Sbjct: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRS-KENEGYKAVIEALKAGYRHIDGAAVYGNEGE 60

Query: 72  VGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRS 131
           VGKAI DSGVPR EIF+TTKLW TQ  +P   L+ SL+RLGLDYVDLYL+HWPV L   +
Sbjct: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
           IKDGN       PDG +DV+++ W+++KTWELMQ+L ++GKT+A+GVSNFS+NNLK +L+
Sbjct: 121 IKDGNLFQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
           +P  KV PAVNQVE+HPLLPQE+L+++    GI++EAYSPLG  NAPIL++P +  +AK 
Sbjct: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239

Query: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIV 311
           +GV+   +VISW VQ+G + LPKSV   RI  N K L LSD ++ +++ + K KGERR  
Sbjct: 240 NGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTC 299

Query: 312 QPHWEPFVPF 321
              + PF  F
Sbjct: 300 YQDFSPFPIF 309

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  387 bits (995), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 232/304 (76%), Gaps = 2/304 (0%)

Query: 15  SNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGK 74
           +NS+   KL TGATI  +G GTW+ST E +GY AV+ ALK GYRHIDTAA+YGNE  VG+
Sbjct: 5   TNSSAVGKLRTGATIPLLGFGTWRSTEE-DGYNAVLTALKVGYRHIDTAAVYGNEAAVGR 63

Query: 75  AINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKD 134
           AI DSGVPR+++FVTTKLW+TQH DP   L+ SL+RLGLDYVDLYL+HWP+ L  + I D
Sbjct: 64  AIRDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITD 123

Query: 135 GNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPG 194
           GN  ++P   DGK DV+ + W YVKTWE+MQ+LP T KTRAVGVSNFS+  L+ +L++ G
Sbjct: 124 GNLFTVPTKEDGKPDVD-EQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASG 182

Query: 195 NKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGV 254
            KV+PAVNQVE HPLLPQ++L ++C    ILLEAYSPLGS  +P++ EP +  +A KH  
Sbjct: 183 TKVIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNA 242

Query: 255 QTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPH 314
             AQ++ISW ++RGY++LPKSV   RI++NFK + L+D++  +INNI KEKGE+RI  P 
Sbjct: 243 DPAQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPD 302

Query: 315 WEPF 318
           W  F
Sbjct: 303 WFHF 306

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  374 bits (961), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 232/308 (75%), Gaps = 2/308 (0%)

Query: 15  SNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGK 74
           S  T +FKLNTGA + A+GLGTW+S+ E+  Y AV++ALKAGY+HIDTAAIY NE  VGK
Sbjct: 5   STKTPSFKLNTGALLPAIGLGTWKSSEED-AYTAVLSALKAGYKHIDTAAIYRNERAVGK 63

Query: 75  AINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKD 134
           AI DSG+PR+E+F+TTKLWSTQH DP A L+ SL+RLGLDYVDLYL+H+PV      I+D
Sbjct: 64  AIRDSGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDRIED 123

Query: 135 GNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPG 194
           GN    PLLP+GKRDV+I  WD+VKTW L+Q LP++GK +AVGVSNFSINNLK +L S  
Sbjct: 124 GNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLESDE 183

Query: 195 NKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK-HG 253
              VPAVNQVEIHP LPQ EL+++C SK I++EAYSPLGST + +LT+  L  +A+K   
Sbjct: 184 KFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKXXD 243

Query: 254 VQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQP 313
            Q AQI+I+W + RGY VLPKSV  +RI+AN + + +  E++ ++ N+    G +R ++P
Sbjct: 244 AQPAQILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRYLEP 303

Query: 314 HWEPFVPF 321
            W PF  F
Sbjct: 304 DWSPFPIF 311

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  373 bits (958), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 174/307 (56%), Positives = 226/307 (73%), Gaps = 2/307 (0%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ 71
           ++A N   T+ +     I AV LGTW++   NE Y AV+ ALKAGYRHID AAIY NE +
Sbjct: 3   VTAKNCDITYAIGKDTKIPAVALGTWKAA-PNEVYTAVLEALKAGYRHIDGAAIYCNEEE 61

Query: 72  VGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRS 131
           VGKAI DSG+PR++IFVTTKLW T+  +P   L+ SLKRLGLDYVDLYLMHWPV L   S
Sbjct: 62  VGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKADS 121

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
           I D + L+IP LP GK D++I+ W+++KTWELMQELP T K +A+GVSNFSINNL ++L+
Sbjct: 122 ITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELP-TSKAKAIGVSNFSINNLNELLA 180

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
           +P  K +PA NQ EIHPLLPQ EL+++C  K I++EAY PLG +N P++T PV+  +A K
Sbjct: 181 APTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIATK 240

Query: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIV 311
            GV   Q++ISW +QRGY+VLPKSV  ERI  NF+T+ +  EE  ++NN++KE G +R V
Sbjct: 241 LGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRSV 300

Query: 312 QPHWEPF 318
              + PF
Sbjct: 301 NIDFSPF 307

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  370 bits (950), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 230/308 (74%), Gaps = 4/308 (1%)

Query: 12  MSASN-STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEG 70
           MSA   ST+  KLNTGA+I  VGLGT+ S +E  GY+AV+ A+K GYRHID AA+Y NE 
Sbjct: 1   MSAPKPSTSVGKLNTGASIPLVGLGTYLSEDET-GYKAVLHAIKVGYRHIDCAALYKNED 59

Query: 71  QVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPR 130
            VG+AI DSGVPREE+FVTTK+W+TQH +PA  L +SL RLGLDYVDL+LMHWP  L   
Sbjct: 60  FVGRAIRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTE 119

Query: 131 SIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVL 190
            I DGN +++P   D K DV+ + W+Y+KTW LMQ+LP +GKT+AVGVSNFS+  L+K+L
Sbjct: 120 RITDGNMITVPKREDEKPDVDTE-WNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLL 178

Query: 191 SSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAK 250
           + PG+KVVPA NQVE+HPLLPQ  L ++C  K I+L AYSPLGS  AP+L +PV++ +A 
Sbjct: 179 ADPGSKVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAA 238

Query: 251 KHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRI 310
           KH    AQI+I W V+RGY+ LPKSV   RI++N + + L+D E+ +IN I K KGE+R+
Sbjct: 239 KHKADPAQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHK-KGEKRV 297

Query: 311 VQPHWEPF 318
           V P W  F
Sbjct: 298 VDPEWFDF 305

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  367 bits (943), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 175/302 (57%), Positives = 223/302 (73%), Gaps = 2/302 (0%)

Query: 17  STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI 76
            T T KLNTGA I  +GLGTW+ST EN GY A +AA+KAGYRHID AA+  NE  VG+AI
Sbjct: 8   CTATAKLNTGAQIPLLGLGTWRSTKEN-GYNATLAAIKAGYRHIDIAAVCMNEQVVGRAI 66

Query: 77  NDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136
            DSGVPREE+FVTTKLW TQH DP   L+ SLKRLGLDYVDLY+MHWPV      +K  N
Sbjct: 67  RDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTN 126

Query: 137 FLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNK 196
           ++ IP   DG+ DV+ + WDYVKTWELMQELP TGKT A+GV+NFS++ LKK++ SPGNK
Sbjct: 127 YMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGNK 185

Query: 197 VVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQT 256
           +VPA +Q+E HP LPQ ++L +C    IL+EAYSPLGS  AP+L EPV+  ++KK  V+ 
Sbjct: 186 IVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVEP 245

Query: 257 AQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHWE 316
           AQ+++SW +QRG+ VL KS    RI+AN  T  + + ++R IN +++E+G +RI  P W 
Sbjct: 246 AQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPTWF 305

Query: 317 PF 318
            F
Sbjct: 306 SF 307

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  352 bits (903), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 227/310 (73%), Gaps = 2/310 (0%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ 71
           ++  N T T  LN G  I  +GLGT+ S  +NE YEAV+ A KAGYRH+DTAA Y NE Q
Sbjct: 3   VTLKNCTETITLNNGTKIPVIGLGTYLS-KQNEVYEAVVTAAKAGYRHVDTAAFYKNEEQ 61

Query: 72  VGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRS 131
           VGKA+ D GVPR E++VTTK+W T+  DP A L+ SLKRLGL+Y+DLYLMHWPVTL   +
Sbjct: 62  VGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTDT 121

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
           IKDG  + IP LPDG  DV+ D W +V+ WE MQ+L K+GK +++GVSNFSINN+K++L+
Sbjct: 122 IKDGELMCIPRLPDGNADVDKD-WTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELLA 180

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
           +P   VVP VNQVE+ PLLP +EL+E+C SK I+ +AY P G + AP++ +  ++ +AK 
Sbjct: 181 APTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAKG 240

Query: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIV 311
           +GV   Q++ SWHVQRGY+VLPKSV   RI +N KT  LSD +M ++NNISK +GE+R+ 
Sbjct: 241 NGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRLN 300

Query: 312 QPHWEPFVPF 321
             ++ PF  F
Sbjct: 301 NVNFSPFPIF 310

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  347 bits (891), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 169/303 (55%), Positives = 219/303 (72%), Gaps = 3/303 (0%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75
             T T  LNTGA I  +GLGTW+ T E  GY+A++AALKAGYRHID+AA+  NE  +GKA
Sbjct: 7   KCTATATLNTGAKIPLLGLGTWRLTKEG-GYKAILAALKAGYRHIDSAAVCMNEQVIGKA 65

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
           I DSGV R+E+FVTTKLWSTQH DP+A L+ SLKRLGL+YVDLY+MHWP+      IK  
Sbjct: 66  IRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKAK 125

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195
           NF+ IP   +GK  V+ D WDYVKTWELMQ+LP T KTRA+GV+NFS+  L  +L SP N
Sbjct: 126 NFMLIPRNSEGKPYVDTD-WDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLKSPNN 183

Query: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255
           K++PA +Q+E HP LP +E+L +C  KGIL+EAYSPLG    P++ EPV+  ++KK  V+
Sbjct: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243

Query: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315
            AQ++ISW ++RG  VLPKS    RI++N +   LSDE+   I+ I++E+G +R   P W
Sbjct: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPW 303

Query: 316 EPF 318
             F
Sbjct: 304 FSF 306

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  341 bits (875), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 220/309 (71%), Gaps = 3/309 (0%)

Query: 13  SASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQV 72
           S S    + KLNTGA+I  +G GTW S++  + Y AVI ALK GYRHID AA+YGNE  V
Sbjct: 3   SPSGEFPSLKLNTGASIPQLGFGTWPSSHA-DAYTAVITALKTGYRHIDAAAMYGNEAAV 61

Query: 73  GKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSI 132
           GK I DSG+PREEIFVTTKLW+TQ  DPA+ L++SL+RLGLDYVDL+L+HWPV L P   
Sbjct: 62  GKGIRDSGIPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPVGG 121

Query: 133 KDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSS 192
            + N L  P  P  K  ++ + W ++KTWELMQ LPKTGKTRAVGVSNFSI NL+ +L+S
Sbjct: 122 PE-NLLKYPT-PGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNS 179

Query: 193 PGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKH 252
             + +VPAVNQ EIHP LPQ EL+ +C SKGI++EAY PLGS+++ +L++P +  +A K+
Sbjct: 180 SPDVLVPAVNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKY 239

Query: 253 GVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQ 312
            V+ A ++I+W + RGY VLPKS    RI +N   + LS E+   I  +S+  G +R V 
Sbjct: 240 HVKPANVLINWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVH 299

Query: 313 PHWEPFVPF 321
           P +EP+  F
Sbjct: 300 PDFEPYPLF 308

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  315 bits (806), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 162/307 (52%), Positives = 220/307 (71%), Gaps = 6/307 (1%)

Query: 17  STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI 76
           ST T  LNTGA I   GLGTWQST+++    AV AALK GY+HIDTA+ Y NE  VGKA+
Sbjct: 10  STDTVTLNTGAKIPLFGLGTWQSTDDDA-SSAVAAALKHGYKHIDTASFYKNEELVGKAV 68

Query: 77  NDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136
            +SG+PREE+F+TTK+W+ Q  DPA  L+ SLK+LG +YVDL LMHWPV          +
Sbjct: 69  KESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPENSTLD 128

Query: 137 FLSIPLLPDGK--RDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPG 194
              +P  PDGK  RD E   WD+VKTW LMQ+L  TGK +A+GVSNFSINNL+++L++ G
Sbjct: 129 AYKVPRGPDGKVTRDEE---WDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNAEG 185

Query: 195 NKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGV 254
             VVPAVNQVE+H  LPQ EL+E+C  KGI++EAYSPLGS++AP+L +  +  +A+K+GV
Sbjct: 186 TTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKYGV 245

Query: 255 QTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPH 314
             A +++++   RG +VLPKSV   RI +NF+  K+ +E+++ +N+I K++G +R V P 
Sbjct: 246 TPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFVDPD 305

Query: 315 WEPFVPF 321
           + PF  F
Sbjct: 306 FSPFPLF 312

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  236 bits (601), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 188/298 (63%), Gaps = 11/298 (3%)

Query: 21  FKLNTGATISAVGLGTWQSTNEN-EGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAIND- 78
           F LN G  I A+GLGT    +   E  EAV AA++AGYRHIDTA  Y  E  +G+A+ + 
Sbjct: 11  FNLNNGTRIPAIGLGTASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQALKEL 70

Query: 79  ---SGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
              + + REE+F+TTK+W T  ++P+  ++ SLK LG+DYVDL L HWPV         G
Sbjct: 71  FESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKVENSQG 130

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQEL---PKTGKTRAVGVSNFSINNLKKVLSS 192
           N + +P   DG    E D  D++ T++ ++++   PK  + RA+GVSN+ I  L+++   
Sbjct: 131 NIIGLPRDKDGNALFEKDA-DWLFTYKALEKIYLDPKDNRVRAIGVSNYPIEYLERLFKE 189

Query: 193 PGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKH 252
              KV PA+NQVE+HP LPQ EL ++CH   ILL AYSPLGS  AP L    + +LAKK+
Sbjct: 190 --CKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDLAKKY 247

Query: 253 GVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRI 310
            V+ A I+ S+H+ +G +VLP+S++ +RI AN    KL+D+++ +++ +  ++  R I
Sbjct: 248 KVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQVGIDEPNRFI 305

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  231 bits (589), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 184/303 (60%), Gaps = 11/303 (3%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNEN-EGYEAVIAALKAGYRHIDTAAIYGNEGQVGK 74
           N+   F LN G  I A+GLGT        E  +AV AA++AGYR IDTA  Y  E  +G+
Sbjct: 6   NTEIYFNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGE 65

Query: 75  AI----NDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPR 130
           A+     D  + RE++F+TTK+W     DP+  +N+SLK LG+DYVD+ L HWP+     
Sbjct: 66  ALKELFRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKKT 125

Query: 131 SIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQEL---PKTGKTRAVGVSNFSINNLK 187
             ++G  +  PL  DGK  +  +  D++ T++LM+++   PK  + RA+GVSN+ I  L+
Sbjct: 126 YDENGTIIGKPLDKDGKV-IFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLE 184

Query: 188 KVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLIN 247
           +V+     KV P +NQVE+HP LPQ EL ++CH  GILL AYSPLGS  AP    P++  
Sbjct: 185 RVIKE--CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQE 242

Query: 248 LAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGE 307
            AKKH V  A I+ S+HV++G +V+P+S++ ER+ +N     L+  EM+ +++       
Sbjct: 243 YAKKHEVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDFGVNTPH 302

Query: 308 RRI 310
           R I
Sbjct: 303 RYI 305

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  221 bits (562), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 117/295 (39%), Positives = 191/295 (64%), Gaps = 9/295 (3%)

Query: 21  FKLNTGATISAVGLGTWQSTNEN-EGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAIND- 78
           F LNTGA I ++GLGT     +  +  +AV  A+K GYR IDTA +YG+E  +G+A+ + 
Sbjct: 11  FNLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQEL 70

Query: 79  ---SGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
                V RE++F+TTK+W   ++     L +SLK+L LDYVDL L HWP+    +  + G
Sbjct: 71  FEEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVKQYDEHG 130

Query: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPK--TGKTRAVGVSNFSINNLKKVLSSP 193
              S P+ P     V  +  DY+ TW+ ++++ K  +G+ R +GVSN+ +  L+++L   
Sbjct: 131 KLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLLKE- 189

Query: 194 GNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHG 253
             +VVP +NQVE+HPLLPQEEL E+C+S GIL+E++SPLGS+  P L  P++  L+KK+ 
Sbjct: 190 -TEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSKKYD 248

Query: 254 VQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGER 308
            +   +++++HV++G +V+P+S++  RI  N   + LS+E++ +++ + +EK  R
Sbjct: 249 CEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGREKPVR 303

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  216 bits (551), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 185/302 (61%), Gaps = 16/302 (5%)

Query: 21  FKLNTGATISAVGLGTWQSTNEN--EGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAIND 78
           FKLN G  + A+GLGT  S  E+  E  +AV AA+KAGYRHIDTA  YG EG +G A+ +
Sbjct: 11  FKLNNGVNMPALGLGT-ASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIGDALKE 69

Query: 79  ----SGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNP-RSIK 133
                 V R ++F+T+K+W     D    LN+SLK LGLDYVDLYL HWP+        K
Sbjct: 70  LLENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQKIEDSK 129

Query: 134 DG--NFLSIPLLPDGKRDVEIDTWDYVKTWELMQEL---PKTGKTRAVGVSNFSINNLKK 188
           DG       P+  DG   + ++  DY+ T++ M+++   PK  + RA+GVSN+ +  L +
Sbjct: 130 DGVNGLKGKPIDKDGNALI-VEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVEYLDR 188

Query: 189 VLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINL 248
           +L      V PAVNQVE+HP LPQ EL E+C    I L AYSPLGS+ AP+L  P++  L
Sbjct: 189 LLKV--CTVKPAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLPLVKEL 246

Query: 249 AKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGER 308
           ++K+ V    ++IS+H+++G  V+P+S++  R+      + L++ E+ ++++I ++   R
Sbjct: 247 SEKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDIGRKDSIR 306

Query: 309 RI 310
            I
Sbjct: 307 YI 308

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  214 bits (544), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 187/302 (61%), Gaps = 16/302 (5%)

Query: 21  FKLNTGATISAVGLGTWQSTNE-NEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAIND- 78
           FKLN G TI A+G GT+       E  +AV AA+KAGYRHIDTA +Y +E  VG+AI + 
Sbjct: 11  FKLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVGEAIKEM 70

Query: 79  ---SGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
                V R ++FVTTK+W     +    LN+SL+ LGLDYVDL L HWP+   PR   + 
Sbjct: 71  IEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCF-PRVEDEK 129

Query: 136 N----FLSIPLLPDGKRDVEIDTWDYVKTWELMQEL---PKTGKTRAVGVSNFSINNLKK 188
           N     ++ P   +GK  +  +  D+++T+  ++++   P   + RA+GVSN++I  L+ 
Sbjct: 130 NGVNGLVAYPEDDEGKPLLN-EKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIEYLEA 188

Query: 189 VLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINL 248
           +      KV P VNQVEIHP LPQ EL ++CH+ GILL AYSPLGS  AP L  P++  L
Sbjct: 189 LFKE--CKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIPLVHQL 246

Query: 249 AKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGER 308
           A+K+ +    I+IS+H+++G  V+P+S++  RI +  +    + EE+++++N+  E+  R
Sbjct: 247 AEKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNVGIEEPAR 306

Query: 309 RI 310
            +
Sbjct: 307 FV 308

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  213 bits (543), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 189/317 (59%), Gaps = 17/317 (5%)

Query: 9   EKQMSASNSTTTFKLNTGATISAVGLGTWQSTNE-NEGYEAVIAALKAGYRHIDTAAIYG 67
           E  +    +   F LN G  I A+GLGT     +  E  +AV AA+KAGYRHIDTA  Y 
Sbjct: 13  ENMLHPKTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYE 72

Query: 68  NEGQVGKAIN----DSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHW 123
            E  VG+AI     D  + RE++F+TTK+W     +    LN+SLK LGL+YVDL L HW
Sbjct: 73  TEPFVGEAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHW 132

Query: 124 PVTL----NPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQEL---PKTGKTRAV 176
           P+      +P+ I     +  P+   GK     D  DY++T++ ++++   P   + RA+
Sbjct: 133 PLCFEKIKDPKGI--SGLVKTPVDDSGKTMYAADG-DYLETYKQLEKIYLDPNDHRVRAI 189

Query: 177 GVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTN 236
           GVSNFSI  L++++     +V P VNQVE HP LPQ EL ++C    ILL AYSPLGS  
Sbjct: 190 GVSNFSIEYLERLIKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHG 247

Query: 237 APILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMR 296
           AP L  P++  LA+K+ V    ++IS+H+++G IV+P+S++  RI ++ +   L+ +E++
Sbjct: 248 APNLKIPLVKKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQ 307

Query: 297 EINNISKEKGERRIVQP 313
           E+N+  ++   R I +P
Sbjct: 308 ELNDFGEKYPVRFIDEP 324

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  209 bits (532), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 122/316 (38%), Positives = 189/316 (59%), Gaps = 15/316 (4%)

Query: 9   EKQMSASNSTTTFKLNTGATISAVGLGTWQSTNE-NEGYEAVIAALKAGYRHIDTAAIYG 67
           EK +    +   F LN G  I A+GLGT     +  E  +AV AA+KAGYRHIDTA  Y 
Sbjct: 13  EKMLHPKTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYE 72

Query: 68  NEGQVGKAIN----DSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHW 123
            E  VG+AI     D  + RE++F+TTK+W     +    LN+SLK LGLDYVDL+L HW
Sbjct: 73  TEPFVGEAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHW 132

Query: 124 PVTLNPRSIKDGNFLSIPL---LPDGKRDVEIDTWDYVKTWELMQEL---PKTGKTRAVG 177
           P+      +KD   LS  +   + D  + +     D+++T++ ++++   P   + RA+G
Sbjct: 133 PLCF--EKVKDPKGLSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIG 190

Query: 178 VSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNA 237
           VSNFSI  L++++     +V P VNQVE HP LPQ  + ++C    ILL AYSPLGS  A
Sbjct: 191 VSNFSIEYLERLIKE--CRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGA 248

Query: 238 PILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMRE 297
           P L  P++  L +K+ +    ++IS+H+++G IV+P+S++  RI ++ +   L+ +E++E
Sbjct: 249 PNLKIPLVKKLTEKYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQE 308

Query: 298 INNISKEKGERRIVQP 313
           +N+  ++   R I +P
Sbjct: 309 LNDFGEKYPVRFIDEP 324

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  209 bits (532), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 128/322 (39%), Positives = 191/322 (59%), Gaps = 21/322 (6%)

Query: 9   EKQMSASNSTTTFKLNTGATISAVGLGTWQSTNE-NEGYEAVIAALKAGYRHIDTAAIYG 67
           +K +    +   F LN G  I A+GLGT     +  E  +AV AA+KAGYRHIDTA  Y 
Sbjct: 13  DKMLHPKTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYR 72

Query: 68  NEGQVGKAIND----SGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHW 123
            E  VG+AI +      + RE++F+TTK+W     +    LN+SLK LGLDYVDL L HW
Sbjct: 73  TEPFVGEAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHW 132

Query: 124 PVTL----NPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQEL---PKTGKTRAV 176
           P+      +P+ I     +  P+  D  + V     D+++T++ ++++       + RA+
Sbjct: 133 PLCFEKVKDPKGI--SGLVKTPV-DDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAI 189

Query: 177 GVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTN 236
           GVSNFSI  L++++     KV P VNQVE HP LPQ EL ++C    ILL AYSPLGS  
Sbjct: 190 GVSNFSIEYLERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQG 247

Query: 237 APILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMR 296
           AP L  P++  L +K+ V    ++IS+H+++G IV+P+S++  RI +N + + L+ +E++
Sbjct: 248 APNLKIPLVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQ 307

Query: 297 EINNISKEKGERRIVQPHWEPF 318
           E+N    E GE+  V+   EPF
Sbjct: 308 ELN----EFGEKYPVRFIDEPF 325

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  209 bits (531), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 187/315 (59%), Gaps = 13/315 (4%)

Query: 9   EKQMSASNSTTTFKLNTGATISAVGLGTWQSTNE-NEGYEAVIAALKAGYRHIDTAAIYG 67
           +K +    +   F LN G  I A+GLGT     +  E  +AV AA+KAGYRHIDTA  Y 
Sbjct: 13  DKMLHPKTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYE 72

Query: 68  NEGQVGKAIND----SGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHW 123
            E  VG+AI +      + RE++F+TTK+W     +    LN+SLK LGLDYVDL L HW
Sbjct: 73  TEPFVGEAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHW 132

Query: 124 PVTLNPRSIKDG--NFLSIPLLPDGKRDVEIDTWDYVKTWELMQEL---PKTGKTRAVGV 178
           P+        +G   ++ +P+   GK  V     D+++T++ ++++       + RA+GV
Sbjct: 133 PICFGKVKDPEGISGYMKLPVDDSGKT-VYASNGDWLETYKQLEKIYLDSNDHRVRAIGV 191

Query: 179 SNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAP 238
           SNFSI  L++++     KV P VNQVE HP LPQ EL ++C    ILL AYSPLGS  AP
Sbjct: 192 SNFSIEYLERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAP 249

Query: 239 ILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREI 298
            L  P++  L +K+ V    ++IS+H+++G IV+P+S++  RI +N + + L+ +E++E+
Sbjct: 250 NLKIPLVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQEL 309

Query: 299 NNISKEKGERRIVQP 313
           N   ++   R +  P
Sbjct: 310 NEFGEKYPVRFMDVP 324

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  206 bits (525), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 118/311 (37%), Positives = 185/311 (59%), Gaps = 12/311 (3%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNE-NEGYEAVIAALKAGYRHIDTAAIYGNEG 70
           +   N+   F LN G  + A+GLGT     +  +  +AV AA+K+GYRHIDTA  Y  E 
Sbjct: 2   LHPKNTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCED 61

Query: 71  QVGKAIND----SGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVT 126
           +VG+A+ +      V RE+IFVTTK+W T        ++ SL+ LGLD+VDL L HWP+ 
Sbjct: 62  RVGEALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLC 121

Query: 127 LNPRSIKDG--NFLSIPLLPDGKRDVEIDTWDYVKTWELMQEL--PKTGKTRAVGVSNFS 182
            N     DG       P   DG      +  DY++T++ +++L   K  + RA+GVSN+ 
Sbjct: 122 FNRLEDPDGIDGVRRNPYHEDGSPHYN-EKGDYLETFKTLEKLYLAKDPRFRAIGVSNYP 180

Query: 183 INNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTE 242
           +  L+++L     +VVPA+NQVE HP LPQ EL ++C    I LEAYSPLG+TNAP++  
Sbjct: 181 VEYLERLLKE--CQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDN 238

Query: 243 PVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNIS 302
            ++  +A K+   T  ++I++H+++G + +P+SV+ + I +N + + LS E++  +N   
Sbjct: 239 ELVKKIAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFG 298

Query: 303 KEKGERRIVQP 313
            E  +R + +P
Sbjct: 299 VENTKRIVDEP 309

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  206 bits (525), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 180/299 (60%), Gaps = 11/299 (3%)

Query: 21  FKLNTGATISAVGLGTW-QSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAIND- 78
           F  N G  + A GLGT  Q     E  +AV AA+KAGYRHIDTA  YG E  VG+A+ + 
Sbjct: 11  FTFNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQEL 70

Query: 79  ---SGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
                V RE++ +T+K+W T  +D    LN+SL RL +DYVDL+L HWP+         G
Sbjct: 71  FEERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWPLCTQKVPDPHG 130

Query: 136 -NFLSIPLLPDGKRDVEIDTWDYVKTWELMQEL---PKTGKTRAVGVSNFSINNLKKVLS 191
            + ++   + D    +  +  D+++T++ ++++       + RA+GVSNF I  LK+VL 
Sbjct: 131 VDKIAKEPVDDQGNPLYDEKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRVLK 190

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
               + VPA NQVE+HP LPQ EL E+C    IL+ AYSPLG   AP+L  P+L  L +K
Sbjct: 191 E--CRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLCEK 248

Query: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRI 310
           +      I+ S+H+++G IV+P+S+++ RI +N + + LS+E++ ++N   ++  +R I
Sbjct: 249 YNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQKNKKRYI 307

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  207 bits (526), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 120/317 (37%), Positives = 190/317 (59%), Gaps = 17/317 (5%)

Query: 9   EKQMSASNSTTTFKLNTGATISAVGLGTWQSTNE-NEGYEAVIAALKAGYRHIDTAAIYG 67
           EK +    +   F LN G  + A+GLGT     +  E  +AV AA+KAGYRHIDTA  Y 
Sbjct: 13  EKMLHPKTTEIYFTLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYE 72

Query: 68  NEGQVGKAIND----SGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHW 123
            E  VG+AI +      + RE++F+TTK+W     +    L++SLK +GLDYVDL+L HW
Sbjct: 73  TEPFVGEAIKELLEEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHW 132

Query: 124 PVTL----NPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQEL---PKTGKTRAV 176
           P+      +P+ I     +  P+   G+  +     D+++T++ ++++   P   + RA+
Sbjct: 133 PLCFEKVKDPKGI--SGLVKTPVHKSGEAMLA-SNGDWMETYKQLEKIYLDPNDHRVRAI 189

Query: 177 GVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTN 236
           GVSNFSI  L++++     +V P VNQVE HP LPQ EL ++C    ILL AYSPLGS  
Sbjct: 190 GVSNFSIEYLERLVKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNG 247

Query: 237 APILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMR 296
           AP L  P++  L +K+ V    ++IS+H+++G IV+P+S++  RI ++ +   L+ +E++
Sbjct: 248 APNLKIPLVKKLVEKYNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQ 307

Query: 297 EINNISKEKGERRIVQP 313
           E+N+  ++   R I +P
Sbjct: 308 ELNDFGEKYPVRFIDEP 324

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  206 bits (523), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 123/311 (39%), Positives = 188/311 (60%), Gaps = 14/311 (4%)

Query: 20  TFKLNTGATISAVGLGTWQSTNE-NEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAIND 78
           +F LN G  + A+GLGT     E     +AV AA+KAGYRHIDTA  YG+E  VG+AI +
Sbjct: 13  SFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVGEAIKE 72

Query: 79  ----SGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKD 134
                 + RE+IF+T+K+W     D    LN+SL+ LG+DY+DL+L HWP+    +    
Sbjct: 73  LMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCYVKQEDTH 132

Query: 135 G--NFLSIPLLPDGKRDVEIDTWDYVKTWELMQEL---PKTGKTRAVGVSNFSINNLKKV 189
           G       P  P+G+   E+D  D+++T+  M+++   P   + R++GVSNF +  L++ 
Sbjct: 133 GINGLARNPETPNGEPYYEVDG-DWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQYLERT 191

Query: 190 LSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLA 249
           L      V PAVNQVE+HP LPQ EL ++C +  ILLEAYSPLGS NAP +   ++ +LA
Sbjct: 192 LFECA--VKPAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLVQDLA 249

Query: 250 KKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERR 309
           +K+ +  + I+ S+H+++G  V+ +SV+  RI +N +   L++EE+  ++ +   K  +R
Sbjct: 250 EKYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLGITK-PKR 308

Query: 310 IVQPHWEPFVP 320
            V   W   VP
Sbjct: 309 FVNEKWNAVVP 319

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  205 bits (521), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/304 (39%), Positives = 171/304 (56%), Gaps = 21/304 (6%)

Query: 21  FKLNTGATISAVGLGT------WQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGK 74
           F LN G  I AVGLGT      W  T E     AV AA+KAG+R IDTA  YG E  +G+
Sbjct: 11  FNLNNGTRIPAVGLGTANPKDKWPQTKE-----AVKAAVKAGFRQIDTAWAYGTEEYIGE 65

Query: 75  AIND----SGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPR 130
           A+ +      V RE++F+TTK+W          LN+SLKRL LDYVDL L HWP     +
Sbjct: 66  ALQELFAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVKK 125

Query: 131 SIKDGN--FLSIPLLPDGK--RDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNL 186
              +G+   ++ P   DG    D   D  +  K  E +       + RA+GVSN+ I  L
Sbjct: 126 QDPEGSGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYL 185

Query: 187 KKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLI 246
           +++      K VPA+NQVE+HP LPQ EL ++C+  GIL+ +YSPLGS  AP L  P++ 
Sbjct: 186 ERLFKE--CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQ 243

Query: 247 NLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKG 306
            LA K+      +++S+H+++G IV+P+S++ ERI      + L+ EE+ ++N    E  
Sbjct: 244 ELASKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYGVEHE 303

Query: 307 ERRI 310
            R I
Sbjct: 304 YRYI 307

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  205 bits (521), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 119/319 (37%), Positives = 189/319 (59%), Gaps = 14/319 (4%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNE-NEGYEAVIAALKAGYRHIDTAAIYGNEG 70
           +   ++  +F LN G  + A+GLGT     +  E  +AV AA+KAGYR+IDTA  YG+E 
Sbjct: 2   LHPKSTEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEP 61

Query: 71  QVGKAIND----SGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVT 126
            VG+AI +      + RE++F+T+K+W     D    L +SLK LG+DY+DL+L HWP+ 
Sbjct: 62  FVGEAIKELIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLC 121

Query: 127 LNPRSIKDG--NFLSIPLLPDGKRDVEIDTWDYVKTWELMQEL---PKTGKTRAVGVSNF 181
            N R    G       P   DG  D   +  D++ T++ M+ +   PK  + RA+GVSNF
Sbjct: 122 YNRREDPHGINGLARNPEKADGSPDFN-EKADWLDTYKQMERIYSNPKDNRVRAIGVSNF 180

Query: 182 SINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILT 241
            +  LK+VL      V P +NQVE+HP LPQ EL E+CH   I L AYSPLGS  AP++ 
Sbjct: 181 PVEYLKRVLKE--CPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVK 238

Query: 242 EPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNI 301
            P++  +++K+      I+ S+H+++G  V+P+S+++ RI +N + + LS +++ ++ ++
Sbjct: 239 HPLIKEMSQKYKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLSKDDLDKLKDL 298

Query: 302 SKEKGERRIVQPHWEPFVP 320
            + +  +R +   W   VP
Sbjct: 299 GRTE-PKRFINEKWNAAVP 316

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  197 bits (500), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 110/308 (35%), Positives = 183/308 (59%), Gaps = 12/308 (3%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNE-NEGYEAVIAALKAGYRHIDTAAIYGNEG 70
           +   N+   F LN G  + A+GLGT     +  +  +AV AA+K+GYRHIDTA  Y  E 
Sbjct: 2   LHPKNTEIYFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCED 61

Query: 71  QVGKAIND----SGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVT 126
           ++G+A+ +      + RE+IF+TTK+W T        ++ SL+ LG+DYVDL L HWP+ 
Sbjct: 62  RIGEALKELFEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLC 121

Query: 127 LNPRSIKDG--NFLSIPLLPDGKRDVEIDTWDYVKTWELMQE--LPKTGKTRAVGVSNFS 182
            N     +G       P   DG      +  DY++T++ +++  L K  + R++GVSN+ 
Sbjct: 122 FNRLQDPEGIDGICRNPTHEDGSPHYN-EKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYP 180

Query: 183 INNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTE 242
           +  L+++L     KVVPAVNQVE+HP LPQ EL ++C    I LEA+SP G+T +P++  
Sbjct: 181 VEYLERLLKE--CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKN 238

Query: 243 PVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNIS 302
            ++  +A+K+      ++I++H+++G + +P+SV+ + I +N + + LS E++ E+N   
Sbjct: 239 ELVQKVAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFG 298

Query: 303 KEKGERRI 310
            E  +R +
Sbjct: 299 VENPKRLV 306

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  173 bits (438), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 108/313 (34%), Positives = 166/313 (53%), Gaps = 32/313 (10%)

Query: 17  STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG--- 73
            T T+ LN G  +  VGLG W+ + +    + V  A+K GYR  D A  YGNE ++G   
Sbjct: 3   DTRTYTLNNGMKMPVVGLGCWKLSADVAATQ-VYEAIKLGYRLFDGALCYGNEKEIGVGI 61

Query: 74  -KAINDSGVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRLGLDYVDLYLMHWPVTLNPR 130
            +AIN+  V RE++F+ +KLW   HH       L  +L  LGLDYVDLY +H+P+ +   
Sbjct: 62  KQAINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYV 121

Query: 131 SIKDGNFLSIPLLPDGKRD-----VEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINN 185
            +++      P +  G+ D     V       + T+  M++L   G  +++G+SNF    
Sbjct: 122 PLEEK---YPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACL 178

Query: 186 LKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTN--------- 236
           ++ +L   G ++ P   QVE+HP L QE L+ +  SK I + AYS  G  +         
Sbjct: 179 IQDLLR--GARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAA 236

Query: 237 ---APILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTLKL 290
               P+L   +++N+AKKH V  +Q+++ W  QRG  V+PKS   ER+  N    K L L
Sbjct: 237 KDVTPLLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTL 296

Query: 291 SDEEMREINNISK 303
           SD EM +I +++K
Sbjct: 297 SDSEMSDIFSLNK 309

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  170 bits (431), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 104/307 (33%), Positives = 165/307 (53%), Gaps = 32/307 (10%)

Query: 23  LNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG----KAIND 78
           LN G  +  VGLG W+  NE    + +  A+  GYR  D A  YGNE +VG    +AI D
Sbjct: 7   LNNGNKMPLVGLGCWKIPNETCS-QQIYDAISVGYRVFDGAQDYGNEKEVGEGVRRAIKD 65

Query: 79  SGVPREEIFVTTKLWSTQHH--DPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136
             V REE+FV +KLW++ HH  +    L  +L  +GLDY+DL+ +H+P+ L P S ++  
Sbjct: 66  GLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSFEEK- 124

Query: 137 FLSIPLLPDGKRDVEIDTWD-----YVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
               P L  G+ D +           + T+  ++E  + G  +++GVSNFS + +  +L 
Sbjct: 125 --YPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIMLDLLR 182

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG------------STNAPI 239
             G ++ PA  Q+E+HP L QE  ++W  SKGI + AYS  G                P+
Sbjct: 183 --GARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKATPPL 240

Query: 240 LTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTLKLSDEEMR 296
               V+  +A KH V T+Q+++ W  Q+   V+PKS   ER++ N    + + L+ +E++
Sbjct: 241 FEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTLTGDEIK 300

Query: 297 EINNISK 303
           EI+ ++K
Sbjct: 301 EISGLNK 307

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  170 bits (430), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 110/314 (35%), Positives = 173/314 (55%), Gaps = 34/314 (10%)

Query: 18  TTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG---- 73
           + T KLN G  +  VGLG W+  NE    + V  A+K GYR  D A  YGNE +VG    
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQ-VYEAIKLGYRLFDGAQDYGNEKEVGQGIR 63

Query: 74  KAINDSGVPREEIFVTTKLWSTQHHDPA---AGLNDSLKRLGLDYVDLYLMHWPVTLNPR 130
           KAI++  V RE++FV +KLW++ +HDP      L  +L+ LGL+Y+DL+ +H+P+     
Sbjct: 64  KAIDEGIVKREDLFVVSKLWNS-YHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFV 122

Query: 131 SIKDGNFLSIPLLPDGKRD-----VEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINN 185
             ++      P    G  D     + ++    + T+  +++    G  +A+GVSNF    
Sbjct: 123 PFEER---YPPGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGIL 179

Query: 186 LKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG-----------S 234
           L  +L+  G K+ PA  Q+E HP L QE+L+E+C  +GI + AYS  G           +
Sbjct: 180 LHDLLA--GAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLA 237

Query: 235 TNAPILTE-PVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT---LKL 290
            + P L E  V+  +A  HGV T+++++ W  QR   ++PKS   ER+  N +    L L
Sbjct: 238 KSTPTLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTL 297

Query: 291 SDEEMREINNISKE 304
           SDEE++EI++++K+
Sbjct: 298 SDEELQEISSLNKD 311

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  170 bits (431), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 107/316 (33%), Positives = 169/316 (53%), Gaps = 46/316 (14%)

Query: 20  TFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG----KA 75
           T KLN GA +  VGLG W+  NE    E V  A+K GYR +D A  Y NE +VG    +A
Sbjct: 32  TIKLNNGADMPLVGLGCWKIPNEVAA-EQVYEAIKLGYRLLDGAEDYANEREVGQGIRRA 90

Query: 76  INDSGVPREEIFVTTKLWSTQHH--DPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIK 133
           I++  V REE+FV +KLW+  H   D    L  +L  LGLDY+DL+ +H+P+        
Sbjct: 91  IDEGLVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLA------- 143

Query: 134 DGNFLSIPL-------LPDGKRDVEI-----DTWDYVKTWELMQELPKTGKTRAVGVSNF 181
              F  +PL       L  G  D +      +    ++T+  +++L   G+ RA+G+SNF
Sbjct: 144 ---FKFVPLEERYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNF 200

Query: 182 SINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTN----- 236
               ++ +L   G ++ PA  Q+E HP L QE L+++  S+G+ +  YS LG  +     
Sbjct: 201 QGCLVQDLLR--GCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELG 258

Query: 237 -------APILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFK--- 286
                  AP+L   V+  +A++H    A++++ W  QR   V+PKS   ER+  N +   
Sbjct: 259 NTAAQNAAPLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDE 318

Query: 287 TLKLSDEEMREINNIS 302
            L L+D+E+RE+++++
Sbjct: 319 ALTLADDELRELSSLN 334

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  167 bits (424), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 168/287 (58%), Gaps = 40/287 (13%)

Query: 20  TFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI--- 76
            +KL++G T+ ++GLGT+   + N   E V  ALK GYRH+DTA +YGNE +VG+ I   
Sbjct: 9   AYKLSSGYTLPSIGLGTYDLPS-NATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKW 67

Query: 77  ---NDSGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRL-GLDYVDLYLMHWPVTLNPR 130
              N S   RE++F  TKLW++Q  +++    + +  +++ GL Y+DL L+H P++    
Sbjct: 68  LKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLS---- 123

Query: 131 SIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVL 190
                          G R         ++T++ MQE    G  R++GVSN+ ++++ ++L
Sbjct: 124 ---------------GSRKR-------LETYKAMQEAVDKGIVRSIGVSNYGVHHIDELL 161

Query: 191 SSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAK 250
           +    K  P VNQ+EI P L ++EL ++C S+G+++EAY+PL  T+   +  P ++ +AK
Sbjct: 162 NWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAK 219

Query: 251 KHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEM 295
           + G  + Q++I W +Q GY+ LPK+   +R+ +N     ++L+ E+M
Sbjct: 220 EAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQM 266

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  164 bits (415), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 160/291 (54%), Gaps = 40/291 (13%)

Query: 20  TFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI--- 76
           ++KL++G TI +VGLGT++       Y  V  AL+ GYRH DTA +YGNE +VG+ I   
Sbjct: 8   SYKLSSGYTIPSVGLGTYELPPNKTAY-LVHQALEVGYRHFDTAVLYGNEYEVGQGIKKW 66

Query: 77  ---NDSGVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRL-GLDYVDLYLMHWPVTLNPR 130
              N +   R ++F TTKLW +QH    A   ++  L+ +  L Y+DL L+H P+     
Sbjct: 67  LNENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPL----- 121

Query: 131 SIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVL 190
                          G + + ++T+      E MQE    GK R++GVSN+   +++++L
Sbjct: 122 ---------------GGKKLRLETY------EAMQEAVDAGKVRSIGVSNYGFQHIEELL 160

Query: 191 SSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAK 250
           +    K  P VNQ+EI P   ++EL ++C  KGIL+EAY+PL  T+   L +P L+ +A 
Sbjct: 161 NWEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVKVAN 218

Query: 251 KHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKL--SDEEMREIN 299
           + G    Q +I W +Q+GYI LPK+    R+ +N        + ++M +++
Sbjct: 219 EVGCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSFEWTTDQMDQLD 269

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  165 bits (417), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/313 (32%), Positives = 170/313 (54%), Gaps = 34/313 (10%)

Query: 18  TTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG---- 73
           + T  LN G T+  VGLG W+  + +   E V  A+K GYR  D A  YGNE QVG    
Sbjct: 2   SETVTLNNGLTMPLVGLGCWK-ISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIR 60

Query: 74  KAINDSGVPREEIFVTTKLWSTQHHDPA---AGLNDSLKRLGLDYVDLYLMHWPVTLNPR 130
           +AI++  V RE++FV +KLW+T +HDP      L  +L  + L+Y+DLY +H+P+     
Sbjct: 61  RAIDEGIVKREDLFVVSKLWNT-YHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFV 119

Query: 131 SIKD----GNFLSIPLLPDGKRDVEID-TWDYVKTWELMQELPKTGKTRAVGVSNFSINN 185
             ++    G +       D K+ +  +     + T+  M+EL   G T+++G+SN++   
Sbjct: 120 PFEERYPPGFYTGAE---DAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGAL 176

Query: 186 LKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTN--------- 236
           ++  L   G ++ P   Q+E HP L QE+L+E+C   GI + AYS  G  +         
Sbjct: 177 VQDTLR--GCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLA 234

Query: 237 ---APILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTLKL 290
               P+   PV+  +A++H V T+Q+++ W  QRG  V+PKS H  R+  N    + + L
Sbjct: 235 KHTPPLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTL 294

Query: 291 SDEEMREINNISK 303
           + +++ EI++++K
Sbjct: 295 TPKDLEEISSLNK 307

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  164 bits (414), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 104/311 (33%), Positives = 173/311 (55%), Gaps = 45/311 (14%)

Query: 19  TTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ----VGK 74
           TT  L  G  +  +GLG +Q+  E E    V  ALK GYR +D+A +YGNE +    + K
Sbjct: 7   TTHALKNGVKMPCLGLGLYQTPKE-ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITK 65

Query: 75  AINDS-GVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRLG-LDYVDLYLMHWPVTLNPR 130
            + +S  V R +IF TTK+ +      +A   + +SL R+  LDY+DL+L+H P+T   +
Sbjct: 66  FLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEK 125

Query: 131 SIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVL 190
            +                           TW+  QE  +TGK +A+GVSN+ I +L+++ 
Sbjct: 126 RLG--------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMY 159

Query: 191 SSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAK 250
              G K+ P VNQ E++P L ++EL  +CH KG++++AYSPL  T A  L +P L+ L +
Sbjct: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVE 217

Query: 251 KHGVQ--TAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEMREINNISKEKG 306
               +  +AQI+++W +Q G++ L K+VH +R++ N K+   +LS  +++++ +      
Sbjct: 218 DSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH----DD 273

Query: 307 ERRIVQPHWEP 317
           +  + QP W+P
Sbjct: 274 QYYLSQPKWDP 284

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  164 bits (414), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 164/307 (53%), Gaps = 32/307 (10%)

Query: 23  LNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGK----AIND 78
           LN G  +  VGLG W+  N+    + V  A+KAGYR  D A  Y NE +VGK    A++D
Sbjct: 7   LNNGMKMPQVGLGCWKIPNDICA-DQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMDD 65

Query: 79  SGVPREEIFVTTKLWSTQHHDPAAGLN--DSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136
             V R+++FV +KLW+  HH     LN   +LK LGLDY+DLY +H+P+      +++  
Sbjct: 66  GIVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPMEER- 124

Query: 137 FLSIPLLPDGKRD-----VEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
               P +  GK D     +  +    + T+  ++E  + G  +++G+SNF+   +  +L 
Sbjct: 125 --YPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADILR 182

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG------------STNAPI 239
             G  + P   Q+E HP L QE+LLE+C    + +  YS  G                P+
Sbjct: 183 --GCSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPPL 240

Query: 240 LTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFK---TLKLSDEEMR 296
              PV+  +A+KH V TA++++ W  QRG  ++PKS H +R+ +N      + L++E+++
Sbjct: 241 FDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDLK 300

Query: 297 EINNISK 303
            I+ +++
Sbjct: 301 SISGLNQ 307

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  164 bits (414), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 107/307 (34%), Positives = 161/307 (52%), Gaps = 32/307 (10%)

Query: 23  LNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG----KAIND 78
           LN G  +  VGLG W+  N     E V  A+K GYR  D A  YGNE +VG    +AI++
Sbjct: 7   LNNGLKMPMVGLGCWKIPNTVCA-EQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRRAIDE 65

Query: 79  SGVPREEIFVTTKLWSTQHHDPAAGL--NDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136
             V R ++F+ +KLW+T HH     L    +L  LGLDY+DLY +H+P+      I++  
Sbjct: 66  KIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPIEEK- 124

Query: 137 FLSIPLLPDGKRD-----VEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
               P    GK D     + +    Y+ T+  M+ L + G  +++GVSN     L+ VL 
Sbjct: 125 --YPPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQDVLM 182

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGST-----------NAP-I 239
             G K+ P   Q+E HP L Q  L+++C  + I++ AYS  G             + P +
Sbjct: 183 --GCKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKEDTPNL 240

Query: 240 LTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTLKLSDEEMR 296
              PV+  +A K+ V T+++++ W  Q G  V+PKS   ER+  N     TL LS+EE+ 
Sbjct: 241 FDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSNEELV 300

Query: 297 EINNISK 303
           EI+NI++
Sbjct: 301 EISNINR 307

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  161 bits (408), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 162/291 (55%), Gaps = 39/291 (13%)

Query: 20  TFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGK-AIND 78
           ++KL +G  I  +GLGT+     N     V AAL+ GYRH+DTA +YGNE +V + A+N 
Sbjct: 6   SYKLASGFNIPTIGLGTYDLPPSNTT-AIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNF 64

Query: 79  SG----VPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRLG-LDYVDLYLMHWPVTLNPRS 131
            G    V RE+IF TTKLW++Q  +      + + ++ +G L Y+DL LMH P+    + 
Sbjct: 65  LGRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPI--GGKQ 122

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
           ++ G                        TW+ MQE    G  R++GVS++   +L+ +  
Sbjct: 123 VRRG------------------------TWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFE 158

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
               K  PAVNQ+EI P + +++L ++C SKGI++EAYSPL  T+   L +P L+ +A++
Sbjct: 159 WSELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THGYKLDDPDLLKVAEE 216

Query: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTL--KLSDEEMREINN 300
            G    Q+++ W +Q GY+ LPK+    R+Q N      +LS E M+ +++
Sbjct: 217 TGKNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVFDWELSPEHMKLLDH 267

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  160 bits (405), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 159/293 (54%), Gaps = 39/293 (13%)

Query: 20  TFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI--- 76
           T+ L  G  + ++GLG + S  +N   + V  ALK GYRH DTA  YGNE +VG+ I   
Sbjct: 5   TYTLTNGCLMPSLGLGCY-SIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAW 63

Query: 77  ---NDSGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRLG-LDYVDLYLMHWPVTLNPR 130
              + S   R+++F  TKLW++Q  + +    +   L+++  L Y+DL L+H P      
Sbjct: 64  LAEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPAC---- 119

Query: 131 SIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVL 190
                           KR         + T+E MQE    G  +++GVSN+  ++L+++ 
Sbjct: 120 -------------GSAKR---------LATYEAMQESVDAGIVKSIGVSNYERHHLQELY 157

Query: 191 SSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAK 250
           + P  K  P VNQ+E+ P LP+ +L+++C S G+ ++AYSPLG  +   + +P + +LA 
Sbjct: 158 AMPNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASLAT 215

Query: 251 KHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISK 303
           +     AQI+I+W + +GY  LPK+ + +R+Q+N  +  +S     E+ NI K
Sbjct: 216 QKNCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNVS-LTAEELTNIEK 267

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  160 bits (405), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/319 (32%), Positives = 176/319 (55%), Gaps = 48/319 (15%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVI-AALKAGYRHIDTAAIYGNEG 70
           MS + STT   L  G  I  +G GT+++  E    E+++ AA K GYRH+DTA +Y NE 
Sbjct: 1   MSITASTTK-TLTNGVKIPVLGFGTYETPKEKA--ESIVHAAFKQGYRHVDTAQLYENER 57

Query: 71  QVGKAI-----NDSGVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRLG-LDYVDLYLMH 122
           +   A+         V R+++F TTK+    H    A   + +SL+    L+YVDL+L+H
Sbjct: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIH 117

Query: 123 WPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFS 182
            P                            +T   + T++ +QE  K GK +A+GVS++S
Sbjct: 118 NPCA--------------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYS 151

Query: 183 INNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTE 242
           I +L+++ S  G +V P VNQ E++P L +++L+++C  + +++EA+SP+  T +   ++
Sbjct: 152 IKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSD 209

Query: 243 PVLINLAKKH--GVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTL--KLSDEEMREI 298
           PV+  L K+   G   AQ++I W +Q G++ LPKSVH +R ++N   L  ++S E+M+ +
Sbjct: 210 PVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269

Query: 299 NNISKEKGERRIVQPHWEP 317
            +     GE  + QP ++P
Sbjct: 270 TH----DGEHFLAQPGFDP 284

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  160 bits (405), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/295 (32%), Positives = 166/295 (56%), Gaps = 40/295 (13%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ 71
           MS +     +KL++G  + ++GLGT+      E  E V  ALK+GYRH+DTA +YGNE +
Sbjct: 8   MSKTTVPKAYKLSSGYILPSIGLGTY-DIPRAETSEVVYQALKSGYRHLDTAVLYGNEHE 66

Query: 72  VGKAI------NDSGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRLG-LDYVDLYLMH 122
           VG+ I      +     R+++F TTKLW++Q  + +    + + ++++  L Y+DL L+H
Sbjct: 67  VGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIH 126

Query: 123 WPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFS 182
            P++   R ++                          T++ MQE    G  R++GVSN+ 
Sbjct: 127 SPLSGTRRRLE--------------------------TYKAMQEAVDEGIVRSIGVSNYG 160

Query: 183 INNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTE 242
            +++ ++L+    K  P VNQ+EI P + +++L ++C SKG+++EA+SPL  T+   L  
Sbjct: 161 KHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKH 218

Query: 243 PVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEM 295
           P ++ +AK+ G    +++I W +Q GY+ LPKS   ER++ N K    +LS E++
Sbjct: 219 PDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQV 273

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  160 bits (404), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 167/295 (56%), Gaps = 40/295 (13%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ 71
           MS+++    +KL++G  + ++GLGT+      E  E V  ALKAGYRH+DTA +YGNE +
Sbjct: 1   MSSTSVPRAYKLSSGYVLPSLGLGTY-DIPRAETAEVVYQALKAGYRHLDTAVLYGNERE 59

Query: 72  VGKAI------NDSGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRLG-LDYVDLYLMH 122
           VG+ +      +     R ++F TTKLW++Q  + +    + + L ++  L Y+D+ L+H
Sbjct: 60  VGEGVEKWLKEDPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIH 119

Query: 123 WPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFS 182
            P++   R ++                          T++ MQE    G  R++GVSN+ 
Sbjct: 120 SPLSGTRRRLE--------------------------TYKAMQEAVDAGIVRSIGVSNYG 153

Query: 183 INNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTE 242
            +++ ++L+    K  P VNQ+EI P + +++L ++C SKG+++EA+SPL  T+   +  
Sbjct: 154 KHHIDELLAWEELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKH 211

Query: 243 PVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEM 295
           P ++ +A++ G  T Q++I W +Q GY+ LPKS   ER++ N +    +LS E++
Sbjct: 212 PNVVRVAEEVGRNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVYDFELSPEQI 266

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  159 bits (403), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 160/291 (54%), Gaps = 40/291 (13%)

Query: 21  FKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI---- 76
           +KL+ G  I ++ LGT+     ++  E V   +K GYRH DTA +YGNE +VG  I    
Sbjct: 6   YKLSNGFKIPSIALGTY-DIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWL 64

Query: 77  -NDSGV-PREEIFVTTKLWSTQ--HHDPAAGLNDSLKRL-GLDYVDLYLMHWPVTLNPRS 131
             D G   REEIF TTKLW++Q  +    A +   L  + GL Y+DL L+H P+      
Sbjct: 65  NEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL------ 118

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
             +G+ L +                  +TW  MQE    G  +++GVSN+   ++ ++L+
Sbjct: 119 --EGSKLRL------------------ETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLN 158

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
            P  K  P VNQ+EI P + ++EL ++C SKG+++EA++PL   +   +T P L+ + K+
Sbjct: 159 WPELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL--CHGYKMTNPDLLKVCKE 216

Query: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEMREINN 300
                 Q++I W +Q GY+ LPK+   +R++ N      +LSDE+M+ +++
Sbjct: 217 VDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFLDH 267

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  159 bits (401), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 165/290 (56%), Gaps = 46/290 (15%)

Query: 21  FKLNTGATISAVGLGTW---QSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI- 76
           + L+ G  I ++ LGT+   +ST  N  YEA    LK GYRH DTA +Y NE +VG+ I 
Sbjct: 7   YTLSNGVKIPSLALGTYDLPKSTTANIVYEA----LKCGYRHFDTAVLYNNERKVGEGIY 62

Query: 77  -----NDSGVPREEIFVTTKLWSTQH-HDPAA-GLNDSLKRL-GLDYVDLYLMHWPVTLN 128
                +     RE++F TTKLW++Q+ + PA   + + L+++  L Y+DL L+H P++  
Sbjct: 63  QWLQEDPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLS-- 120

Query: 129 PRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKK 188
                            G R         ++T++ MQE    G  +++GVSN+  ++L++
Sbjct: 121 -----------------GSRKR-------LETYKAMQEAVDEGIVKSIGVSNYGQHHLEE 156

Query: 189 VLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINL 248
           +LS  G K  P VNQ+EI P   ++EL +WC S+GI++E Y+PL  T+   L +P L+ +
Sbjct: 157 LLSWEGLKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL--THGYKLKDPQLVKV 214

Query: 249 AKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEMR 296
           A++ G  T Q++I W +Q GY+ LPK+ + +R+  N      KL++ +++
Sbjct: 215 AEEVGKNTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDFKLTESQIK 264

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  158 bits (400), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 162/295 (54%), Gaps = 41/295 (13%)

Query: 18  TTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI- 76
           +TT  L  G  I  + LG +++  E E    V  ALK+GYRH+D A +YGNE +VG  I 
Sbjct: 6   STTKTLTNGVKIPVLALGVYEAPKE-ETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIA 64

Query: 77  ----NDSGVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRLG-LDYVDLYLMHWPVTLNP 129
                   V R EIF TTK+    H    A   +  SL+ +  ++Y+DL L+H P+    
Sbjct: 65  KFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAA-- 122

Query: 130 RSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKV 189
                                   T + + TW+ +QE    GK RA+GVSN+SI +L+++
Sbjct: 123 ------------------------TEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEEL 158

Query: 190 LSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLA 249
            +  G KV P VNQ E++P L ++EL E+C  KG++LEA+SPL  T     ++P L  L 
Sbjct: 159 YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELI 216

Query: 250 K-KHGVQT-AQIVISWHVQRGYIVLPKSVHAERIQANFKTL--KLSDEEMREINN 300
           K  +  QT AQI+I W +Q G+I LPKS +++R  +N + L  ++SD++M+ + +
Sbjct: 217 KTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  159 bits (403), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 105/314 (33%), Positives = 165/314 (52%), Gaps = 34/314 (10%)

Query: 18  TTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAIN 77
           T    LN G  +  VGLG W+  N+    + V  A+K GYR  D AA YGNE +VG+ IN
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQ-VYEAIKLGYRLFDGAADYGNEKEVGQGIN 60

Query: 78  ----DSGVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRLGLDYVDLYLMHWPVTLNPRS 131
               +  V R ++F+ +KLW+T HH       L  +L  LGLDY+DLY +H+P+      
Sbjct: 61  KALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFKYVP 120

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWD-----YVKTWELMQELPKTGKTRAVGVSNFSINNL 186
            ++      P    G  D +I         Y+ T+  M++L   G T+++GVSN   + L
Sbjct: 121 FEEK---YPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSIL 177

Query: 187 KKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG-----------ST 235
           + VL   G ++ PA  Q+E HP L QE L+++C ++ I + +YS  G           + 
Sbjct: 178 QDVLM--GCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAE 235

Query: 236 NAPILTE-PVLINLAKKHG--VQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTLK 289
           + P L + PV+  +A  HG  V T+++++ W  QR   ++PKS   ER+  N    + L 
Sbjct: 236 DTPALFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNEKLT 295

Query: 290 LSDEEMREINNISK 303
           L++ E+ EI+ ++K
Sbjct: 296 LTEAELLEISALNK 309

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  159 bits (401), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 105/310 (33%), Positives = 163/310 (52%), Gaps = 36/310 (11%)

Query: 23  LNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG----KAIND 78
           LN G  +  VGLG W+  NE    + V  A+K GYR  D A  YGNE +VG    KAI++
Sbjct: 7   LNNGMKMPLVGLGCWKIPNEVCASQ-VYEAIKIGYRLFDGAQDYGNEKEVGQGIRKAIDE 65

Query: 79  SGVPREEIFVTTKLWSTQHHDPA---AGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135
             V REE+FV +KLW++  HDP    A L  +L  + LDY+DL+ +H+P+ L     K+ 
Sbjct: 66  GIVKREELFVVSKLWNS-FHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVPFKEK 124

Query: 136 NFLSIPLLPDGKRDVEIDTWD-----YVKTWELMQELPKTGKTRAVGVSNFSINNLKKVL 190
                P L  G +D +  T        + T+  +++L   G  +++G+SNFS + +  +L
Sbjct: 125 ---YPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMDLL 181

Query: 191 SSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG------------STNAP 238
              G ++ P   Q+E HP L QE L+ +   +G+ + AYS  G             T  P
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTTPP 239

Query: 239 ILTEPVLINLAKKHG--VQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTLKLSDE 293
           +   P +I +AK HG  +  +Q+++ W  Q    V+PKS   ER+  N      L L+D+
Sbjct: 240 LFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLTDQ 299

Query: 294 EMREINNISK 303
           E++EI+ ++K
Sbjct: 300 ELKEISALNK 309

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  157 bits (396), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 167/294 (56%), Gaps = 46/294 (15%)

Query: 21  FKLNTGATISAVGLGTW---QSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI- 76
           + +  G  I ++ LG +   +S   N  YEA    LK GYRH DTA +YGNE +VG+ I 
Sbjct: 7   YTMVNGIKIPSLALGCYDIPRSQTANVVYEA----LKRGYRHFDTAVLYGNEKEVGEGIY 62

Query: 77  -----NDSGVPREEIFVTTKLWSTQH-HDPAA-GLNDSLKRLG-LDYVDLYLMHWPVTLN 128
                + +   RE++F TTKLW++Q+ + PA  G+++ + ++  L Y+DL L+H P++  
Sbjct: 63  KWLKEDPANNKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSPLS-G 121

Query: 129 PRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKK 188
           PR                 R +E        T++ MQE    G  +++GVSN+   ++++
Sbjct: 122 PR-----------------RRLE--------TYQAMQEAVDDGIVKSIGVSNYGKQHIEE 156

Query: 189 VLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINL 248
           +      K  P  NQ+EI P   +E+L  WC SKG+++EA+SPL  T+   L EP L++L
Sbjct: 157 LYKWDKLKHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL--THGYKLKEPGLVSL 214

Query: 249 AKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEMREINN 300
           AKK G  T Q++I W +QRG + LPK+ +  R+ +N +    +L+ E+++E+++
Sbjct: 215 AKKLGRDTGQVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPEDVKELDH 268

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  157 bits (396), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 100/308 (32%), Positives = 167/308 (54%), Gaps = 33/308 (10%)

Query: 23  LNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG----KAIND 78
           LN G  +  VGLG W+ +N+    E V  A+K GYR  D A  YGNE +VG    KAI++
Sbjct: 7   LNNGQKMPLVGLGCWKISNDICA-EQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKAIDE 65

Query: 79  SGVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKD-- 134
             V R ++FV +KLW++ HH       L  +L+ LGLDY+DLY +H+P+       ++  
Sbjct: 66  GLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPFEEKY 125

Query: 135 --GNFLSIPLLPDG-KRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
             G +  +    +G   + ++   D   T+  ++E    G  +++G+SNF+   ++ +L+
Sbjct: 126 PPGFYTGVDDAREGILSEAKVPILD---TYRALEECVDNGLIKSIGISNFNGVLVQDLLN 182

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG------------STNAPI 239
             G ++ P   Q+E HP L QE+L+E+C  KGI + AYS  G             +   +
Sbjct: 183 --GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPSL 240

Query: 240 LTEPVLINLAKKHGVQT-AQIVISWHVQRGYIVLPKSVHAERIQANFK---TLKLSDEEM 295
           L  P++  +A  H   T +++++ W  QRG  V+PKS   ER+  N     ++ L++EE+
Sbjct: 241 LEHPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEEEL 300

Query: 296 REINNISK 303
            EI++++K
Sbjct: 301 NEISSLNK 308

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  155 bits (392), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 160/291 (54%), Gaps = 40/291 (13%)

Query: 21  FKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI---- 76
           +KL+ G  I ++ LGT++    ++  E V   +K GYRH DTA +YGNE +VG  I    
Sbjct: 6   YKLSNGIKIPSIALGTYE-IPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWL 64

Query: 77  --NDSGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRL-GLDYVDLYLMHWPVTLNPRS 131
             +     R +IF TTKLW++Q  +    A +   L  + GL+Y+DL L+H P+      
Sbjct: 65  NEDPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL------ 118

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
             +G+ L +                  +TW  MQE    G  +++GVSN+   ++ ++L+
Sbjct: 119 --EGSKLRL------------------ETWRAMQEAVDAGVVKSIGVSNYGRKHIDELLN 158

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
               +  P VNQ+EI P + ++EL ++C SKG+++EA++PL   +   +T P L+ + K+
Sbjct: 159 WSELRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLIVCKE 216

Query: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFK--TLKLSDEEMREINN 300
                 Q++I W +Q GY+ LPK+   +R++ N    + +LSDE+M+ +++
Sbjct: 217 VDRNPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSDEQMKTLDH 267

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  156 bits (395), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 161/312 (51%), Gaps = 32/312 (10%)

Query: 18  TTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG---- 73
           ++   LN G  +  VGLG W+  N+    + V  A+K GYR  D A  YGNE +VG    
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCA-QQVYDAIKIGYRLFDGAEDYGNEKEVGQGIR 60

Query: 74  KAINDSGVPREEIFVTTKLWSTQHHDP--AAGLNDSLKRLGLDYVDLYLMHWPVTLNPRS 131
           KAI++  V RE++FV +KLW++ HH       L  +L  +GLDY+DL+ +H+P+      
Sbjct: 61  KAIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFKYVP 120

Query: 132 IKDGNFLSIPLLPDGKRD-----VEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNL 186
            ++      P    GK D     +       + T+  +++  + G  +++G+SNFS + +
Sbjct: 121 FEEK---YPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLV 177

Query: 187 KKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLI 246
           + +L     K+ P   QVE HP L QE L+E+C   GI + AYS  G  +   L  P+  
Sbjct: 178 QDLLRQC--KIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAK 235

Query: 247 N------------LAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTLKLS 291
           N            +A  H V T+Q+++ W  QRG  ++PKS   ER+Q N    + L L+
Sbjct: 236 NTPNLFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLT 295

Query: 292 DEEMREINNISK 303
            +E+  I+ ++K
Sbjct: 296 HKELEAISKLNK 307

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  156 bits (395), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 164/311 (52%), Gaps = 39/311 (12%)

Query: 23  LNTGATISAVGLGTWQ---STNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG----KA 75
           LN G  +  VGLG W+   ST   + Y+A+    K GYR  D A  YGNE +VG    +A
Sbjct: 7   LNNGLKMPLVGLGCWKIPTSTCAQQIYDAI----KVGYRLFDGATDYGNEKEVGQGIKRA 62

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLN--DSLKRLGLDYVDLYLMHWPVTLNPRSIK 133
           I++  V RE++F+ +KLW+  HH     LN   +LK LGLDYVDLY +H+P+     S  
Sbjct: 63  IDEGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVS-P 121

Query: 134 DGNFLSIPLLPDGKRD-----VEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKK 188
           D  +   P +  GK D     +  +    + T+  M++L   G  +++G+SN++   +  
Sbjct: 122 DERY--PPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVAD 179

Query: 189 VLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG------------STN 236
            L   G ++ P   Q+E HP L QE+LLE+C    + + AYS  G               
Sbjct: 180 TLR--GCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKNT 237

Query: 237 APILTEPVLINLAKKH-GVQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTLKLSD 292
            P+   P +  +A K+  V T+Q+++ W  QRG  ++PKS   ER+  N    + + L++
Sbjct: 238 PPLFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTLAE 297

Query: 293 EEMREINNISK 303
           E++REI+ +++
Sbjct: 298 EDLREISALNQ 308

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  155 bits (391), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 103/316 (32%), Positives = 169/316 (53%), Gaps = 28/316 (8%)

Query: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ 71
           MSA + T T  LN G  +  +GLG W+  N+    + V  A+K GYR  D A  YGNE +
Sbjct: 1   MSALSKTVT--LNNGLEMPLIGLGCWKIPNDVCASQ-VYEAIKLGYRLFDGAQDYGNEKE 57

Query: 72  VG----KAINDSGVPREEIFVTTKLWSTQHH--DPAAGLNDSLKRLGLDYVDLYLMHWPV 125
           VG    KAI +  V RE++FV +KLW++ HH  +    L  +L  +GLDY+DL+ +H+P+
Sbjct: 58  VGQGIKKAIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPL 117

Query: 126 TLNPRSIKDGNFLSIPLLPDGKRDVEIDTWD--YVKTWELMQELPKTGKTRAVGVSNFSI 183
                  ++          + +++  I   D   + T+  +++    G  +++G+SNF+ 
Sbjct: 118 AFKFVPFEEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNG 177

Query: 184 NNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPIL--- 240
           + ++ +L   G ++ P   Q+E HP L QE L+++C + GI + AYS  G  +   L   
Sbjct: 178 SLVQDLLR--GARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSE 235

Query: 241 ---TEPVLIN------LAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTL 288
              T P L        +A  H V T+Q+++ W  QRG  V+PKS   ER+  N     +L
Sbjct: 236 LAKTTPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSL 295

Query: 289 KLSDEEMREINNISKE 304
            LSD+E++ I+ ++K+
Sbjct: 296 TLSDKELKAISALNKD 311

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  154 bits (388), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 157/291 (53%), Gaps = 40/291 (13%)

Query: 21  FKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI---- 76
           + L+ G  I ++ LGT+     ++  E V   +K GYRH DTA +YGNE +VG  I    
Sbjct: 6   YNLSNGYRIPSIALGTY-DIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWL 64

Query: 77  --NDSGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRL-GLDYVDLYLMHWPVTLNPRS 131
             N     RE+IF TTKLW++Q  +    A +   L  + GL Y+DL L+H P+      
Sbjct: 65  NENPESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL------ 118

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
             +G+ L +                  +TW+ MQE    G  +++GVSN+   ++ ++L+
Sbjct: 119 --EGSKLRL------------------ETWQAMQEAVDEGVVKSIGVSNYGKKHIDELLT 158

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
            P     P VNQ+EI P + ++EL ++C SKG+++EA++PL   +   +T P L+ + K+
Sbjct: 159 WPDLTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLKVCKE 216

Query: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEMREINN 300
                 Q++I W +Q GY+ LPK+   +R++ N      +L D++M+ +++
Sbjct: 217 VDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYDFELLDKQMKILDH 267

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  154 bits (388), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 152/286 (53%), Gaps = 40/286 (13%)

Query: 21  FKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI---- 76
           +KL+ G +I +VGLGT+   N N     V  ALKAGYRH DTA +YGNE +VG+ I    
Sbjct: 9   YKLSNGYSIPSVGLGTYDIPN-NVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWL 67

Query: 77  --NDSGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRL-GLDYVDLYLMHWPVTLNPRS 131
             +     RE +F TTKLW++Q  +      + + L ++  L+Y+DL L+H P+      
Sbjct: 68  LEDPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPL------ 121

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
              G  L +                  +TW+ MQE    G  +++GVSN+ ++++ ++L+
Sbjct: 122 --GGTKLRL------------------ETWKAMQEAVDHGMVKSIGVSNYGMHHIDELLT 161

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
               K  P VNQ+EI P L ++EL ++C S  I +E YSPL  T+   L +  L  +A +
Sbjct: 162 WQYLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQDLKKVANE 219

Query: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEM 295
            G    Q++I W +Q GYI LPK+    R++ N       L+ ++M
Sbjct: 220 TGKNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDFNLTSDQM 265

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  154 bits (388), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 100/310 (32%), Positives = 162/310 (52%), Gaps = 32/310 (10%)

Query: 20  TFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG----KA 75
           T  LN G  +  VGLG W+  N+    + +  A+K GYR  D A  Y NE +VG    +A
Sbjct: 7   TVTLNNGEKMPLVGLGCWKMPNDVCA-DQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRA 65

Query: 76  INDSGVPREEIFVTTKLWSTQHH--DPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIK 133
           I +  V RE++ V +KLW++ HH  +    L  +L  L LDYVD++ +H+P+   P    
Sbjct: 66  IKEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPFD 125

Query: 134 DGNFLSIPLLPDGKRD-----VEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKK 188
           +      P    GK D     +E +    + TW  +++L   GK +++G+SNFS   ++ 
Sbjct: 126 EK---YPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQD 182

Query: 189 VLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG-----------STNA 237
           +L   G ++ P   Q+E HP L QE L+++  + GI + AYS  G           + N 
Sbjct: 183 LLR--GARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNT 240

Query: 238 PILTEPVLI-NLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFK---TLKLSDE 293
           P L E   I ++A KH V   Q+++ W  Q G  ++PKS   ER+  N +    L L+D+
Sbjct: 241 PTLFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDD 300

Query: 294 EMREINNISK 303
           E+++I+ +++
Sbjct: 301 ELKQISGLNQ 310

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  152 bits (385), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 162/294 (55%), Gaps = 46/294 (15%)

Query: 21  FKLNTGATISAVGLGTW---QSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI- 76
           +  N G  I ++ LGT+   QS      YEA    LKAGYRH DTA +YGNE QVG+ I 
Sbjct: 8   YTFNNGNQIPSIALGTYDIPQSITAKIVYEA----LKAGYRHFDTAVLYGNEHQVGEGIL 63

Query: 77  -----NDSGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRL-GLDYVDLYLMHWPVTLN 128
                +     R ++F TTKLW++Q  +H     + + L ++ GL Y+D+ L+H P  L 
Sbjct: 64  QWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSP--LE 121

Query: 129 PRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKK 188
            R+               KR         ++TW  MQE  ++G  + +GVSN+   ++++
Sbjct: 122 GRT---------------KR---------LETWRAMQEAVESGLVKNIGVSNYGRQHVEE 157

Query: 189 VLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINL 248
           +L      + P VNQ+EI P + + EL ++C S G+++EA++PL  T+   L +  L+ +
Sbjct: 158 LLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRV 215

Query: 249 AKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEMREINN 300
           +K+ G  T Q++I W +Q GY+ LPK+   +R++ N +    +L+ E+M+ I++
Sbjct: 216 SKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  153 bits (386), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/315 (32%), Positives = 168/315 (53%), Gaps = 34/315 (10%)

Query: 17  STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG--- 73
           ++ T KLN G  +  VGLG W+  NE    + V  A+K GYR  D A  YGNE +VG   
Sbjct: 4   TSETVKLNNGLQMPLVGLGCWKIPNEVCASQ-VYEAIKLGYRLFDGAQDYGNEKEVGQGI 62

Query: 74  -KAINDSGVPREEIFVTTKLWSTQHHDPA---AGLNDSLKRLGLDYVDLYLMHWPVTLNP 129
            KAI++  V RE++FV +KLW++ +HDP      L  +L+ + L+Y+DL+ +H+P+    
Sbjct: 63  HKAIDEGIVKREDLFVVSKLWNS-YHDPKNVKKALKRTLEDMELEYLDLFYIHFPLAFKY 121

Query: 130 RSIKDGNFLSIPLLPDGKRD-----VEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSIN 184
              ++      P    G  D     + ++    + T+  ++E  K G  +++G+SNF   
Sbjct: 122 VPFEEK---YPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGI 178

Query: 185 NLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG----------- 233
            +  +L+  G  + P   Q+E HP L QE+L+E+C  + I + AYS  G           
Sbjct: 179 LIHDLLA--GATIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSEL 236

Query: 234 STNAPILTEPVLIN-LAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT---LK 289
           + + P L E   I  +A  HGV ++Q+++ W  QR   ++PKS   ER+  N +    L 
Sbjct: 237 AKSTPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKLT 296

Query: 290 LSDEEMREINNISKE 304
           L++ E++EI+ ++K+
Sbjct: 297 LTEAELQEISALNKD 311

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  152 bits (385), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 163/310 (52%), Gaps = 40/310 (12%)

Query: 23  LNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAIN----D 78
           LN G  +  VGLG W+  N+    + V  A+K GYR  D A  YGNE +VG+ IN    +
Sbjct: 7   LNNGLKMPIVGLGCWKIPNDTCAAQ-VYEAIKLGYRAFDGAQDYGNEKEVGEGINQAISE 65

Query: 79  SGVPREEIFVTTKLWSTQHHDPA---AGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKD- 134
             V REE+FV +KLW++ +HDP      L  +L  + LDY+DLY +H+P+       ++ 
Sbjct: 66  GIVKREELFVISKLWNS-YHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVPFEEK 124

Query: 135 --GNFLSIPLLPDGKRDVEI-----DTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLK 187
               F +      GK D E      +    + T+  M++L   G  +++G+SNF+   ++
Sbjct: 125 YPAGFYT------GKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQ 178

Query: 188 KVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG-----------STN 236
            +L S   K+ P   Q+E HP L Q  L+E+C    I + AYS  G           + +
Sbjct: 179 DLLRS--CKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALD 236

Query: 237 APILTE-PVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTLKLSD 292
           A +L E  V+ ++A  H V+ +Q+++ W  QRG  ++PKS   ER+  N    + L LS+
Sbjct: 237 AKVLFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLSE 296

Query: 293 EEMREINNIS 302
           +E+  I++++
Sbjct: 297 QELSTISDLN 306

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  151 bits (382), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 151/284 (53%), Gaps = 40/284 (14%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75
           N  T +KLN G  +  +G G +    E E  + V  AL+ GYRHIDTA +Y N+ Q  + 
Sbjct: 8   NRDTRYKLNNGTEVPVIGFGVYDIPVE-ETAQRVYTALQEGYRHIDTAVVYENQKQAAQG 66

Query: 76  IN----DSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLD------YVDLYLMHWPV 125
           ++    ++G PREE++ TTKLW+TQ    A     +L+ +  D      YVDL L+H P+
Sbjct: 67  VHRFLEETGTPREEVWFTTKLWNTQQGRDATP--RALEEIAADVKEFIGYVDLLLLHSPL 124

Query: 126 TLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTG-KTRAVGVSNFSIN 184
           T                  D +R +E  TW  ++    +QE   +  + RA+GVSNF + 
Sbjct: 125 T------------------DAQRRLE--TWAVLE--RAVQEPASSALEIRAIGVSNFGVR 162

Query: 185 NLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPV 244
           +L+++L      V P V+Q+E+HP LP+ EL  +    GIL EAYSPL  T    L +P 
Sbjct: 163 HLQELLEVA--TVKPVVDQLELHPWLPRAELRAFLRENGILAEAYSPL--TQGVRLQDPE 218

Query: 245 LINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTL 288
           L+ L  K G+   +I++ W   +G+ VL KS + +RI+ N   L
Sbjct: 219 LLALEAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVL 262

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  152 bits (383), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 102/307 (33%), Positives = 161/307 (52%), Gaps = 33/307 (10%)

Query: 23  LNTGATISAVGLGTWQSTNE---NEGYEAVIAALKAGYRHIDTAAIYGNEGQVG----KA 75
           LN G  +  VGLG W+  N+   N+ YEA+    K GYR  D A  YGNE +VG    KA
Sbjct: 7   LNNGCKMPLVGLGCWKIDNKVCANQIYEAI----KLGYRLFDGACDYGNEKEVGEGIRKA 62

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRLGLDYVDLYLMHWPVTLN--PRS 131
           I++  V R++IFVT+KLW+  HH       L  +L  +GLDY+DLY +H+P+     P  
Sbjct: 63  ISEGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPFE 122

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
            K           D +  +       + T+  ++     G  +++G+SNF  + ++ +L 
Sbjct: 123 EKYPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDLLR 182

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG-----------STNAPIL 240
             G ++ P   Q+E HP L QE L+++C    I + AYS  G           + + P L
Sbjct: 183 --GCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTPTL 240

Query: 241 TE-PVLINLAKKH-GVQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTLKLSDEEM 295
            E  V+  +++ H G  T+Q+++ W  QRG  V+PKS   ER+  N    K L L+D+E+
Sbjct: 241 FENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTDQEL 300

Query: 296 REINNIS 302
           +EI++++
Sbjct: 301 KEISSLN 307

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  150 bits (378), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 89/291 (30%), Positives = 158/291 (54%), Gaps = 40/291 (13%)

Query: 21  FKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI---- 76
           +K + G  + ++ LGT+     ++  E V   +K GYRH DTA +YGNE +VG  I    
Sbjct: 6   YKFSNGYKVPSIALGTY-DIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWL 64

Query: 77  --NDSGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRL-GLDYVDLYLMHWPVTLNPRS 131
             +     RE++F TTKLW++Q  +      +   L  + GL Y+DL L+H P+      
Sbjct: 65  HEDPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL------ 118

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
             +G+ L +                  +TW+ MQE    G  +++GVSN+   ++ ++L+
Sbjct: 119 --EGSKLRL------------------ETWQAMQEAVDEGMVKSIGVSNYGKKHVDELLN 158

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
               K  P VNQ+EI P + ++EL ++C SK +++EA++PL   +   +T+P L+ + K+
Sbjct: 159 WSQLKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL--CHGYKMTDPDLLKVCKE 216

Query: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEMREINN 300
                 Q++I W +Q GY+ LPK+   +R+++N      +LSD++M+ +++
Sbjct: 217 VDRNPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSDDQMKILDH 267

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  149 bits (377), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 162/293 (55%), Gaps = 41/293 (13%)

Query: 20  TFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAIND- 78
           T+KL++   I  V LGT+   + +E  E V  AL  GYRH DTA +Y NE +V + I++ 
Sbjct: 8   TYKLSSNYYIPTVALGTYDLPS-SETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNW 66

Query: 79  ----SGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRL-GLDYVDLYLMHWPVTLNPRS 131
                   R+EIF TTKLW++Q  + +    + + + ++  L Y+DL LMH P+   P+ 
Sbjct: 67  LIRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPIG-GPQ- 124

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
           I++                        +TW  MQE    G  +++GVSNF I +LK++  
Sbjct: 125 IRE------------------------ETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQ 160

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
             G K  P VNQ+EI P L ++EL ++C  +G+++EAY+PL  T+   +  P LI ++ +
Sbjct: 161 WDGLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPL--THGYKINHPDLIKISNE 218

Query: 252 --HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEMREINN 300
             +   T QI+I W +Q GY+ LPK+    R+++N      +L++++M+ +++
Sbjct: 219 LNNTKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDVYDFELTEDQMKFLDH 271

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  150 bits (378), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 104/309 (33%), Positives = 162/309 (52%), Gaps = 58/309 (18%)

Query: 21  FKLNTGATISAV---GLGT-WQSTNENEGY--EAVIAALKA------GYRHIDTAAIYGN 68
           F L+ G  I AV   G GT W  + E +    + ++  +K       G  HID A IY  
Sbjct: 7   FTLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIYRT 66

Query: 69  EGQVGKAINDSGVPREEIFVTTKLWSTQH--HDPAAGLNDSLKRLGLDYVDLYLMHWPVT 126
             ++G A+ D+  PR+EIF+T K  + +    +P   L  SLK+LG+DYVDLYL+H P+ 
Sbjct: 67  YPELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLHSPI- 125

Query: 127 LNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNL 186
                           + + K DVE +       W+ ++EL K+GK + +GVSNF++ +L
Sbjct: 126 ----------------IKESKLDVEAN-------WKYLEELYKSGKAKNIGVSNFAVKDL 162

Query: 187 KKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLGSTNAPILTEP- 243
           +K+L+    +V P VNQ+E  P L  +   ++E+    GILLEAYSPLG    P+   P 
Sbjct: 163 EKLLAVA--EVKPQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPLG----PLQRRPE 216

Query: 244 ---------VLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQ--ANFKTLKLSD 292
                     +  L+KK+    AQI++SW  +RG + +  S   ERIQ   +  +  L++
Sbjct: 217 DADKLPFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLAN 276

Query: 293 EEMREINNI 301
           EE+++I  +
Sbjct: 277 EEVQKITQL 285

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  149 bits (377), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 98/290 (33%), Positives = 153/290 (52%), Gaps = 41/290 (14%)

Query: 22  KLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI----- 76
           +L+ G  I +VGLG +Q  +E    + V  AL+ GYR  D+A  Y NE  V + I     
Sbjct: 14  RLSDGTQIPSVGLGVYQ-VSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLK 72

Query: 77  NDSGVPREEIFVTTKLWSTQHHDPAA---GLNDSLKRLG-LDYVDLYLMHWPVTLNPRSI 132
           +  G  RE+++ TTK+ +TQ+H   A    L  SL   G L Y+DL L+H P++   R +
Sbjct: 73  HAPGRRREDVYFTTKI-NTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRRL 131

Query: 133 KDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSS 192
                                      TW+ ++E    G+ R++GVSN+   +L ++L  
Sbjct: 132 --------------------------GTWQALEEAVVEGQVRSIGVSNYGQQHLSELLGW 165

Query: 193 PGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKH 252
            G K+ P VNQVEI+P L ++EL+++C    I ++A+SPL       L +P+L  +A ++
Sbjct: 166 EGLKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPL--MRGKRLDDPILQKVAHQY 223

Query: 253 GVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEMREINN 300
               AQI++ W +Q G+IVLPK+   ER+  NF     +LS E M E+ +
Sbjct: 224 DKGVAQILVRWSIQMGFIVLPKAAKKERLAPNFDIWDFELSAETMSELTH 273

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  147 bits (370), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/291 (29%), Positives = 161/291 (55%), Gaps = 40/291 (13%)

Query: 21  FKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI---- 76
           ++L  G  I ++ LGT+   N     + V  ALK GYRH DTA +YGNE +VG+ I    
Sbjct: 11  YELQDGRKIPSLALGTYDIPNSVTA-KVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWI 69

Query: 77  --NDSGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRL-GLDYVDLYLMHWPVTLNPRS 131
             + +   RE++F TTKLW++Q  +++    + + ++++ GL Y+D+ L+H P++   R 
Sbjct: 70  NEDKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPLSGQRRR 129

Query: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
           ++                          TW+ MQE    G  +++GVSN+  ++++++L 
Sbjct: 130 LE--------------------------TWKAMQEAVDEGIVKSIGVSNYGKHHIEELLG 163

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251
               K  P VNQ+EI P + ++EL ++C S  +++EAY+P+   +   + +P L  ++K+
Sbjct: 164 WDELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMA--HGYKMNDPGLREISKE 221

Query: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTL--KLSDEEMREINN 300
            G+   Q++I W +Q GY+ LPK+    R+ +N      KL+ ++++ +++
Sbjct: 222 TGMNPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVYNHKLTLDQVKRMDH 272

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  147 bits (372), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 110/326 (33%), Positives = 162/326 (49%), Gaps = 59/326 (18%)

Query: 21  FKLNTG---ATISAVGLGT-W------QSTNENEGYEAVIAALK-AGYRHIDTAAIYGNE 69
           F LN G    +IS +G GT W      + T  +E  E +  AL   G  HID A  YG  
Sbjct: 8   FDLNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTY 67

Query: 70  GQVGKAINDSGVPREEIFVTTKLWSTQH---HDPAAGLNDSLKRLGLDYVDLYLMHWPVT 126
            ++ KA+ +S  PR EIF+T K +STQ    +DP  GLN  LK LGLDYVDLYL+H P  
Sbjct: 68  PELAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIHSPF- 125

Query: 127 LNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNL 186
                            P+ K  + ++     K W+ M+ L K GK +++GVSNFS+ N+
Sbjct: 126 ---------------FDPEFKGSLTLE-----KVWKDMETLYKEGKAKSIGVSNFSVKNI 165

Query: 187 KKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLGSTNAPILTEP- 243
           +++L   G  + P VNQ+E +  L  +   ++ +C    I LEAYSPLG    P+   P 
Sbjct: 166 EEILKIAG--IKPQVNQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPLG----PLQKRPE 219

Query: 244 ---------VLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERI--QANFKTLKLSD 292
                     +  LA K+G   +QI+++W   RG + +  S   +RI    N  +  L+ 
Sbjct: 220 NSNELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTK 279

Query: 293 EEMREINNISKEKGERRIVQPHWEPF 318
           +E+  +  +  E+   RI   +W  F
Sbjct: 280 DEVDTLTKLGLEQPALRI---YWTNF 302

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  146 bits (369), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 147/283 (51%), Gaps = 38/283 (13%)

Query: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ---- 71
           N  T +KLN G  I  +G G ++   E+   + V +ALK GYRHIDTA +Y N+ +    
Sbjct: 8   NRETRYKLNNGQQIPVIGFGVYEIPKEDTA-DLVYSALKDGYRHIDTAVLYKNQKEAAQG 66

Query: 72  VGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLD------YVDLYLMHWPV 125
           V K ++++G  RE I+ TTKLW +Q          +L+ +  D      YVDL L+H P 
Sbjct: 67  VRKYLDETGEARENIWFTTKLWDSQFGREET--EKALQEVAADVKEYIGYVDLLLLHSPR 124

Query: 126 TLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINN 185
               R ++    L   +   G + +EI                     +++GVSNF +++
Sbjct: 125 GGAKRRLETWAILEQAVQEPGSKALEI---------------------KSIGVSNFGVDH 163

Query: 186 LKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVL 245
           L+++L     KV P ++Q+E+HP LP+ EL ++   K I  EAYSPL  T    L +P L
Sbjct: 164 LEELLKVA--KVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPL--TQGYRLQDPEL 219

Query: 246 INLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTL 288
           + L  K G+  A I++ W   +G++VL KS + ERI+ N   L
Sbjct: 220 LALEAKTGINKAVILLRWSFLQGFVVLVKSSNPERIRQNLAVL 262

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  146 bits (369), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 157/307 (51%), Gaps = 33/307 (10%)

Query: 23  LNTGATISAVGLGTWQ---STNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG----KA 75
           LN G  +  VGLG W+       N+ YEA+    K GYR  D A  YGNE +VG    KA
Sbjct: 7   LNNGLKMPLVGLGCWKIDKKVCANQIYEAI----KLGYRLFDGACDYGNEKEVGEGIRKA 62

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRLGLDYVDLYLMHWPVTLNPRSIK 133
           I++  V R++IFV +KLW+  HH       L  +L  +GLDY+DLY +H+P+       +
Sbjct: 63  ISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPFE 122

Query: 134 DGNFLSIPLLPDGKRDVEIDTWDY--VKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
           +          D ++   I       + T+  ++E    G  +++GVSNF  + ++ +L 
Sbjct: 123 EKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLLR 182

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG-----------STNAPIL 240
             G ++ P   Q+E HP L QE L+E+C    I + AYS  G           +   P L
Sbjct: 183 --GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPTL 240

Query: 241 TE-PVLINLAKKH-GVQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTLKLSDEEM 295
            E  V+  +++ H G  T+Q+++ W  QRG  V+PKS   ER+  N    K   L+++E+
Sbjct: 241 FENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQEL 300

Query: 296 REINNIS 302
           ++I+ ++
Sbjct: 301 KDISALN 307

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  144 bits (362), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 107/303 (35%), Positives = 157/303 (51%), Gaps = 49/303 (16%)

Query: 23  LNTGATISAV---GLGT-W------QSTNENEGYEAVIAALKA-GYRHIDTAAIYGNEGQ 71
           LN G  I A+   G GT W       +T  N   E ++ AL+  G  HID A IY    +
Sbjct: 10  LNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTYPE 69

Query: 72  VGKAINDSGVPREEIFVTTKLWSTQ---HHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLN 128
           VGKA++ +  PR+EIF+T K +STQ      PAAGL  SLK++G DYVDLYL+H P    
Sbjct: 70  VGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSPFV-- 126

Query: 129 PRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKK 188
               K+ N  ++                  + W+ M++L K GK + +GVSNF++ +L+K
Sbjct: 127 ---SKEANGFTLE-----------------EAWKDMEQLYKAGKAKNIGVSNFAVKDLEK 166

Query: 189 VLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLG---STNAPILTEP 243
           +L     +V P VNQ+E  P L  +   + ++C    ILLEAYSPL       A   ++P
Sbjct: 167 ILKIA--EVKPQVNQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPLAPLQKKTAQDDSKP 224

Query: 244 VL---INLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQ--ANFKTLKLSDEEMREI 298
                  L++K+    AQI++ W  +RG + +  S   +RI    N  +  L+DEE+ EI
Sbjct: 225 FFEYVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVDEI 284

Query: 299 NNI 301
             +
Sbjct: 285 TEL 287

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  144 bits (362), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 97/309 (31%), Positives = 158/309 (51%), Gaps = 37/309 (11%)

Query: 23  LNTGATISAVGLGTWQ---STNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG----KA 75
           LN G  +  VGLG W+       N+ YEA+    K GYR  D A  YGNE +VG    +A
Sbjct: 7   LNNGLKMPLVGLGCWKIDKKVCANQIYEAI----KLGYRLFDGACDYGNEKEVGEGIRRA 62

Query: 76  INDSGVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRLGLDYVDLYLMHWPVTLNPRSIK 133
           I++  V R+++FV +KLW+  HH       L  +L  +GLDY+DLY +H+P+       +
Sbjct: 63  ISEGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVPFE 122

Query: 134 D----GNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKV 189
           +    G +  +    + K  +       + T+  ++E    G  +++G+SNF  + ++ +
Sbjct: 123 EKYPPGFYTGVD--DEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQDL 180

Query: 190 LSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG-----------STNAP 238
           L   G ++ P   Q+E HP L QE L+E+C    I + AYS  G           +   P
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTTP 238

Query: 239 ILTE-PVLINLAKKH-GVQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTLKLSDE 293
            L E  V+  ++  H G  T+Q+++ W  QRG  V+PKS   ER+  N    K   L+++
Sbjct: 239 TLFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQ 298

Query: 294 EMREINNIS 302
           E++EI+ ++
Sbjct: 299 ELKEISALN 307

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  142 bits (357), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 93/307 (30%), Positives = 153/307 (49%), Gaps = 33/307 (10%)

Query: 23  LNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVG----KAIND 78
           LN G  +  VGLG W+  ++N     +  A+K GYR  D A  YGNE +VG    KAI +
Sbjct: 7   LNNGLKMPLVGLGCWK-IDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAIYE 65

Query: 79  SGVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136
             V R+++FV +KLW+  HH       L  +L  +GLDY+DLY +H+P+       ++  
Sbjct: 66  GLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYIPFEEK- 124

Query: 137 FLSIPLLPDGKRDVEIDTWD-----YVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191
               P    G  D E           + T+  +++    G  +++G+SNF  + ++ +L 
Sbjct: 125 --YPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQDLLR 182

Query: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLG------------STNAPI 239
             G ++ P   Q+E HP L QE L+E+C    I + AYS  G                 +
Sbjct: 183 --GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKATQTL 240

Query: 240 LTEPVLINLAKKH-GVQTAQIVISWHVQRGYIVLPKSVHAERIQANF---KTLKLSDEEM 295
               V+  +++ H G  T+Q+++ W  QRG  V+PKS   ER+  N    K   L+++E+
Sbjct: 241 FENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLTEQEL 300

Query: 296 REINNIS 302
           ++I+ ++
Sbjct: 301 KKISALN 307

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  141 bits (355), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 105/312 (33%), Positives = 159/312 (50%), Gaps = 49/312 (15%)

Query: 23  LNTGATISAV---GLGT-W------QSTNENEGYEAVIAALKA-GYRHIDTAAIYGNEGQ 71
           LN G  I A+   G GT W       +T  N   E ++ ALK  G  HID A IY    +
Sbjct: 10  LNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYPE 69

Query: 72  VGKAINDSGVPREEIFVTTKLWSTQ---HHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLN 128
           VGKA++ +  PR EIF+T K +STQ      PA GL+ +LK++G DYVDLYL+H P    
Sbjct: 70  VGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSP---- 124

Query: 129 PRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKK 188
                   F+S           E + +   + W+ M++L ++GK + +GVSNF++ +L++
Sbjct: 125 --------FVS----------KETNGFTLEEAWKDMEQLYRSGKAKNIGVSNFAMKDLER 166

Query: 189 VLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLGSTNAPILTEPVL- 245
           +L     ++ P VNQ+E  P L  +   + ++C    ILLEAYSPLG        +  L 
Sbjct: 167 ILKVA--EIRPQVNQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDESLP 224

Query: 246 -----INLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQ--ANFKTLKLSDEEMREI 298
                  L++K+    AQI + W  +RG + +  S   +RI    N  +  L+DEE+ +I
Sbjct: 225 FFEYVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVNQI 284

Query: 299 NNISKEKGERRI 310
             +  E    R+
Sbjct: 285 TELGLEHEPLRL 296

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  140 bits (353), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 107/318 (33%), Positives = 159/318 (50%), Gaps = 53/318 (16%)

Query: 21  FKLNTGATISAV---GLGT-WQSTNENEGY-------EAVIAALKAGYRHIDTAAIYGNE 69
           F LN G  I A+   G GT W  T E +         E  +A    G  HID A IY   
Sbjct: 8   FTLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTY 67

Query: 70  GQVGKAINDSGVPREEIFVTTKLWSTQ---HHDPAAGLNDSLKRLGLDYVDLYLMHWPVT 126
            +V  A+ +S  PR+EIF+T K +STQ     DP AGLN SLK LGLDYVDLYL+H P  
Sbjct: 68  PEVAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSPF- 125

Query: 127 LNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNL 186
                IK+G+ L                    + W+ M++L K+GK + +GVSNF + +L
Sbjct: 126 -----IKNGSTLE-------------------ECWKQMEKLYKSGKAKNIGVSNFRVEDL 161

Query: 187 KKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLGSTNAPILTEP- 243
           +K+L     K  P +NQ+E +  L  +   ++++C    I LEAY+PLG     I   P 
Sbjct: 162 EKILKIATIK--PQINQIEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQR-IQDTPE 218

Query: 244 ------VLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMRE 297
                  +  L+KK+    AQI++ W  +RG + +  S   +R+  + + L   D E  E
Sbjct: 219 AKPFYDYIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLH-DAQNLFSFDLESSE 277

Query: 298 INNISKEKGERRIVQPHW 315
           ++ I++   + +  + +W
Sbjct: 278 VDKITELGLKLKATRLYW 295

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  136 bits (343), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 106/314 (33%), Positives = 159/314 (50%), Gaps = 49/314 (15%)

Query: 21  FKLNTGATISAV---GLGTWQSTNE-------NEGYEAVIAALKA-GYRHIDTAAIYGNE 69
           F LN G  I A+   G GT    NE       N   E ++ ALK  G  HID A IY   
Sbjct: 8   FTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 70  GQVGKAINDSGVPREEIFVTTKLWSTQ---HHDPAAGLNDSLKRLGLDYVDLYLMHWPVT 126
            +VGKA++ +  PR  IF+T K +S Q      PA GL+ +LK++G DYVDLYL+H P  
Sbjct: 68  PEVGKALSLTEKPRNAIFLTDK-YSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSPFV 126

Query: 127 LNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNL 186
                 K+ N LS+                  + W+ M++L K+GK + +GVSNF++ +L
Sbjct: 127 -----SKEVNGLSLE-----------------EAWKDMEQLYKSGKAKNIGVSNFAVEDL 164

Query: 187 KKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLG---STNAPILT 241
           +++L     +V P VNQ+E  P L  +   + ++C    IL+EAYSPLG      A   +
Sbjct: 165 QRILKVA--EVKPQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDS 222

Query: 242 EPVL---INLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQ--ANFKTLKLSDEEMR 296
           +P       L++K+    AQI++ W  +RG + +  S   +RI    N  +  L+ EE+ 
Sbjct: 223 QPFFEYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVD 282

Query: 297 EINNISKEKGERRI 310
           +I  +  E    R+
Sbjct: 283 KITELGLEHEPLRL 296

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  136 bits (342), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 154/308 (50%), Gaps = 55/308 (17%)

Query: 21  FKLNTGAT---ISAVGLGT-WQSTNE-NEGY-EAVIAALKA-----GYRHIDTAAIYGNE 69
           FKLN G     ++ VG GT W   NE +E + + ++  LK      G  H+D A  Y   
Sbjct: 7   FKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTY 66

Query: 70  GQVGKAINDSGVPREEIFVTTKLWSTQH--HDPAAGLNDSLKRLGLDYVDLYLMHWPVTL 127
            +VG+A+ ++  PR+EIF+T K W+      +P  GL   LKRLGL+YVDLYL+H P   
Sbjct: 67  REVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSP--- 123

Query: 128 NPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLK 187
                    F+S           E + +   + W +M+EL  +GK + +GVSNF+  +L+
Sbjct: 124 ---------FIS----------KETNGFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLE 164

Query: 188 KVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLGSTNAPILTEPV- 244
           +VL     KV P VNQ+E +  L  +   +  +C    I L AYSPLG    P+  +P  
Sbjct: 165 RVLKVC--KVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLG----PLQKKPAD 218

Query: 245 --------LIN-LAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLK--LSDE 293
                    IN LA+ +     Q+++ W  +RG + +  S   ERI+   +  +  L D+
Sbjct: 219 GNSQPFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDD 278

Query: 294 EMREINNI 301
           E+ EI  +
Sbjct: 279 EVTEITKL 286

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  135 bits (340), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 104/310 (33%), Positives = 149/310 (48%), Gaps = 47/310 (15%)

Query: 15  SNSTTTFKLNTGATISAV---GLGT-WQSTNE------NEGYEAVIAALKA-GYRHIDTA 63
           S++     LN G  + AV   G GT W    E      +E  E +  AL   G  HID A
Sbjct: 2   SHNQAFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDAA 61

Query: 64  AIYGNEGQVGKAINDSGVPREEIFVTTK--LWSTQHHDPAAGLNDSLKRLGLDYVDLYLM 121
            +YG   ++  A+  +  PR EIF+T K  L +    DP AGL DSLK   LDYVDLYL+
Sbjct: 62  EMYGTYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYLL 121

Query: 122 HWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNF 181
           H P     +           L  +G              W  M++L K GK + +GVSNF
Sbjct: 122 HSPFVAKEKP---------GLTLEG-------------AWRQMEQLYKDGKAKNIGVSNF 159

Query: 182 SINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLGSTNAPI 239
           S+ +LK+VLS    ++ P VNQ+E HP L  +   +L++C  + I LEA++PLG      
Sbjct: 160 SVEDLKRVLSVA--EIKPQVNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVKT 217

Query: 240 LTE------PVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERI--QANFKTLKLS 291
             +        + +L+ K+    AQI++ W  +RG I +  S   +RI    N     L 
Sbjct: 218 QEDENDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDLE 277

Query: 292 DEEMREINNI 301
           DEE+ +I  +
Sbjct: 278 DEEVTKITRL 287

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  131 bits (330), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 104/324 (32%), Positives = 158/324 (48%), Gaps = 59/324 (18%)

Query: 21  FKLNTGATISAV---GLGT-WQSTNE-----NEGYEAVIAALKA-GYRHIDTAAIYGNEG 70
           F LN G  I AV   G GT W++  +     NE  +    AL   G  H+D A  Y    
Sbjct: 8   FTLNNGNKIRAVAIIGTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAAEYYRTYP 67

Query: 71  QVGKAINDSGVPREEIFVTTKLWSTQH--HDPAAGLNDSLKRLGLDYVDLYLMHWPVTLN 128
           ++ KA+ +S  PR EIF+T K  +      +P   LN +L  LGLDYVDLY++H+P   +
Sbjct: 68  ELNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGLDYVDLYVLHFP-EFD 126

Query: 129 PRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKK 188
           P                  +D+ I+T      W  M+ L K GK + +GVSNFSI +L++
Sbjct: 127 PEY----------------KDLSIET-----AW--MELLYKEGKAKNIGVSNFSIEHLER 163

Query: 189 VLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLGSTNAPILTEPVLI 246
           V+      V P VNQ+E +  L  +   ++++C   G  LEAYSPL    AP+  +P   
Sbjct: 164 VMKIAD--VKPQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSPL----APLQRKPKNF 217

Query: 247 N----------LAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERI--QANFKTLKLSDEE 294
           N          ++ K+G   ++I++ W  +RG + +  S   ERI    N  +  L+DEE
Sbjct: 218 NELPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIVNAQNLFSFDLTDEE 277

Query: 295 MREINNISKEKGERRIVQPHWEPF 318
           + +I  +  E+   R+   +W  F
Sbjct: 278 VDKITKLGLEQPALRL---YWNEF 298

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  130 bits (327), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 135/271 (49%), Gaps = 37/271 (13%)

Query: 47  EAVIAALKAGYRHIDTAAIYGNEGQVGKAINDSGVPREEIFVTTKL----WS-TQHHDPA 101
           + ++ A+  G+ HIDTA  Y    +VG+A+  S +PR+++F+T K     W+      P 
Sbjct: 48  DQLVTAVDLGFNHIDTAEFYLTHEEVGEALRRSQLPRDKLFITDKYNQGAWTGLDCSGPI 107

Query: 102 AGLNDSLKRLGLDYVDLYLMHWP-VTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKT 160
                 L+ LG+ Y DLY++H P +T     I                       D  + 
Sbjct: 108 QAAKKGLEALGIKYFDLYMLHRPDITKENAGI-----------------------DLQEA 144

Query: 161 WELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEW 218
           W  ++EL + G  +A+GVSNF +  LK++ S    + +P V+QVE HP L  +   ++EW
Sbjct: 145 WRQVEELYEAGIAKAIGVSNFPLETLKQMESY--CRYLPMVHQVEFHPYLQNQSPGVVEW 202

Query: 219 CHSKGILLEAYSPLGS--TNAPILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSV 276
           C +K I++EAYSPL       P   + +L NL KK+G    QIV+ W + RG + L  S 
Sbjct: 203 CQNKHIVVEAYSPLAPLFRARPGPLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSS 262

Query: 277 HAERIQANFKTL--KLSDEEMREINNISKEK 305
             ERI     TL  +L   ++  IN +  +K
Sbjct: 263 KEERIHEILGTLDFELEKSDVELINEVGSKK 293

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  129 bits (325), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 150/311 (48%), Gaps = 48/311 (15%)

Query: 15  SNSTTTFKLNTG---ATISAVGLGT-WQSTNENEGY--EAVIAALKA-----GYRHIDTA 63
           S S   F LN G     IS +G GT W       G   + ++  L+      G  HID A
Sbjct: 2   SFSQEFFTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDAA 61

Query: 64  AIYGNEGQVGKAINDSGVPREEIFVTTKLWSTQ---HHDPAAGLNDSLKRLGLDYVDLYL 120
            +Y    +V KA+  +   R+EIF+T K +S       +P AGL  SLK L LDYVDLYL
Sbjct: 62  EMYNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLYL 121

Query: 121 MHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSN 180
           +H P                          E   +   + W+ M++L K GK + +GVSN
Sbjct: 122 LHSPFITK----------------------ESCGYTMEEAWKQMEKLYKDGKAKNIGVSN 159

Query: 181 FSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLGS-TNA 237
           FS+++LK++L     ++ P +NQ+E +  L  +   ++++C    IL+EAYSPLG     
Sbjct: 160 FSVDDLKRILKI--CEIKPQINQIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLGPLRKK 217

Query: 238 PILTEP-----VLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQ--ANFKTLKL 290
           P   +P      +  LAKK+G    Q+++ W  +R  + +  S   ERI+   +  +  L
Sbjct: 218 PTDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFSFDL 277

Query: 291 SDEEMREINNI 301
           + EE+ +I  +
Sbjct: 278 TSEEVEKITKL 288

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  129 bits (323), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 99/301 (32%), Positives = 151/301 (50%), Gaps = 48/301 (15%)

Query: 24  NTGATISAVGLGT-WQSTNE------NEGYEAVIAALKA-GYRHIDTAAIYGNEGQVGKA 75
           N   +I+ +G GT W  T E       E  + +  AL   G  HID A +Y    +VGKA
Sbjct: 15  NKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYPEVGKA 74

Query: 76  INDSG--VPREEIFVTTKLWSTQ---HHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPR 130
           + +S    PR+EIF+T K +STQ     +P  GL + LK+LGLDYVDLYL+H P      
Sbjct: 75  LRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSP------ 127

Query: 131 SIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVL 190
                 F+S           E + +   + W+ M++L K GK + +GVSNFS+ +L+++L
Sbjct: 128 ------FIS----------KEKNGFTMEEAWKYMEDLYKAGKVKNIGVSNFSMADLQRIL 171

Query: 191 SSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLGSTNAPILT------E 242
            S   +V P VNQ+E +  L  +   ++ +C    I + AY+PLG               
Sbjct: 172 KSC--EVKPQVNQIEFNAFLQNQTPGIVNFCRENDIQVVAYTPLGPLQRKSKNFEQENFH 229

Query: 243 PVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQ--ANFKTLKLSDEEMREINN 300
             +  LA+K+    AQI++ W  +RG I +  S   +RI+      T  L+D E+ +I  
Sbjct: 230 KFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDLTDSEVEKITQ 289

Query: 301 I 301
           +
Sbjct: 290 L 290

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  126 bits (316), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 95/302 (31%), Positives = 147/302 (48%), Gaps = 45/302 (14%)

Query: 21  FKLNTGATISAV---GLGT-WQSTNENEG------YEAVIAALKA-GYRHIDTAAIYGNE 69
           F LN G  I AV   G GT W    E E        E +  AL   G  H+D A  Y   
Sbjct: 27  FTLNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTY 86

Query: 70  GQVGKAINDSGVPREEIFVTTKLWST--QHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTL 127
            ++G+A+ +S  PR+EIF+T K   T   H          +K++G+DYVDLYL+H     
Sbjct: 87  QELGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIH----- 141

Query: 128 NPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLK 187
                        PL+   K  V ++     + W+ +++L + GK + +GVSNF + +L+
Sbjct: 142 ------------SPLIEKEKNGVTLE-----EVWKDLEKLYEAGKAKNIGVSNFRVEDLQ 184

Query: 188 KVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLGSTNAPILTEPVL 245
           ++L     KV P VNQ+E H  L  +   ++++     I LEAY+PLG            
Sbjct: 185 RILKVA--KVKPQVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLGPLQRKQSDAGDF 242

Query: 246 IN----LAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQA--NFKTLKLSDEEMREIN 299
            N    LAKK+G   AQ+++ W  +R  + +  S   +RIQA  +  +  L+DEE+++I 
Sbjct: 243 YNYVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVKKIT 302

Query: 300 NI 301
            +
Sbjct: 303 EL 304

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  125 bits (314), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 88/276 (31%), Positives = 133/276 (48%), Gaps = 35/276 (12%)

Query: 47  EAVIAALKAGYRHIDTAAIYGNEGQVGKAINDSGVPREEIFVTTKL--WS---TQHHDPA 101
           + V  A+KAG+ HID A  Y    +VG  I +SGVPRE+++VT K   WS    +   P 
Sbjct: 47  DQVSNAIKAGFNHIDAAEAYKTHPEVGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPL 106

Query: 102 AGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTW 161
             L  SL ++ + YVDLYL+H P  +NP                     E    D  + W
Sbjct: 107 ESLELSLGKMQMQYVDLYLVHVPF-INP---------------------ETAGIDLKEAW 144

Query: 162 ELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWC 219
             M+E+   G  + +GVSNF + +L+ + +    K  P VNQ+E    + Q+   ++ +C
Sbjct: 145 RQMEEIYDRGWAKNIGVSNFDVESLEYIRTI--GKYQPVVNQIEFSAYMQQQSPGIISYC 202

Query: 220 HSKGILLEAYSPLG--STNAPILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVH 277
              GI +E YSPL   +   P   + +L  +AKK+G    QI++ W VQ G I +  S  
Sbjct: 203 KKHGIAIEGYSPLVPLTKGKPGPLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQ 262

Query: 278 AERIQANFKT--LKLSDEEMREINNISKEKGERRIV 311
            +RI  +      +LS E+   I  + K K  R  +
Sbjct: 263 QKRIDESLDIFDFELSSEDFTSITEVGKTKIFRNFM 298

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  124 bits (312), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 85/284 (29%), Positives = 137/284 (48%), Gaps = 37/284 (13%)

Query: 47  EAVIAALKAGYRHIDTAAIYGNEGQVGKAINDSGVPREEIFVTTKL--WS---TQHHDPA 101
           + V  A++ G+ HIDTA  Y    +VG  I+++ VPRE +++T K   WS    +   P 
Sbjct: 48  DQVTNAIQCGFNHIDTAEAYKTYKEVGTGISNAQVPRETLWITDKYTPWSWEWRKGSGPL 107

Query: 102 AGLNDSLKRLGLDYVDLYLMHWP-VTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKT 160
             L  SLK + LDYVDLY++H P +T     I                       D  + 
Sbjct: 108 ESLTLSLKEMNLDYVDLYMIHVPNITTKTAGI-----------------------DLKEA 144

Query: 161 WELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEW 218
           W  M+E+      R +GVSNF + +L+ + S    K  P VNQ+E    + Q+   +L++
Sbjct: 145 WLQMEEIYTRKMARNIGVSNFDVESLEYIKSFA--KYQPVVNQIEFSAYMQQQSPGILKY 202

Query: 219 CHSKGILLEAYSPLG--STNAPILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSV 276
           C    I++E YSPL   +   P   + +L  +A K+G    Q+++ W  Q G +V+  + 
Sbjct: 203 CRENNIVVEGYSPLVPLTKGKPGPLDEILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTG 262

Query: 277 HAERIQA--NFKTLKLSDEEMREINNISKEKGERRIVQPHWEPF 318
             ER+    N    +LS E+  +I N+ +EK  R  +   +E +
Sbjct: 263 KKERLNESLNIFDFELSKEDFDQITNVGREKILRNYMHMLYEKY 306

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  123 bits (308), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 97/309 (31%), Positives = 150/309 (48%), Gaps = 57/309 (18%)

Query: 21  FKLNTGATISAV---GLGT-WQSTNEN------EGYEAVIAALKA-GYRHIDTAAIYGNE 69
           F LN G  I AV   G GT W  T EN      E  + V  AL   G  HID A IY   
Sbjct: 8   FTLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTY 67

Query: 70  GQVGKAINDSGVPREEIFVTTKLWSTQ---HHDPAAGLNDSLKRLGLDYVDLYLMHWPVT 126
            ++GKA+ ++  PR EI++T K +ST      +P  G  + LK LG+DY+DLYL+H    
Sbjct: 68  PELGKALRETKKPRNEIWITDK-YSTSLKLSDNPIVGFENGLKELGVDYIDLYLLH---- 122

Query: 127 LNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNL 186
                         P + +G+    ++     + W+ ++EL K+GK + +GVSNF+  +L
Sbjct: 123 -------------SPFITEGRNGFTLE-----QAWKYLEELYKSGKAKNIGVSNFAKEDL 164

Query: 187 KKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLGSTNAPILTEP- 243
           +++L     ++ P VNQ+E    L  +   +  +     ILLEAYSPLG    P+   P 
Sbjct: 165 ERILKIA--EIKPQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLG----PLQRRPE 218

Query: 244 ---------VLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQ--ANFKTLKLSD 292
                     +  LA+K+G   AQ+++ W  +RG + +  S    R+    +  T  L+ 
Sbjct: 219 EADSLPFYKYINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTS 278

Query: 293 EEMREINNI 301
            E+ +I  +
Sbjct: 279 TEVEKITEL 287

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  121 bits (303), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 140/284 (49%), Gaps = 37/284 (13%)

Query: 47  EAVIAALKAGYRHIDTAAIYGNEGQVGKAINDSGVPREEIFVTTKL--WS---TQHHDPA 101
           + V +A+ AG+ HID A  Y    +VG+ + +SGVPR+++++T K   WS    +   P 
Sbjct: 47  DQVTSAINAGFNHIDAAEAYKTHPEVGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPL 106

Query: 102 AGLNDSLKRLGLDYVDLYLMHWP-VTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKT 160
             L+ SL+++ + YVDLYL+H P +T+    I                       D  + 
Sbjct: 107 ESLSLSLEKMQMSYVDLYLLHVPFITVQTAGI-----------------------DLKEA 143

Query: 161 WELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEW 218
           W  M+E+   G  + +GVSNF + +L+ +  +   K +P VNQ+E +  L Q+   ++ +
Sbjct: 144 WRQMEEIYDRGLAKNIGVSNFDVESLEYI--TKIGKYLPVVNQIEFNAYLQQQSPGIIAY 201

Query: 219 CHSKGILLEAYSPLG--STNAPILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSV 276
           C    I++E YSPL   +   P   + +L  LA+K+     QI++ W  Q G +V+  S 
Sbjct: 202 CKDHDIVVEGYSPLVPLTKGRPGPLDKLLPALAEKYHKSELQILLRWVTQNGVVVITTSA 261

Query: 277 HAERIQ--ANFKTLKLSDEEMREINNISKEKGERRIVQPHWEPF 318
              R++   N    +L+ E+   I  I +EK  R  +   +  +
Sbjct: 262 QQARVKESVNIFDFELTAEDFDSITKIGREKIFRGFMGEQYSKY 305

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  120 bits (300), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 88/323 (27%), Positives = 156/323 (48%), Gaps = 46/323 (14%)

Query: 15  SNSTTTFKLNTGATI---SAVGLGT-WQSTNENEGY-EAVIAALK-----AGYRHIDTAA 64
           S  T+   LN G  I   S +G GT W   N  + Y +A++  ++      G  HID A 
Sbjct: 2   SYQTSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAE 61

Query: 65  IYGNEGQVGKAINDSGVPREEIFVTTKLWSTQHH--DPAAGLNDSLKRLGLDYVDLYLMH 122
           +Y    +VG+A+ +S  PR+EIF+T K    +    +P  GL  +L+++GL+YVDLYL+H
Sbjct: 62  MYQTHAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLH 121

Query: 123 WPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYV--KTWELMQELPKTGKTRAVGVSN 180
           +P+ ++P+                        +D+   + W++M++L   G  + +GVSN
Sbjct: 122 FPI-IDPK-----------------------LYDFTLEEAWKMMEDLYNEGLAKNIGVSN 157

Query: 181 FSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYS---PLGST 235
           F + +L+++  S    + P +NQ+E +  L  +   + ++C    I LEA+    PL   
Sbjct: 158 FRVEDLEQL--SKSWVIKPQINQIEFNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREV 215

Query: 236 NAPILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEM 295
           N   L    +  LA+K+     QI++ W  QR  I +  S   ER++  +        + 
Sbjct: 216 NEKDLLPLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQ- 274

Query: 296 REINNISKEKGERRIVQPHWEPF 318
            E+  I+K   +   ++ +W  +
Sbjct: 275 DEVEFITKLGSQHDTIRKYWNVY 297

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  119 bits (299), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 98/322 (30%), Positives = 153/322 (47%), Gaps = 52/322 (16%)

Query: 21  FKLNTGATISAV---GLGT-WQSTNENEG--YEAVIAALK-----AGYRHIDTAAIYGNE 69
           F LN G  I AV   G GT W    E +     A++  ++      G  H+D A +Y   
Sbjct: 8   FTLNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTY 67

Query: 70  GQVGKAINDSGVPREEIFVTTKLWSTQH---HDPAAGLNDSLKRLGLDYVDLYLMHWPVT 126
            +  +A+ ++  PR EIFVT K +S Q    +DP  GL+  LKR GL+YVDLYL+H    
Sbjct: 68  PEFSEALKNTKKPRNEIFVTDK-YSVQEKITNDPREGLDTGLKRTGLEYVDLYLLH---- 122

Query: 127 LNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNL 186
            +P + K+ N  +I                  + W  ++EL   GK + +GVSNF + +L
Sbjct: 123 -SPFASKEKNGFTIE-----------------EAWAQLEELYHEGKAKNIGVSNFRVEDL 164

Query: 187 KKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYSPLGSTNAPILTEPV 244
           +K+L     KV P VNQ+E    L  +   ++++     I LEAY+PLG  +    +E  
Sbjct: 165 EKILKVA--KVKPQVNQIEFSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQA 222

Query: 245 ------LINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQ--ANFKTLKLSDEEMR 296
                 +  L +K+    AQI++ W  +RG + +  S   +RI+   N     L+ +E+ 
Sbjct: 223 KPFYDYIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVD 282

Query: 297 EINNISKEKGERRIVQPHWEPF 318
           EI  +       R+   +W P 
Sbjct: 283 EITKLGLAHPALRL---YWNPL 301

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  110 bits (276), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 100/323 (30%), Positives = 150/323 (46%), Gaps = 57/323 (17%)

Query: 21  FKLNTGATISA---VGLGT-WQST-NENEGYEAVIAALKA-----GYRHIDTAAIYGNEG 70
           F LN G +I A   VG+G  W       +G + ++  LK      G+ HI TA  Y N G
Sbjct: 9   FTLNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFYPNNG 68

Query: 71  QVGKAINDSGVPREEIFVTTKLWSTQH--HDPAAGLNDSLKRLGLDYVDLYLMHWPVTLN 128
            +  A+  S  PR EI++T K  S       P   L  SL RLG DYVDLYL+H     N
Sbjct: 69  LLSAALKASQKPRHEIWITDKYCSQCKLSSSPIEALERSLDRLGFDYVDLYLIH-----N 123

Query: 129 PRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKK 188
           P      N +S+                  K W+ M+ L KTGK + +GVSNF I +L++
Sbjct: 124 PCLDSSPNGISLE-----------------KAWKQMELLYKTGKVKNIGVSNFRIEDLER 166

Query: 189 VLSSPGNKVVPAVNQVEIHPLLPQE--ELLEWCHSKGILLEAYS---PLGSTNAPILTEP 243
           +  +   ++ P VN++E H  L  +   + E+  +  +LL  YS   PL +     +  P
Sbjct: 167 LKDA---EIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETKTEDFMDFP 223

Query: 244 V---LINLAKKHGVQTAQIVISWHVQRGYIVLP----KSVHAERIQANFKTLKLSDEEMR 296
               +I LA+K+    AQI++ W    G  VLP      V   +  ++  + +L+ EE+ 
Sbjct: 224 FYRYIIGLAEKYNKTEAQILLHWMNCLG--VLPVITNTKVKWYKEASDIISFELTSEELD 281

Query: 297 EINNISKEKGERRIVQPHWEPFV 319
            I  + K+       +PH + FV
Sbjct: 282 MITELGKKH------KPHRKHFV 298

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W
          - Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 68.9 bits (167), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 5/85 (5%)

Query: 16 NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ---- 71
          N  T +KLN G  I  +G G ++   E+   + V +ALK GYRHIDTA +Y N+ +    
Sbjct: 8  NRETRYKLNNGQQIPVIGFGVYEIPKEDTA-DRVYSALKDGYRHIDTAVLYRNQKEAAQG 66

Query: 72 VGKAINDSGVPREEIFVTTKLWSTQ 96
          V K ++++G  RE I+ TTKLW +Q
Sbjct: 67 VRKYLDETGEARENIWFTTKLWDSQ 91

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 92/196 (46%), Gaps = 39/196 (19%)

Query: 60  IDTAA--IYGNE-GQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGL----NDSLKRLG 112
           ID AA  IY     +VG+A++ +  P+ EIF+T K  S+   + +A L    + +LK++ 
Sbjct: 7   IDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDK--SSTQTEVSATLAMRPDMALKKIS 64

Query: 113 LDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGK 172
           ++YVD++ +H P        K  N L++               D + T      L ++ K
Sbjct: 65  VEYVDMHFLHSPFVF-----KQANVLNL--------------KDAMHT----DHLRRSNK 101

Query: 173 TRAVGVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEE--LLEWCHSKGILLEAYS 230
               G S+ ++  L++VL +   +  P VNQ+++   L  +   + + C    IL+  YS
Sbjct: 102 ANNRGASSVNVEELRRVLKTEDEE--PQVNQIKLRSSLRNQTPGISKLCQENDILMAVYS 159

Query: 231 ---PLGSTNAPILTEP 243
              PL   NA   ++P
Sbjct: 160 TLDPLQRKNARNDSQP 175

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 68/329 (20%), Positives = 129/329 (39%), Gaps = 65/329 (19%)

Query: 24  NTGATISAVGLGT----------WQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ-- 71
           NTG  IS + +G           W   ++NE ++ +  A  +G R  DTA  Y N GQ  
Sbjct: 11  NTGLKISPIIVGCMSYGSKDWHPWIIEDKNEVFKILKTAYDSGLRTFDTADGYSN-GQSE 69

Query: 72  --VGKAINDSGVPREEIFVTTKLW-----STQHHDPAAGLNDSLKRLGLDYVDLYLMHWP 124
             +G+ + +  +PRE + + TK+W     S +       +N+  K    +   L   H  
Sbjct: 70  ILLGEFLKEYEIPRETVIIMTKVWAPVDSSLEGFQRTGPMNEDQKVHFANQQGLSRKHII 129

Query: 125 VTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSIN 184
                   + G ++ +  +    +D  ++     +T   + ++ + G TR +G S+    
Sbjct: 130 EACKNSVRRLGTYIDVYQIHRADQDTPME-----ETMRALNDVVQQGLTRYIGASSMLGT 184

Query: 185 NLKKV-LSSPGNKVVPAVNQVEIHPLLPQE---ELLEWCHSKGILLEAYSPLGSTNAPIL 240
              +    +  N     VN  + + LL +E   E++ +    GI    +SPL      +L
Sbjct: 185 EFAEYQFIAEKNGWSKFVNMQDCYNLLYREEEREMIPYIKKHGIAQTPWSPL---QRGLL 241

Query: 241 TEPV---------------------------LIN----LAKKHGVQTAQIVISWHVQRGY 269
           + PV                           +IN    +A K G+  A++  +W + +G 
Sbjct: 242 SRPVEVSSYREDNDRVLKGRRLNQYEDFEIEIINRVEQVAVKKGITMAEVATAWLLSKGT 301

Query: 270 IVLPKSVHAERIQANFKTLK--LSDEEMR 296
             +      +R++   K L   L++EE +
Sbjct: 302 FPILGLNSVQRVKEAIKALDVTLTEEECK 330

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 77/182 (42%), Gaps = 51/182 (28%)

Query: 52  ALKAGYRHIDTAAIYG-NEGQVGKAIND--SGVPREEIFVTTKL-------WSTQHHDPA 101
           A+  G   IDT+  YG +E   GKA+ +     PREE F+ TK+       ++    +  
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKENVR 109

Query: 102 AGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTW 161
             +  S +RL  DY+DL  +H                            +I+  +Y K W
Sbjct: 110 FSVKRSCERLHTDYLDLVYLH----------------------------DIEYVEYDKIW 141

Query: 162 ELMQELPK---TGKTRAVGVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEW 218
           E ++EL K    G  R +G+S + ++ L  V  +     VP     EI PL   + +L +
Sbjct: 142 EALRELRKLKDEGVIRHIGISGYPVDLLLYVSKTCCG--VP-----EIGPL---DAVLSY 191

Query: 219 CH 220
           C+
Sbjct: 192 CN 193

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 73/345 (21%), Positives = 128/345 (37%), Gaps = 102/345 (29%)

Query: 25  TGATISAVGLGT----------WQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EGQ 71
           TG  +S + +G           W   ++ E +  +  A   G R  DTA +Y N   E  
Sbjct: 12  TGLKVSPIIIGCMSYGTKNFFDWVLDDKEEIFGILKHAYDRGLRTYDTADVYSNGMSETI 71

Query: 72  VGKAINDSGVPREEIFVTTKLW------------------------STQHHDPAAGLN-- 105
           +G+ +    +PRE + + TK++                        + QH      LN  
Sbjct: 72  LGEFLRTYNIPRETVVIMTKVFFPVDDKMDISSNRTKTEEENLQLINQQHLSRKHILNAV 131

Query: 106 -DSLKRLGLDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELM 164
            +S+KRLG  Y+D+Y +H      P                           + +T   +
Sbjct: 132 KNSVKRLG-TYIDVYQIHRCDHETP---------------------------FEETMRAL 163

Query: 165 QELPKTGKTRAVGVSN-FSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQE---ELLEWCH 220
            ++ + G  R +G S+  ++   +    +  +     VN    + L+ +E   E++ +C 
Sbjct: 164 NDVVEQGDVRYLGASSMLAVEFAEMQFIAEKHGWHKFVNMQSCYNLVYREDEREMIPFCK 223

Query: 221 SKGILLEAYS---------PLGSTNAPILTEPVLI-------------------NLAKKH 252
             GI L  +S         PLGS      T+ VLI                    LA K 
Sbjct: 224 RHGIALTPWSPIQKGLLARPLGSHTHRESTDGVLIARKLNQFTESEKEIINRVEKLAIKK 283

Query: 253 GVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTL--KLSDEEM 295
            ++   I + W +Q+G + +      ER+    KTL  KL++++M
Sbjct: 284 NLKMVDISLGWVIQKGTLPILGMSSIERVDEAIKTLTTKLTEDDM 328

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 68/318 (21%), Positives = 129/318 (40%), Gaps = 47/318 (14%)

Query: 35  GTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EGQVGKAINDSGVPREEIFVTTK 91
             W   ++ E ++ +      G R  DTA +Y N   E  +G+ +    + RE + + +K
Sbjct: 32  ANWVLEDKEEIFKILKHCYDNGLRTFDTADVYSNGTSERILGEFLKRFNIKRETVVIMSK 91

Query: 92  LWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGKRDVE 151
           ++     D +  L+   K +  +Y+DL L  +   LN + I  G   S+  L      ++
Sbjct: 92  IFFPV--DESLDLHQGSK-VDQEYIDLQL-SFQQGLNRKHIMAGVANSVERLGTYIDILQ 147

Query: 152 IDTWDYVKTWE-LMQELPK---TGKTRAVGVSNFSINNLKKV-LSSPGNKVVPAVNQVEI 206
           I   D   + E +M+ L     +G+ R +G S+       ++   +  N     +N    
Sbjct: 148 IHRLDKEASMEEIMRSLNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINVQSY 207

Query: 207 HPLLPQE---ELLEWCHSKGILLEAYSP---------LGSTNAPILTEPVLINL------ 248
           + +L +E   EL+ +C   G+ L  +SP            T   +L++P  I +      
Sbjct: 208 YNVLNREDENELIPFCKKHGVGLTVWSPNARGVLTRPADKTGTRMLSDPTFIKMGLDKLD 267

Query: 249 -------------AKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTL--KLSDE 293
                        AKK G+  A + ++W + +G   +      ER+    + +  K + E
Sbjct: 268 ESDKEIIGVVEAIAKKKGISMAMVSMAWILNKGANAIAGLNSIERVDEAIRAIDVKFTVE 327

Query: 294 EMREINNISKEKGERRIV 311
           E+  +    K K  RR+V
Sbjct: 328 ELELLEKPYKPK--RRVV 343

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 105/270 (38%), Gaps = 73/270 (27%)

Query: 43  NEGYEAVIAALKAGYRHIDTAAIY-GNEGQVGKAINDSGVP-REEIFVTTKLWS---TQH 97
           N+    ++  LKAG + IDTA IY  NE    KAI +  +P R  I      +S      
Sbjct: 15  NQNSNEIVTVLKAGVKDIDTARIYPDNE----KAIGELQLPDRFTIHTKASGFSGGCLTR 70

Query: 98  HDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDY 157
            +    + +SL  LG+  V+ +L+H P   +P          IPL               
Sbjct: 71  DNINKSIEESLSLLGVPSVETFLLHSP---DPE---------IPL--------------- 103

Query: 158 VKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNK--VVPAVNQV----------- 204
            +T + +  L + GK    G+SNFS  ++K++     +K  V+P V Q            
Sbjct: 104 EETLDAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNYNALSRAIVN 163

Query: 205 EIHPLLPQEELLEWCHS---KGILLEA--------------YSPLGSTNAPILTEPVLI- 246
           ++ PLL +  +  + +S   +G L E                + +G     +   P +I 
Sbjct: 164 DLFPLLKELHISLYAYSPIARGFLAETPEEILGEKSGRFDNSTMIGQMYLKLYNRPAIIK 223

Query: 247 ------NLAKKHGVQTAQIVISWHVQRGYI 270
                  LAKK G+    +   W V   ++
Sbjct: 224 GLEEWNKLAKKTGISKYSLAYRWIVHNSFL 253

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 126/324 (38%), Gaps = 57/324 (17%)

Query: 24  NTGATISAVGLGT----------WQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ-- 71
           NTG  +S + +G           W   ++ E ++ +  A   G R  DTA +Y N GQ  
Sbjct: 11  NTGLKVSPLIIGCMSFGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSN-GQSE 69

Query: 72  --VGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLY-LMHWPVTLN 128
             +G+ +    +PRE + + TKL      +      +    + L+ V++  L    +  +
Sbjct: 70  IILGEFLRKYNIPRETVVIMTKLRFPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSS 129

Query: 129 PR-SIKD-GNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNL 186
            R S+K  G ++ I  +  G  D   +     +T   + ++   G TR VG S       
Sbjct: 130 SRASVKRLGTYIDILQIHRGDPDTPFE-----ETMGALNDVVIEGLTRYVGASLMLATEF 184

Query: 187 KKV-LSSPGNKVVPAVNQVEIHPLLPQE---ELLEWCHSKGILLEAYSPL--GSTNAPIL 240
            ++   +  +     VN    + L+ +E   EL+ +     I L  +SPL  G    P+ 
Sbjct: 185 AEMQFVAEKHGWFKFVNSQSCYHLMYREDERELIPFAKRHNIALTPFSPLNRGLLCRPLG 244

Query: 241 TEPVLIN--------------------------LAKKHGVQTAQIVISWHVQRGYIVLPK 274
           TE    N                          L+ K  +  + I ++W +Q+G   +  
Sbjct: 245 TETTRSNSDSVIKTKNLKNYTDWEASIINRVEKLSIKKNIPMSAISLAWVLQKGCFPIVG 304

Query: 275 SVHAERIQANFKTL--KLSDEEMR 296
               ER++     L   L++EEM+
Sbjct: 305 FSSIERVEEAIDALDVNLTEEEMK 328

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 80/180 (44%), Gaps = 33/180 (18%)

Query: 54  KAGYRHIDTAAIYGN-EGQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLG 112
           +  +  +DT+  YG+ E  VG+A+ +  +PR EI+V TK+          G+++      
Sbjct: 38  RRCFNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTKVGRV-------GVSE------ 84

Query: 113 LDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWD-YVKTWELMQELPKTG 171
            DY    +    +    R + +G +L +  L     DVE    +  +   + +Q+L + G
Sbjct: 85  FDYSRENVRMSVMRSVERLVGEGGYLDVVYL----HDVEFQPQEACLAALDELQKLKRAG 140

Query: 172 KTRAVGVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHS--KGILLEAY 229
             R VGVS + ++ L  ++S   +   P             + +L +CH   + ++LE Y
Sbjct: 141 IVRNVGVSGYPLSKLYSLVSLCYDAGTPL------------DCVLSYCHMNLQNVMLEEY 188

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 84/183 (45%), Gaps = 42/183 (22%)

Query: 61  DTAAIY-GNEGQVGKAINDSGVPREEIFVTTKLWSTQHHD-PAAGLNDSLKR----LGLD 114
           DTA IY G+E    K+I D G+  +++ + TK  S +       G+ +S+K+    L +D
Sbjct: 38  DTARIYPGSE----KSIGDLGIA-DDLVIDTKARSFEEGALTRDGIFESIKQSFDELKVD 92

Query: 115 YVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTR 174
            V++Y +H P  + P                    +E       +T + + EL K GK +
Sbjct: 93  SVEIYYLHAPDPITP--------------------IE-------ETIDAINELYKQGKFK 125

Query: 175 AVGVSNFSINNLKKV--LSSPGNKVVPAVNQVEIHPLLP--QEELLEWCHSKGILLEAYS 230
             G+SN++ +++KK+   +   N V+P V Q   +      +++L       GI   AYS
Sbjct: 126 KFGLSNYTPDDVKKIYEYAKSKNYVLPTVFQGNYNAFSRSIEKDLFPVLRKYGISFYAYS 185

Query: 231 PLG 233
           P+ 
Sbjct: 186 PIA 188

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/347 (20%), Positives = 125/347 (36%), Gaps = 105/347 (30%)

Query: 24  NTGATISAVGLGT----------WQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EG 70
           NTG  +S + +G           W   +  + ++ +  A   G R  DTA +Y N   E 
Sbjct: 11  NTGLKVSPIIIGCMSFGSKKWSEWVEDDREKIFKILKYAYDKGLRTYDTANVYSNGESEI 70

Query: 71  QVGKAINDSGVPREEIFVTTKLWSTQHHD---------PAAGLN---------------- 105
            +G+ + +  +PRE + + TKL+   + +         P A LN                
Sbjct: 71  ILGEFLKNYKIPRETVIIMTKLYFPTNDNADYDIFSMTPEAILNNVNITGLSRKNIINSA 130

Query: 106 -DSLKRLGLDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELM 164
            DS++RLG  Y D+  +H       R+  D  F                     +T   +
Sbjct: 131 RDSVRRLGT-YADIIQIH-------RADPDTPF--------------------EETMRAL 162

Query: 165 QELPKTGKTRAVGVSNFSINNLKKV-LSSPGNKVVPAVNQVEIHPLLPQE---ELLEWCH 220
            ++   G TR +G S+       ++   +  N     +N    + LL +E   EL+ +  
Sbjct: 163 NDIVVDGLTRYIGASSMLATEFVEMQFIAEKNDWFKFINSQSCYNLLYREDERELIPFAK 222

Query: 221 SKGILLEAYSPL------------------------------GSTNAPILTEPVLINLAK 250
              I L  +SPL                               S++  I+T   +  +AK
Sbjct: 223 RHNIALTPWSPLQRGVLCRPVGETSTRFEKDQFMSIGNIKDINSSDEEIITR--VEEIAK 280

Query: 251 KHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLK--LSDEEM 295
           K   + A + + W +Q+G   +      +RI      L+  L+ +EM
Sbjct: 281 KRNTKMATVALYWVIQKGCFPIVGMSKIDRIDEAIAALEINLTKDEM 327

>KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 70/312 (22%), Positives = 126/312 (40%), Gaps = 68/312 (21%)

Query: 37  WQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EGQVGKAINDSGVPREEIFVTTKLW 93
           W   ++ + +  +      G R  DTA  Y N   E  +G+ +    + RE + + TK++
Sbjct: 11  WVEEDKEKVFNTLKYCYDKGLRTFDTADYYSNGYSEILLGEFLKKYKIKRETVVILTKIF 70

Query: 94  STQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDG-KRDVE- 151
                     ++++L        DL+L   P+ ++   + +   LS   + DG KR VE 
Sbjct: 71  --------FPVDETL--------DLHLGEEPIGVDQLDVVNQRGLSRKHIVDGVKRSVER 114

Query: 152 IDTW-DYVKTWELMQELP------------KTGKTRAVGVSNFSINNLKKV-LSSPGNKV 197
           + T+ D ++     Q+ P            + G  R +G S+       ++   +   + 
Sbjct: 115 LGTYIDVLQIHRFDQDTPIKERMKALNDVVEKGHVRYIGASSMLATEFAEMQFVAEKYEW 174

Query: 198 VPAVNQVEIHPLLPQE---ELLEWCHSKGILLEAYSP---------LGST-----NAPI- 239
              VN   ++ L+ +E   EL+ +C    I L  +SP         +GST     N P  
Sbjct: 175 FQFVNSQSLYNLIYREDERELIPFCKRHNIALTPWSPNHQGLLTRPIGSTTERSENDPFV 234

Query: 240 ---LTEPV------LIN----LAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFK 286
              LT+ +      +IN    LAKK     A I  +W + +G + +       R+    K
Sbjct: 235 KCTLTKKLEKSDIEIINRVEELAKKKKCSMAVISTAWVISKGCVPIVGMSKTSRVDDAIK 294

Query: 287 TL--KLSDEEMR 296
            L  K +DEE++
Sbjct: 295 ALKVKFTDEELK 306

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 44/86 (51%), Gaps = 10/86 (11%)

Query: 47  EAVIAALKAGYRHIDTAAIYGN-EGQVGKAINDSG--VPREEIFVTTKL--WSTQHHDPA 101
           E +  A + G   IDT+  YGN E  +GKA+++ G   PR+   + TK+   S    D +
Sbjct: 28  EILRVAFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYS 87

Query: 102 A-----GLNDSLKRLGLDYVDLYLMH 122
           A      +  S KRL  DY+DL  +H
Sbjct: 88  ADNVRRSVVRSCKRLNSDYLDLVYLH 113

>ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR041C
          Length = 359

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 63/157 (40%), Gaps = 47/157 (29%)

Query: 49  VIAALKAGYRHIDTAAIYGNE----GQVGKAINDSGVPREEIFVTTKL---------WST 95
           V  AL+AG   IDT+  YG      G+   A+ D   PRE  F+ TK+         +S 
Sbjct: 60  VRRALEAGICAIDTSPYYGKSEEIYGEALAAVRDEH-PRETYFICTKVGREGPSDFDYSA 118

Query: 96  QHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTW 155
            H    A ++ S  RL  +Y+DL  +H                            +I+  
Sbjct: 119 AH--VRASVHRSCARLHTEYLDLVYLH----------------------------DIEFV 148

Query: 156 DYVKTWELMQELPK---TGKTRAVGVSNFSINNLKKV 189
           +    WE +QEL +    G  R  G+S + +  L++V
Sbjct: 149 EAAGIWEALQELRRLKDEGVIRFFGISGYPVELLQEV 185

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 84/209 (40%), Gaps = 40/209 (19%)

Query: 33  GLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIY-GNEGQVGKAINDSGVPREEIFVTTK 91
           G  T+ S  + E  + V    K     +DTA IY G+E  +GK      +P+  I  T  
Sbjct: 10  GAFTFASLTQEEASKFVDVLEKYKVEELDTARIYPGSEEAIGKF----ELPKSFIIDTKA 65

Query: 92  LWSTQHHDPAAGLNDSLKR----LGLDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGK 147
               +       +N+S++     LG++ V+++ +H P    P                  
Sbjct: 66  RGFGEGTLTKESINESIEESFGLLGVESVEIFYLHCPDPATPLE---------------- 109

Query: 148 RDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNK--VVPAVNQVE 205
                      +T + +  L K GK +  GVSNFS  +++K+ S    K  V+P V Q  
Sbjct: 110 -----------ETLDAIDALYKEGKFKKFGVSNFSPEDVRKIYSYNKEKGYVLPTVYQGN 158

Query: 206 IHPLLPQEE--LLEWCHSKGILLEAYSPL 232
            + +  + E  L       G+   AYSP+
Sbjct: 159 YNAVGRKIETSLFPVLRELGLSFYAYSPI 187

>KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 75/334 (22%), Positives = 127/334 (38%), Gaps = 58/334 (17%)

Query: 24  NTGATISAVGLGT----------WQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EG 70
           NTG  IS + +G           W   ++N  +  +      G R  DTA  Y N   E 
Sbjct: 12  NTGLKISPIIVGCMSYGSKNWAEWVEDDKNTIFGILKYCYDKGLRTFDTADYYSNGLSEK 71

Query: 71  QVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLG-LDYVDLYLMHWPVTLNP 129
            +G+ +    + RE + + TK++           N  L  L  LD V+         L+ 
Sbjct: 72  LLGEFLVKYNIKRETVVIMTKIFFPFDETLNLKSNTPLSELQELDVVN------QRGLSR 125

Query: 130 RSIKDGNFLSIPLLPDGKRDVEIDTWD----YVKTWELMQELPKTGKTRAVGVSNFSINN 185
           + I DG   +I  L      ++I  +D      +T + + ++ ++G  R +G S+     
Sbjct: 126 KHILDGVEKAIARLGTYIDVLQIHRFDPETPIKETMKALNDVIESGHVRYIGASSMLATQ 185

Query: 186 LKKV-LSSPGNKVVPAVNQVEIHPLLPQE---ELLEWCHSKGILLEAYSP--LGSTNAPI 239
             ++   +        VN   ++ L+ +E   EL+ +C    I L  +SP   G    PI
Sbjct: 186 FAEMQFIADKYNWFQFVNAQSMYNLVYREDERELIPFCKRHNIALTPWSPNHRGFLTRPI 245

Query: 240 LTEPV-------LIN-------------------LAKKHGVQTAQIVISWHVQRGYIVLP 273
            T+ +        IN                   LA+K GV  A I  +W V +G   + 
Sbjct: 246 GTKSLRSESDRFTINKLRDNVLESDIKIVKRVEELAEKKGVSMAAISTAWVVSKGCQPII 305

Query: 274 KSVHAERIQANFKTLK--LSDEEMREINNISKEK 305
                ER+      L    +DEE++ + +  K K
Sbjct: 306 GLSKTERVDDAISALSVTFTDEELKYLEDPYKPK 339

>KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 70/331 (21%), Positives = 127/331 (38%), Gaps = 69/331 (20%)

Query: 24  NTGATISAVGLGT----------WQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EG 70
           NTG  IS + +G           W   ++ + ++ +      G R  DTA +Y N   E 
Sbjct: 11  NTGIKISPIIVGCMSYGSKDWAKWVEDDKEKVFKILKHCYDQGLRTFDTADVYSNGLSEK 70

Query: 71  QVGKAINDSGVPREEIFVTTKLW----STQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVT 126
            + + +    + RE + + +K++     T      +GL D L +L L             
Sbjct: 71  LLKEFMQKYNIRRETVVIMSKVFFPVDETLDLGLGSGLEDELAQLDLTNQQ--------G 122

Query: 127 LNPRSIKDGNFLSIPLLPDGKRDVEIDTWD----YVKTWELMQELPKTGKTRAVGVSNFS 182
           L+ + I D    S+  L      ++I  +D      +T   + ++ + G TR +G S+  
Sbjct: 123 LSRKHIIDAAKKSVERLGTYMDVLQIHRFDPNTPVKETMRALNDVVEMGLTRYIGASSML 182

Query: 183 INNLKKV-LSSPGNKVVPAVNQVEIHPLLPQE---ELLEWCHSKGILLEAYSPLGSTNAP 238
              L ++  ++        VN    + L+ +E   E + +     ++L  +SP    +  
Sbjct: 183 GTQLAELQFTADKYNWFQFVNVQSCYNLVYREDERETIPFAKKHNLMLTPWSP---NHQG 239

Query: 239 ILTEPV-----------LIN--------------------LAKKHGVQTAQIVISWHVQR 267
           +LT PV           +IN                    +AKK  V  A I  +W +Q+
Sbjct: 240 LLTRPVGVESTRSSSDIIINAWGLKNLKPWEVTVINRVEEMAKKKNVSMAVIATAWVIQK 299

Query: 268 GYIVLPKSVHAERIQANFKTLKLS--DEEMR 296
           G   +       R+  N K L +S  +EEM+
Sbjct: 300 GCAPILGMSSIARVDDNIKALDVSFTEEEMK 330

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 21/118 (17%)

Query: 26  GATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ---VGKAINDSGVP 82
           GA+I     G   S N+ + +E + A  +AG   IDTA  Y NE     +G+ +    + 
Sbjct: 36  GASIGDAWSGFMGSMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMASRKL- 94

Query: 83  REEIFVTTKLWSTQHHDPAAG-----------------LNDSLKRLGLDYVDLYLMHW 123
           R++I + TK           G                 + DSL++L  D++D+  +HW
Sbjct: 95  RDQIVIATKFTGDYKKYEVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYIHW 152

>Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331C
           (REAL)
          Length = 376

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 49/118 (41%), Gaps = 21/118 (17%)

Query: 26  GATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNE---GQVGKAINDSGVP 82
           G +I     G   S N+   +E + A  +AG   IDTA  Y NE     +G+ +    + 
Sbjct: 36  GMSIGDAWSGFMGSMNKERAFELLDAFFEAGGNFIDTANNYQNEQSEAWIGEWMVSRKL- 94

Query: 83  REEIFVTTKL-----------------WSTQHHDPAAGLNDSLKRLGLDYVDLYLMHW 123
           R++I + TK                       H     + DSL++L  D++D+  +HW
Sbjct: 95  RDQIVIATKFTTDYKKYEVGKGRSANFCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 152

>TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 54/128 (42%), Gaps = 35/128 (27%)

Query: 28  TISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ-----VGKAINDSGVP 82
           T    G   W   ++ + Y+ +  A   G R  DTA +Y N GQ     +G+ + +  + 
Sbjct: 2   TFGNKGWHKWVIDDKQKSYKILKRAYDLGLRTYDTADLYSN-GQSEIIILGEFLKEYNIS 60

Query: 83  REEIFVTTKLW-----STQHHDPAAGLN-----------------------DSLKRLGLD 114
           RE + + TKL+     +   + P  GL+                       +SL+RLG  
Sbjct: 61  RETVVIMTKLFAPVDDTLPDYQPTGGLHGNQTIHFANQRGLSKKHIIEACKNSLRRLGT- 119

Query: 115 YVDLYLMH 122
           Y+D+Y +H
Sbjct: 120 YIDVYQVH 127

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 21/105 (20%)

Query: 39  STNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ---VGKAINDSGVPREEIFVTTKL--- 92
           S N+ + +E + A  +AG   IDTA  Y NE     +G+ +    + R++I + TK    
Sbjct: 3   SMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKL-RDQIVIATKFTGD 61

Query: 93  -------------WSTQH-HDPAAGLNDSLKRLGLDYVDLYLMHW 123
                        +   H H     + DSL++L  D++D+  +HW
Sbjct: 62  YKKYEVGGGKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 106

>KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 36.6 bits (83), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 71/327 (21%), Positives = 129/327 (39%), Gaps = 61/327 (18%)

Query: 24  NTGATISAVGLGTWQSTNEN------EGYEAVIAALKAGY----RHIDTAAIYGN---EG 70
           NTG  IS + +G     ++N      +  E V   LK  Y    R  DTA +Y N   E 
Sbjct: 11  NTGIKISPIIVGCMSYGSKNWAKWIEDDKEKVFKILKHCYDQGLRTFDTADVYSNGLCER 70

Query: 71  QVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPR 130
            + + + +  + RE + + TKL+          L  +++  G+  +DL        L+ +
Sbjct: 71  LLKEFLEEYKIRRETVVIMTKLFFPVDETLDLSLGGAIED-GVGKLDLTNQQ---GLSRK 126

Query: 131 SIKDGNFLSIPLLPDGKRDVEIDTWD----YVKTWELMQELPKTGKTRAVGVSNFSINNL 186
            I D    S+  L      ++I  +D      +T   + ++ + G TR +G S+     L
Sbjct: 127 HILDAAKKSVERLGTYIDVLQIHRFDPNTPVKETMRALNDVVEMGLTRYIGASSMLGTQL 186

Query: 187 KKV-LSSPGNKVVPAVNQVEIHPLLPQE---ELLEWCHSKGILLEAYSPLGSTNAPILTE 242
            ++  ++        VN    + L+ +E   E++ +     ++L  +SP    +  +LT 
Sbjct: 187 AELQFTADKYNWFQFVNVQSCYNLIYREDEREIIPFAKRHNLMLTPWSP---NHGGLLTR 243

Query: 243 PV---------------------------LIN----LAKKHGVQTAQIVISWHVQRGYIV 271
           PV                           ++N    LAKK  V  A I  +W + +G   
Sbjct: 244 PVGVESARSSTDIILNDWGMKHLKPWEITIVNRIEELAKKKNVSMAVISAAWVISKGCAP 303

Query: 272 LPKSVHAERIQANFKTL--KLSDEEMR 296
           +       R+  N K L  + ++EEM+
Sbjct: 304 IIGMSSIARVDDNIKALDVQFTNEEMK 330

>Kwal_26.9322 s26 complement(1163928..1164923) [996 bp, 331 aa] {ON}
           YPR127W - Hypothetical ORF [contig 72] FULL
          Length = 331

 Score = 36.6 bits (83), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 74/188 (39%), Gaps = 44/188 (23%)

Query: 159 KTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQ---EEL 215
           +T+E + E  K G    + +S  +   ++ V +  G  +     +VE+   +P      +
Sbjct: 135 ETFETIVEYIKKGDLGGLSLSEVTAEQIRAVHAKFGEYL--CCVEVEMSLFVPDILTNGI 192

Query: 216 LEWCHSKGILLEAYSPLGS---TNAPILTEPVLINLAKKH-------------------- 252
            + C+  GI +  YSPL +   T A   T  V     KK+                    
Sbjct: 193 ADTCNELGIPIVCYSPLCNGLLTGAITSTNDVPDGAFKKNFKRLNGGSLEHNLKLVHFLQ 252

Query: 253 ---------GVQTAQIVISW-------HVQRGYIVLPKSVHAERIQANFKTLKLSDEEMR 296
                    G+    + ++W       +    +I +P    A+R++ NFK  +LS EE+ 
Sbjct: 253 HEIVEKRQDGITLPNVALAWVRSFNDRYPNTRFIPIPGGSSAKRVEQNFKVFELSPEELT 312

Query: 297 EINNISKE 304
           ++N+  KE
Sbjct: 313 KVNDFLKE 320

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 52/119 (43%), Gaps = 23/119 (19%)

Query: 26  GATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNE---GQVGKAINDSGVP 82
           G +I     G   + ++   ++ + A  +AG   IDTA  Y NE     +G+ +    + 
Sbjct: 36  GMSIGDAWSGYMGTMDKERAFKLLDAFYEAGGNFIDTANTYQNEQSEAWIGEWMESRKL- 94

Query: 83  REEIFVTTKLWSTQH------------------HDPAAGLNDSLKRLGLDYVDLYLMHW 123
           R++I + TK  ST +                  H     + DSL++L  D++D+  +HW
Sbjct: 95  RDQIVIATKF-STDYKWYDVGKNRSANFCGNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
          {ON} 
          Length = 345

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 34/83 (40%), Gaps = 13/83 (15%)

Query: 24 NTGATISAVGLGT----------WQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EG 70
          NTG  IS    GT          W      + Y+ +  A   G R  DTA  Y N   E 
Sbjct: 11 NTGLKISPFIFGTMTFGNKKNMQWAIEEMEDAYKILKYAYDRGIRTFDTADAYANGLSET 70

Query: 71 QVGKAINDSGVPREEIFVTTKLW 93
           +G  +    +PRE + + TK++
Sbjct: 71 ILGSFLKHYNIPRETVVIMTKVF 93

>SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 342

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 63/299 (21%), Positives = 112/299 (37%), Gaps = 46/299 (15%)

Query: 37  WQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EGQVGKAINDSGVPREEIFVTTKLW 93
           W   NE E ++ +      G R  DTA  Y N   E  VGK +    + RE + + TK++
Sbjct: 34  WVLDNEEEIFKVLKHCYDNGLRTFDTADFYSNGLSERLVGKFLKRYNINRETVVILTKVF 93

Query: 94  STQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEID 153
                 P     D     G+D      +     L+ + I DG   S+  L      ++I 
Sbjct: 94  F-----PVDETLDLSHSKGMDEATQLTVANQRGLSRKHILDGVAKSVERLGTYIDVLQIH 148

Query: 154 TWD----YVKTWELMQELPKTGKTRAVGVSNFSINNLKKV-LSSPGNKVVPAVNQVEIHP 208
            +D      +T + + ++   G  R +G S+       ++   +  +     ++    + 
Sbjct: 149 RFDTETPVNETMKALNDVVSKGYARYIGASSMLATQFAELQFVAEKHDWFKFISSQSCYN 208

Query: 209 LLPQE---ELLEWCHSKGILLEAYSP--LGSTNAPILTEPV------------------- 244
           LL +E   EL+ +     I L  +SP   G    P+ T+ +                   
Sbjct: 209 LLYREDERELIPFAKRHNIGLIPWSPNARGVLTRPLGTQTLRHSTDFGLKRISAFDLQPH 268

Query: 245 -------LINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEE 294
                  +  +A+K GV  A + I+W + +G   +      ER+    K    KL++EE
Sbjct: 269 EEEIVRRVGEIAEKRGVTMAVVSIAWVLSKGCYPIVGLSSTERVDETIKAVEFKLTEEE 327

>KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P42884 Saccharomyces
           cerevisiae YNL331C
          Length = 375

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 60/130 (46%), Gaps = 31/130 (23%)

Query: 24  NTGATISAVGLGT------WQST----NENEGYEAVIAALKAGYRHIDTAAIYGN---EG 70
           N G  +S + LG       W+ T    ++   +E + A  +AG   IDTA  Y N   E 
Sbjct: 24  NAGIRVSPLVLGAMSIGDAWEETLGSMDKQRSFELLDAFYEAGGNFIDTANNYQNGQSEE 83

Query: 71  QVGKAINDSGVPREEIFVTTKLWS---------------TQHHDPAAGLN--DSLKRLGL 113
            +G+ ++   + R++I + TK  S               + +H  +  L+  DSL++L  
Sbjct: 84  WIGEWMSSRKI-RDQIVIATKYTSDYKAYQIGKNKSANFSGNHRRSLQLSVRDSLRKLQT 142

Query: 114 DYVDLYLMHW 123
           D++D+  +HW
Sbjct: 143 DWIDILYVHW 152

>NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 55/269 (20%), Positives = 110/269 (40%), Gaps = 41/269 (15%)

Query: 24  NTGATISAVGLGT----------WQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EG 70
           NTG  IS + +G           W   ++ + +E +      G R  DTA +Y N   E 
Sbjct: 12  NTGIKISPIIVGCMSYGSKQWAEWVQDDKEKVFEILKHCYDRGLRTFDTADVYSNGISER 71

Query: 71  QVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPR 130
            +G+ +    + RE + + TK +       +  L + +     D +DL         N R
Sbjct: 72  LLGEFLKKFNIKRETVVILTKTFFPVDESLSLALGE-MSFSESDTLDL--------TNQR 122

Query: 131 SIKDGNFL-----SIPLLPDGKRDVEIDTWD----YVKTWELMQELPKTGKTRAVGVSNF 181
            +   + L     S+  L      ++I  +D      +T + + ++ ++G  R +G S+ 
Sbjct: 123 GLSRKHILQSVKNSVERLGTYIDVLQIHRFDPTTPIKETMKALNDVVESGDVRYIGASSM 182

Query: 182 SINNLKKVLS-SPGNKVVPAVNQVEIHPLLPQE---ELLEWCHSKGILLEAYSPLGSTNA 237
                 ++ S +  +     VN    + LL +E   +L+++C    I L  +SP    + 
Sbjct: 183 LPTQFVEMQSVADKHDWFQFVNVQSCYNLLYREDERDLMQYCEKHNIALTPWSP---NHQ 239

Query: 238 PILTEPVLINLAKKHGVQTAQIVISWHVQ 266
            +LT P+ +   +     T +I+  W+++
Sbjct: 240 GLLTRPIGVESERS---TTDKIINGWNMK 265

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 49/105 (46%), Gaps = 21/105 (20%)

Query: 39  STNENEGYEAVIAALKAGYRHIDTAAIYGNE---GQVGKAINDSGVPREEIFVTTKLWST 95
           S ++   +E + A  +AG   IDTA  Y NE     +G+ +    + R++I + TK  + 
Sbjct: 49  SMSKERAFELLDAFYEAGGNFIDTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATKFTTD 107

Query: 96  -QHHDPAAG----------------LNDSLKRLGLDYVDLYLMHW 123
            + +D   G                + DSL++L  D++D+  +HW
Sbjct: 108 YKKYDVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 152

>Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 23/106 (21%)

Query: 39  STNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ---VGKAINDSGVPREEIFVTTKLWST 95
           + N+ + +E + A  +AG   +DTA  Y NE     +G+ +    V R++I + TK ++ 
Sbjct: 49  AMNKEQAFELLDAFYEAGGNCVDTANSYQNEQSETWIGEWMKLRKV-RDQIVICTK-YTG 106

Query: 96  QHHDPAAG------------------LNDSLKRLGLDYVDLYLMHW 123
            +    AG                  + DSL++L  D++D+  +HW
Sbjct: 107 DYKKYEAGDGKSANYCGNHRRSLHVSVRDSLRKLQTDWIDILYIHW 152

>KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 13/83 (15%)

Query: 24 NTGATISAVGLGT----------WQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EG 70
          NTG  IS + +G           W   +  E ++ +      G R  DTA +Y N   E 
Sbjct: 11 NTGIKISPIVVGCMSFGSKRWQAWIEDDREEAFKILKYCYDHGLRTFDTADVYSNGESEK 70

Query: 71 QVGKAINDSGVPREEIFVTTKLW 93
           +G+ +    + RE + + TK++
Sbjct: 71 FLGEFLKRYNIRRETVVILTKVY 93

>KNAG0L01560 Chr12 (276747..277769) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 13/83 (15%)

Query: 24 NTGATISAVGLGT----------WQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EG 70
          NTG  IS   +G           W   +E + +E +      G R  DTA +Y N   E 
Sbjct: 11 NTGMKISPFIVGCMSYGDRKRIPWVIEDEEKVFEILKYCYDHGVRTFDTANVYSNGVSER 70

Query: 71 QVGKAINDSGVPREEIFVTTKLW 93
           +GK +    + RE + + TK++
Sbjct: 71 LLGKFLKKYNINRETVVILTKVY 93

>NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565
          Length = 343

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 94/222 (42%), Gaps = 24/222 (10%)

Query: 37  WQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EGQVGKAINDSGVPREEIFVTTKLW 93
           W   +++E ++ +      G R  DTA +Y N   E  VG+ +    + RE + + TK++
Sbjct: 34  WVMEDKDEIFKILKHCYDRGLRTFDTADVYSNGISERLVGEFLKKYNIKRETVVIMTKIF 93

Query: 94  --STQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGKRDVE 151
               +  D   G N + + + L       +     L+ + I DG   S+  L      ++
Sbjct: 94  FPVDESLDLHHGSNVNQEAMELQ------LTLQRGLSRKHIIDGVANSVERLGTYIDVLQ 147

Query: 152 IDTWDYVKTW-ELMQELPK---TGKTRAVGVSNF---SINNLKKVLSSPG-NKVVPAVNQ 203
           I   D   +  E+M+ L     +G+ R +G S+        L+ +    G  K + A + 
Sbjct: 148 IHRLDEETSMEEIMRSLNDVVMSGQVRYIGASSMLATEFAELQFIAEKNGWFKFISAQSY 207

Query: 204 VEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAP-ILTEPV 244
             +     + EL+ +C   G+ L  +SP    NA  +LT PV
Sbjct: 208 YNLINREDERELIPFCKKHGVGLIPWSP----NARGVLTRPV 245

>YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putative
           aryl-alcohol dehydrogenase; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; mutational analysis has not
           yet revealed a physiological role
          Length = 363

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 45/106 (42%), Gaps = 21/106 (19%)

Query: 38  QSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ---VGKAINDSGVPREEIFVTTKLWS 94
           +S N+N  +E +    +AG   ID A    NE     +G+ I    + R++I + TK   
Sbjct: 45  KSMNKNRAFELLDTFYEAGGNFIDAANNCQNEQSEEWIGEWIQSRRL-RDQIVIATKFIK 103

Query: 95  TQHHDPAAGLN-----------------DSLKRLGLDYVDLYLMHW 123
           +     A   N                 DSL++L  D++D+  +HW
Sbjct: 104 SDKKYKAGESNTANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 149

>NCAS0J01740 Chr10 complement(321825..322862) [1038 bp, 345 aa] {ON}
           
          Length = 345

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 15/96 (15%)

Query: 24  NTGATISAVGLG-------TWQSTNENEGYEAVIAALK----AGYRHIDTAAIYGN---E 69
           +TG  +S + +G       +WQ   E+   E V A LK     G R  DTA +Y N   E
Sbjct: 12  STGMKVSPIIVGCMSYGSKSWQPWVEDNK-EKVFALLKHCYDVGLRTFDTADVYNNGQSE 70

Query: 70  GQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLN 105
             +G+ +    + RE + + TK++         G N
Sbjct: 71  VLLGEFLKKYNIRRETVVILTKIYFDSDDSMEVGSN 106

>ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 379

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 13/83 (15%)

Query: 24  NTGATISAVGLGT----------WQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EG 70
           NTG  IS + +G           W   ++ E ++ +  A   G R  DTA +Y N   E 
Sbjct: 48  NTGLKISPIVVGCMSFGSKEWADWLIEDKEEVFKILKRAYDRGLRTYDTADVYSNGLSER 107

Query: 71  QVGKAINDSGVPREEIFVTTKLW 93
            +G+ +    + RE + + TK++
Sbjct: 108 ILGEFLRHYNINRETVVILTKVF 130

>ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar to
           uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 346

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 20/91 (21%)

Query: 49  VIAALKAGYRH----IDTAAIYGNE----GQVGKAINDSGVPREEIFVTTKL-------- 92
           ++  LK G+ H    IDT+  YG      GQ  + I D   PR   ++ TK+        
Sbjct: 42  LVDMLKHGFNHGIRAIDTSPYYGPSEILYGQALEHIRDE-FPRNSYYICTKVGRIQLDEF 100

Query: 93  -WSTQHHDPAAGLNDSLKRLGLDYVDLYLMH 122
            +S +H      +  S +RL  DY+DL  +H
Sbjct: 101 DYSREH--VRFSVLRSCQRLKTDYLDLVYLH 129

>NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.76
           YGR250C
          Length = 940

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 31/73 (42%), Gaps = 15/73 (20%)

Query: 161 WELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNKVVPAVNQV---------------E 205
           W  ++E    GK + + + NF INN+K+      NK     N+                E
Sbjct: 291 WNQLRENNDDGKFKCIFIGNFPINNMKQESGETENKDKSITNEFNYRITPEIIIEKIKSE 350

Query: 206 IHPLLPQEELLEW 218
           + PL+P  E+L +
Sbjct: 351 LLPLIPDFEILSY 363

>NDAI0H02960 Chr8 (721089..722123) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 36/81 (44%), Gaps = 13/81 (16%)

Query: 24 NTGATISAVGLGT----------WQSTNENEGYEAVIAALKAGYRHIDTAAIYGN---EG 70
          NTG  +S + +G           W   ++ + ++ +      G+R  DTA +Y N   E 
Sbjct: 12 NTGIKVSPLIVGCMSYGSKTWAEWVEDDKEKVFQILKHCYDIGFRTFDTADVYSNGKSER 71

Query: 71 QVGKAINDSGVPREEIFVTTK 91
           +G+ +    + RE + + TK
Sbjct: 72 LLGEFLRKFNIRRETVVILTK 92

>KNAG0C05620 Chr3 (1086573..1087775) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 76/174 (43%), Gaps = 17/174 (9%)

Query: 96  QHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGNFLSI----PLLPDGKRDVE 151
           Q   PA     SL+   LD VDLY  H    L    +++G+F  I    P  PD +R   
Sbjct: 41  QKRGPAKRRTVSLENDELDPVDLYYRHIDGALPVVPMREGDFRHILQGSP--PDVQRLFA 98

Query: 152 IDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLP 211
               D +     ++E+ + G  +++ +    + +        G+K V     + +   LP
Sbjct: 99  EVVHDLLYGEGQLREVSRCGVVKSLKLVQLELTS--------GDKFVLLACLLLL--CLP 148

Query: 212 QEELLEWCHSKGILLEAYSPLGSTNAPI-LTEPVLINLAKKHGVQTAQIVISWH 264
            +++L  C + G+  E  +P G+T   +  T  V+ +LA    + T ++V S H
Sbjct: 149 LQDILPLCTALGLYYEWCTPQGNTLLELHWTNIVIFDLALHETMGTPRVVTSVH 202

>ADR215C Chr4 complement(1080543..1081562) [1020 bp, 339 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKR081C
           (RPF2)
          Length = 339

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 25/56 (44%), Gaps = 9/56 (16%)

Query: 181 FSINNLKKVLSSPGNKVVPAVNQVEIHPLL---------PQEELLEWCHSKGILLE 227
           F +  LK   SS G K +P V  VEI P L         P  EL++  H K   LE
Sbjct: 201 FRVYRLKTYRSSQGGKKLPRVELVEIGPRLDFKIGRIHTPSPELVKEAHRKAKQLE 256

>Smik_3.210 Chr3 (309527..310615) [1089 bp, 362 aa] {ON} YNL331C
           (REAL)
          Length = 362

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 53/121 (43%), Gaps = 24/121 (19%)

Query: 23  LNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEG---QVGKAINDS 79
           L  GAT S+  L    S N+   ++ + A  KAG   ID A  Y NE     +G+ + +S
Sbjct: 32  LVLGATTSSDFL---DSMNKKRAFKLLDAFNKAGGNFIDAANNYENEQWDEWIGEWM-ES 87

Query: 80  GVPREEIFVTTKLWS---------------TQHHDPA--AGLNDSLKRLGLDYVDLYLMH 122
              R++I + TK                    +H P+    + DSL +L  D++D+  + 
Sbjct: 88  RKLRDKIVICTKYAGDYKRCEAAQGKSANYCGYHQPSLRVSVRDSLHKLKTDWIDILYVQ 147

Query: 123 W 123
           W
Sbjct: 148 W 148

>Smik_79.1 Chr79 complement(3..761) [759 bp, 253 aa] {ON} YNL331C
           (REAL)
          Length = 253

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 53/121 (43%), Gaps = 24/121 (19%)

Query: 23  LNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEG---QVGKAINDS 79
           L  GAT S+  L    S N+   ++ + A  KAG   ID A  Y NE     +G+ + +S
Sbjct: 32  LVLGATTSSDFL---DSMNKKRAFKLLDAFNKAGGNFIDAANNYENEQWDEWIGEWM-ES 87

Query: 80  GVPREEIFVTTKLWS---------------TQHHDPA--AGLNDSLKRLGLDYVDLYLMH 122
              R++I + TK                    +H P+    + DSL +L  D++D+  + 
Sbjct: 88  RKLRDKIVICTKYAGDYKRCEAAQGKSANYCGYHQPSLRVSVRDSLHKLKTDWIDILYVQ 147

Query: 123 W 123
           W
Sbjct: 148 W 148

>KLLA0A03531g Chr1 (320828..323026) [2199 bp, 732 aa] {ON} similar
           to uniprot|P06103 Saccharomyces cerevisiae YOR361C PRT1
           Subunit of the core complex of translation initiation
           factor 3(eIF3) essential for translation part of a
           subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates binding
           of mRNA and tRNA(i)Met to ribosomes
          Length = 732

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 234 STNAPILTEPVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDE 293
           S  A ++T P    +   + VQ + + I WH Q  ++      H +  +  F  L++   
Sbjct: 369 SCKAFLMTLPNKRIVKTVNLVQVSNVSIHWHEQADFVCFQVDRHTKSKKTFFTNLEICKL 428

Query: 294 EMREINNISKEKGERRIVQPHWEP 317
              EI  + K + + R+++  WEP
Sbjct: 429 NESEI-PVEKIEMKDRVLELAWEP 451

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 43/106 (40%), Gaps = 29/106 (27%)

Query: 77  NDSGVPR----EEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSI 132
           ND G+      ++I V   +W   H DP       L+RLGL                +S+
Sbjct: 95  NDDGIDEIHSVKKIPVKLGMWDFDHCDPKRCSGKKLERLGL---------------IKSL 139

Query: 133 KDGN-FLSIPLLPDGKRDVEIDTWDYVK---------TWELMQELP 168
           K G  F  + + P+GK+ V  D  D +K         +W  + E+P
Sbjct: 140 KIGQRFQGLIISPNGKKVVSPDDADIIKEFGAAVVECSWARLDEIP 185

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 65/156 (41%), Gaps = 36/156 (23%)

Query: 54  KAGYRHIDTAAIYGNEGQVGKAINDSGVP-REEIFVTTKLWS---TQHHDPAAGLNDSLK 109
           KAG + IDTA IY +  ++   I +  +P R  I      +S       +    + +SL 
Sbjct: 31  KAGVKDIDTARIYPDSEKI---IGELQLPNRFTIHTKASGFSGGCLTKDNINKSIEESLS 87

Query: 110 RLGLDYVDLYLMHWPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPK 169
            LG+  V+ + +H P                    D +  +E       +T   +  L +
Sbjct: 88  LLGVPSVETFFLHSP--------------------DPETPIE-------ETLGAINSLYE 120

Query: 170 TGKTRAVGVSNFSINNLKKV--LSSPGNKVVPAVNQ 203
            GK +  G+SNF+  ++K++   +   N V+P V Q
Sbjct: 121 QGKFKKFGLSNFATEDVKRIYEYAKSKNFVLPTVYQ 156

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,815,798
Number of extensions: 1599783
Number of successful extensions: 3821
Number of sequences better than 10.0: 164
Number of HSP's gapped: 3483
Number of HSP's successfully gapped: 165
Length of query: 322
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 212
Effective length of database: 40,868,139
Effective search space: 8664045468
Effective search space used: 8664045468
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)