Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H015106.27ON31331315220.0
NDAI0F017406.27ON31331311501e-159
KNAG0M012406.27ON31427311201e-154
CAGL0E02519g6.27ON31527011131e-153
SAKL0E01474g6.27ON31127310921e-150
KAFR0G026506.27ON32127110801e-148
ZYRO0C07612g6.27ON31927310621e-145
Kwal_56.224546.27ON31527310211e-139
TDEL0G044206.27ON32227310201e-139
Kpol_1032.96.27ON31827310071e-137
KLTH0C11044g6.27ON31527010061e-137
TBLA0E030606.27ON3192739991e-136
Smik_15.1686.27ON3272739991e-135
Skud_15.1606.27ON3272739951e-135
YOL002C (IZH2)6.27ON3172739831e-133
Ecym_30316.27ON3282739831e-133
ACL002C6.27ON3292729711e-131
KLLA0D01331g6.27ON3082749681e-131
Suva_15.1736.27ON3272739671e-131
TPHA0M002906.27ON3272709501e-128
SAKL0C09218g3.90ON3142757522e-98
KLTH0C09504g3.90ON3192757504e-98
ZYRO0B06556g3.90ON3182757462e-97
TPHA0A006403.90ON3272757402e-96
Kwal_56.227043.90ON3202757358e-96
TDEL0D053403.90ON3162757104e-92
Smik_4.7693.90ON3162757087e-92
YDR492W (IZH1)3.90ON3162757071e-91
Skud_4.7663.90ON3162757001e-90
Suva_2.6683.90ON3152727001e-90
Kpol_1053.263.90ON3242706983e-90
NDAI0A071603.90ON3302926932e-89
CAGL0G04631g3.90ON3162756819e-88
AFR337W3.90ON3172686741e-86
KLLA0C12441g3.90ON3152756662e-85
Ecym_35883.90ON3052686609e-85
NCAS0I025703.90ON3142766513e-83
TBLA0B022903.90ON3262736463e-82
KAFR0A081303.90ON3192766411e-81
KNAG0K021603.90ON3232766099e-77
TBLA0B082553.90ON2962833912e-44
NCAS0C049203.90ON3262743888e-44
NDAI0G043003.90ON3182763826e-43
CAGL0I07491g3.90ON3012852733e-27
Suva_15.643.90ON3122082332e-21
Skud_15.533.90ON3122082225e-20
Smik_15.563.90ON3122432216e-20
YOL101C (IZH4)3.90ON3122432146e-19
KAFR0J006705.197ON5092311894e-15
Kpol_2002.945.197ON5772421781e-13
NDAI0I023305.197ON5782401672e-12
TPHA0E031205.197ON5692371656e-12
NCAS0D026005.197ON5432341631e-11
AAL153C5.197ON4192371611e-11
KNAG0B051005.197ON5382351593e-11
TBLA0C060505.197ON4372391549e-11
YLR023C (IZH3)5.197ON5432361513e-10
CAGL0D03322g5.197ON5452361461e-09
KLLA0F15510g5.197ON6222851442e-09
ZYRO0B10538g5.197ON5312361433e-09
Smik_12.865.197ON5422381398e-09
KLTH0B03498g5.197ON5462441399e-09
SAKL0G12980g5.197ON5632511399e-09
Skud_12.915.197ON5422421381e-08
Ecym_71095.197ON5682381362e-08
TDEL0E043205.197ON4502351334e-08
Kwal_33.151225.197ON5662421264e-07
Suva_10.1045.197ON5412351247e-07
KNAG0K006703.90ON3212221173e-06
KAFR0C014603.90ON219208730.82
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H01510
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   590   0.0  
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      447   e-159
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   436   e-154
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   433   e-153
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   425   e-150
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   420   e-148
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   413   e-145
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   397   e-139
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   397   e-139
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   392   e-137
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   392   e-137
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   389   e-136
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   389   e-135
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   387   e-135
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   383   e-133
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   383   e-133
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   378   e-131
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   377   e-131
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   377   e-131
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   370   e-128
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   294   2e-98
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   293   4e-98
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   291   2e-97
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   289   2e-96
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   287   8e-96
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   278   4e-92
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   277   7e-92
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   276   1e-91
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   274   1e-90
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   274   1e-90
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   273   3e-90
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   271   2e-89
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   266   9e-88
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   264   1e-86
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   261   2e-85
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   258   9e-85
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   255   3e-83
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   253   3e-82
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   251   1e-81
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   239   9e-77
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             155   2e-44
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   154   8e-44
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    151   6e-43
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...   109   3e-27
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    94   2e-21
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    90   5e-20
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    90   6e-20
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    87   6e-19
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    77   4e-15
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    73   1e-13
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     69   2e-12
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    68   6e-12
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    67   1e-11
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    67   1e-11
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    66   3e-11
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    64   9e-11
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    63   3e-10
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    61   1e-09
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    60   2e-09
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    60   3e-09
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    58   8e-09
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    58   9e-09
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    58   9e-09
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    58   1e-08
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    57   2e-08
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    56   4e-08
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    53   4e-07
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    52   7e-07
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    50   3e-06
KAFR0C01460 Chr3 (300109..300768) [660 bp, 219 aa] {ON} Anc_3.90...    33   0.82 

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/313 (92%), Positives = 291/313 (92%)

Query: 1   MTKNLQQRVALXXXXXXXXXXIDDDNVSXXXXXXXXXXXXLYTWDEIPEWQKDNEHIIAG 60
           MTKNLQQRVAL          IDDDNVS            LYTWDEIPEWQKDNEHIIAG
Sbjct: 1   MTKNLQQRVALTSTSTSTKTTIDDDNVSIKHTKKTTTIRKLYTWDEIPEWQKDNEHIIAG 60

Query: 61  YVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLII 120
           YVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLII
Sbjct: 61  YVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLII 120

Query: 121 NLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGP 180
           NLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGP
Sbjct: 121 NLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGP 180

Query: 181 FFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHE 240
           FFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHE
Sbjct: 181 FFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHE 240

Query: 241 TWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLK 300
           TWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLK
Sbjct: 241 TWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLK 300

Query: 301 ALLGSYELVHMNL 313
           ALLGSYELVHMNL
Sbjct: 301 ALLGSYELVHMNL 313

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  447 bits (1150), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 215/313 (68%), Positives = 244/313 (77%)

Query: 1   MTKNLQQRVALXXXXXXXXXXIDDDNVSXXXXXXXXXXXXLYTWDEIPEWQKDNEHIIAG 60
           M K +Q+R              + DN              LY WDEIPEWQKDNEHII+G
Sbjct: 1   MPKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISG 60

Query: 61  YVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLII 120
           YVRETNSF+ C  SLFY+HNE+GNVYSHL+PGV FF TM+ +KY I  + TT+  DYL+I
Sbjct: 61  YVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMI 120

Query: 121 NLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGP 180
           +LFF GAF CLILSS FHCFKSHSLK+AT GNKLDYLGIV+LIVTSMISI+++GF+DN  
Sbjct: 121 DLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPL 180

Query: 181 FFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHE 240
           FFY FS LT  FG ACA VSLKD FRSREWRPYRAGLFVAFGLSA+LPIL G  YYG  E
Sbjct: 181 FFYFFSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEE 240

Query: 241 TWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLK 300
           T+ RIQLKW++LEG FYIFGAFLYG+RFPEKYV G+FDIWGHSHQIFH+LVVVAAFCHL+
Sbjct: 241 TFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLR 300

Query: 301 ALLGSYELVHMNL 313
            LL SYE+VH  L
Sbjct: 301 GLLSSYEIVHSRL 313

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  436 bits (1120), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 205/273 (75%), Positives = 234/273 (85%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           +YTW+EIPEWQKDNEHII GYVRETNSF +C  SLFY+HNE+ NVYSHL+P + FF  + 
Sbjct: 36  IYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLF 95

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
            +KY + SFETT+  DYL I+LFFLGAFTCLILSSTFHCFKSHSLK+ATFGNKLDYLGIV
Sbjct: 96  LNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIV 155

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
           VLIVTSMISIL+YGFYD+   FY FS +TLSFG+AC +VSLKD FRSREWRPYRAGLFVA
Sbjct: 156 VLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVA 215

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLSA+LPIL+G+  YG  E + RIQ+KW++LEGVFYI GAFLYGIRFPEK   G +DIW
Sbjct: 216 FGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIW 275

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           GHSHQ+FH+LVVVAA CHLK L+ SYELVH  L
Sbjct: 276 GHSHQVFHILVVVAALCHLKGLMVSYELVHKGL 308

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  433 bits (1113), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 203/270 (75%), Positives = 232/270 (85%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LYTW+EIPEWQKDNEHI  GYVRET+S   C  SLFY+HNET N+YSHL+P + FF T+ 
Sbjct: 38  LYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIF 97

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
           F+KY + ++ TTT  DYLII++FFLGAF+CLILSSTFHC KSHSL++A FGNKLDYLGIV
Sbjct: 98  FNKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIV 157

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
            LIV SM+SIL+YGF+ N  FF  FSL+T++FG+ACA+VSLKD FRSREWRPYRA LFV 
Sbjct: 158 FLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVI 217

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLSAVLPIL G+  YGP ETWTRIQLKWV+LEGVFYIFGAFLYGIRFPEK   G+FD+W
Sbjct: 218 FGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLW 277

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVH 310
           GHSHQIFH+LVVVAA CHLKALLGSY LVH
Sbjct: 278 GHSHQIFHILVVVAALCHLKALLGSYSLVH 307

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  425 bits (1092), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 198/273 (72%), Positives = 230/273 (84%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LY+W+EIP+WQKDNEHI  GYVRETNSF  CFDSLFY+HNE+ N+Y+HL+PG+ FF  +L
Sbjct: 36  LYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVL 95

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
           FDK AI  F+TTTF DY++++LFFLGAFTCLILSSTFHC K+HSL+IA  GNKLDYLGIV
Sbjct: 96  FDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIV 155

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
            LIV+SMISI++YGF+D+G FFYGFS LTL FG ACAI SL D FRSREWRPYRA LFVA
Sbjct: 156 ALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVA 215

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLSAVLPI +GV  YG  ETW ++Q+KWV+L GVFYI GA LY +R PE+   G FDIW
Sbjct: 216 FGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIW 275

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           GHSHQIFH+LVV+AA CHLKA+L SYELVH  L
Sbjct: 276 GHSHQIFHILVVIAALCHLKAVLNSYELVHKKL 308

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  420 bits (1080), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 200/271 (73%), Positives = 228/271 (84%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LY W+EIP+WQKDNEHII+GYV+ETNSF  C +SLFY+HNE+ NVYSHL+P V F +T L
Sbjct: 40  LYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSL 99

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
            +K  +  F TTT  DYL I+LFFLGAFTCLILSSTFHCFKSHSL+IATFGNKLDYLGIV
Sbjct: 100 LNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIV 159

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
           VLI TSMIS+L+YGFYD    FY F+ +TLSFG ACA VSLKDKFRSRE R YRA LFV 
Sbjct: 160 VLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVC 219

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLSAVLP++ G+ +YG + TW RIQLKWV+LEGVFYIFGAFLYGIRFPEKY  G +DIW
Sbjct: 220 FGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIW 279

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHM 311
           GHSHQ+FH+LVV+AA CH KAL+ SYE VHM
Sbjct: 280 GHSHQLFHILVVIAALCHFKALMCSYEHVHM 310

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  413 bits (1062), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 187/273 (68%), Positives = 225/273 (82%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LYTW+EIP+WQKDNEHI+ GYVRETNS R C  SL Y+HNE+ N+Y+H +PG+ F  T +
Sbjct: 42  LYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCI 101

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
           FDK+AI +F+TTT+ DY+ I+ FF GAF+CLILSSTFHCFKSHS +++ FGNKLDYLGIV
Sbjct: 102 FDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIV 161

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
           +LIV SMISIL+Y F+D+   FY F+L+   FG +C I S  D FRSREWRPYRAGLFVA
Sbjct: 162 ILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVA 221

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLSA+LPI+ G++ YG HETWTRIQ+KWV+LEG+FYIFGAFLY IRFPE+   G FD  
Sbjct: 222 FGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFDFV 281

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           GHSHQIFH+LVV+AA CHL AL+ SYELVH NL
Sbjct: 282 GHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  397 bits (1021), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 183/273 (67%), Positives = 219/273 (80%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LY WDEIPEWQKDNEHI+ GY+ ET S   C  SL Y+HNE+ N+Y+HL+PG  F L  L
Sbjct: 41  LYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTL 100

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
           F++ AI  +ETT   DY++I+LFFLG FTCL++SSTFHCFK HSL +A  GNKLDYLGIV
Sbjct: 101 FNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIV 160

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
            L+VTSM+SILFYGF+DN  +FY FS LT+ FG AC IVSL DKFRSR+WRPYRA LFVA
Sbjct: 161 ALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVA 220

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLSA+ P++ G+ +YG   TWTRIQLKWV LEGVFYI GA LYG+RFPE+   GTFDIW
Sbjct: 221 FGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIW 280

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           G SHQ+FH+LVV+AA CHL+ALLG+Y+ VH  +
Sbjct: 281 GQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  397 bits (1020), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 179/273 (65%), Positives = 224/273 (82%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LYTWDEIP WQ+DNEHI++GYV ET S  +CF SLFY+HNE+ N+Y+HL+PG+ F   + 
Sbjct: 45  LYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLC 104

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
           FDK+A+  FETTT  DY++I+LF L +FTCL LSS FHC K+HS  +ATFGNKLDYLGIV
Sbjct: 105 FDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIV 164

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
           VL+VTSM+SI++YGF++    FY FS +T +FG+ACA+VSLK+ FR+REWRPYRA +FVA
Sbjct: 165 VLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVA 224

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLSAVLPI+TG+ YYG  E + RIQ+KWV+L G+FYI GA LYG+RFPEKY  G +DIW
Sbjct: 225 FGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIW 284

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           GHSHQ+FH+LVVVAA CHL  L+ SY LVH+ +
Sbjct: 285 GHSHQLFHVLVVVAALCHLYGLIKSYNLVHLKM 317

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  392 bits (1007), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 176/273 (64%), Positives = 221/273 (80%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           L TW+ +P+WQKDNEHI++GYV+ETNS + C  SL +IHNE+ N++SHLVP   F  T++
Sbjct: 41  LVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTII 100

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
           FDKY +  + TTT  DYL+++LF  GAFTCL++SS FHC K+HS  +++FGNKLDYLGIV
Sbjct: 101 FDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGIV 160

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
           VLIV+SM SIL+YGFYDN   ++ FS +T +FG +CA+VSL ++FR+REWRPYRA +FVA
Sbjct: 161 VLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFVA 220

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLSA+LPI  G +YYG  ET  R+QLKWVVLEGVFYIFGA LYG+RFPE+   G FDIW
Sbjct: 221 FGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDIW 280

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           GHSHQ+FH+LVVVAA CHL+ LLGSY +VH  L
Sbjct: 281 GHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  392 bits (1006), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 180/270 (66%), Positives = 219/270 (81%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LYTWDEIPEWQ+DNEHI+ GY+ ET S   C  SL Y+HNE+ N+Y+HL+PG  F L  +
Sbjct: 41  LYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAV 100

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
           F++  I  FETT   DY++I+LFFLG FTCL++SS FHCFK HSL +A  GNKLDYLGIV
Sbjct: 101 FNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIV 160

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
            L+VTS++SILFYGF+D   +F+ FS LT++FG ACA VSL +KFRSREWRPYRA LFVA
Sbjct: 161 ALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVA 220

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLSA+LP++ G ++YG  ETWTRIQL+WV+L GVFYI GA LYGIRFPE+   G FDIW
Sbjct: 221 FGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIW 280

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVH 310
           GHSHQ+FH+LVVVAA CHL+ALLG+Y+L H
Sbjct: 281 GHSHQLFHILVVVAALCHLRALLGAYKLFH 310

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  389 bits (999), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 182/273 (66%), Positives = 218/273 (79%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LYTWDEIP WQ DNE+I  GYVRETNS +  F SLFYIHNE+ N+Y+HL+P   F   +L
Sbjct: 39  LYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLL 98

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
           F+ Y +    TTT+ DY+ I+LFF+GAFTCL LSSTFHCFKSHSLKI+ FGNKLDYLGIV
Sbjct: 99  FNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIV 158

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
           +LI TS+IS+L++G++D+   FY FS +TL FG AC I SLKDKFR+REWRPYRA LFV 
Sbjct: 159 ILISTSLISVLYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVL 218

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLS VLPI+ G+M YG  E + R+QLKW++ EGV YIFGAFLYG RFPEK++ G  DIW
Sbjct: 219 FGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIW 278

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           G SHQIFH+LVV+AA CHL+ L+GSYELVH  L
Sbjct: 279 GQSHQIFHVLVVIAALCHLRGLIGSYELVHQKL 311

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  389 bits (999), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 181/273 (66%), Positives = 221/273 (80%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LY+WDEIPEWQ+DN+ I+ GYVRET+SF   F SLFY+HNE+ N+YSHLVP + FF  +L
Sbjct: 49  LYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLL 108

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
            DK  I  FETTT+ D+++I+LF+ GAF CLILSS+FHC KSHSL+IAT GNKLDYLGI 
Sbjct: 109 LDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGIC 168

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
           +LIVTSM+SILFYG+Y+    F  F+L+T+SFG AC+IVSLKDKFR REWRPYRAGLFV 
Sbjct: 169 ILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVC 228

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLS+++PI +G+  Y   E WT+IQL WV+L GV YI GA LYG+RFPEK   G FDIW
Sbjct: 229 FGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIW 288

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           GHSHQ+FH LVV+A+ CHL+ LL SYELVH+ +
Sbjct: 289 GHSHQLFHFLVVIASLCHLRGLLNSYELVHIKM 321

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  387 bits (995), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 180/273 (65%), Positives = 221/273 (80%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LY+WDEIPEWQ+DN++I+ GYVRET SF   F SLFY+HNE+ N+YSHL+P + FF  +L
Sbjct: 49  LYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLL 108

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
            DK  I  FETTT+ D++II+LF+ GAF CLILSS+FHC KSHSL+IAT GNKLDYLGI 
Sbjct: 109 LDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGIC 168

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
           +LIVTSM SIL+YG+Y+    F  F+L+T+SFG AC+IV+LKDKFR REWRPYRAGLFV 
Sbjct: 169 ILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVC 228

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLS+++PI +G+  Y   E WT+IQL WV+L GV YI GA LYG+RFPEK   G FDIW
Sbjct: 229 FGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIW 288

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           GHSHQ+FH LVV+A+FCHL+ LL SYELVH+ +
Sbjct: 289 GHSHQLFHFLVVIASFCHLRGLLNSYELVHLKM 321

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  383 bits (983), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 177/273 (64%), Positives = 220/273 (80%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LY+WDEIPEWQ+DN+ I+ GYV+ET+SF   F SLFY+HNE+ N+YSHL+P + FF  +L
Sbjct: 39  LYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLL 98

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
            DK  I  F TTT+ D+++I+LF+ GAF CLILSS+FHC KSHSL+IAT GNKLDYLGI 
Sbjct: 99  LDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGIC 158

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
           +LIVTSM+SIL+YG+++    F  F+L+T+SFG AC+IVSLKDKFR REWRPYRAGLFV 
Sbjct: 159 ILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVC 218

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLS+++PI +G+  Y   E WT+IQL WV+L GV YI GA LYG+RFPEK   G FDIW
Sbjct: 219 FGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIW 278

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           GHSHQ+FH LVV+AA CHL+ LL SYELVH+ +
Sbjct: 279 GHSHQLFHFLVVIAALCHLRGLLNSYELVHIKM 311

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  383 bits (983), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 167/273 (61%), Positives = 215/273 (78%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           L++W EIPEWQ+DNEHI+ GYV+ETNSF+    SL Y+HNE+ N+Y+HL+PGV FF  + 
Sbjct: 48  LFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLF 107

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
            +KY I  F+TTT+ DY II+ FF+GAF CL++S T+HC KSHS  ++  GN+LDY+GIV
Sbjct: 108 LNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIV 167

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
           +LI TSM S+L+YGFY++   FYGFS +TL  G+ C +V+L  +FRSR WRPYRA +FVA
Sbjct: 168 ILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVA 227

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLS++LPIL  ++YYG  ETW  +QL W++LEGV YIFGAF+YGIRFPE    G+FDIW
Sbjct: 228 FGLSSILPILASILYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIW 287

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           GHSHQ+FH+LVV+AA CH KA+  SYELVH  L
Sbjct: 288 GHSHQLFHVLVVIAALCHFKAVTQSYELVHFRL 320

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  378 bits (971), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 169/272 (62%), Positives = 213/272 (78%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           L +WD++P+WQKDNEHI++GYVRETNS+R+ F SLFY+HNE+ N+YSHL+PG+ F    L
Sbjct: 52  LCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIAL 111

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
           F+KY +  + TTT+ DYL+I++F LGA  CL LS  +HC KSHSL+++ FGNKLDY+GIV
Sbjct: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
            LI  SMIS ++YGFYD+   F  FS +TLS   ACA+VSL   FRSREWR YRA +F A
Sbjct: 172 ALISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTA 231

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLS +LP++T   YYGP E ++RIQLKW+ LEGV YI GA LYG+RFPEK   G+FDIW
Sbjct: 232 FGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIW 291

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHMN 312
           GHSHQ+FH+LVV+AA CHL+ALL  Y+ VH N
Sbjct: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  377 bits (968), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 180/274 (65%), Positives = 213/274 (77%), Gaps = 1/274 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           +Y+WDEIP+WQKDNEHI+ GYVRET S++  F SLFY+HNE+ N+Y+HL+P V  F  ML
Sbjct: 33  VYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIML 92

Query: 101 FDKYAIVS-FETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGI 159
           F  + +++ + TT+  DY +INLFF G  TCL +SS FH  K HSL IATFGNKLDYLGI
Sbjct: 93  FATHHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGI 152

Query: 160 VVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFV 219
           VVLI TSMISILFYGF+D+   FY F+ LT  FG  C  +SLKDKFRSREWRPYRA +FV
Sbjct: 153 VVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFV 212

Query: 220 AFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDI 279
            FGLSAV PI+ G + YG  ETW R+QL WV+ EGV YIFGAFLYG+RFPE+   G FDI
Sbjct: 213 LFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDI 272

Query: 280 WGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           WGHSHQ+FH+LVVVAA CHLKAL+ SY LVH  L
Sbjct: 273 WGHSHQLFHVLVVVAALCHLKALVVSYGLVHQAL 306

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  377 bits (967), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 179/273 (65%), Positives = 222/273 (81%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           +Y+WDEIPEWQ+DN++I+ GYV+ET+SF   F SLFY+HNE+ N+YSHL+P V F   +L
Sbjct: 49  VYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLL 108

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
            DK  I  FETTT+ D+++I+LFF GAF CLILSS+FHCFKSHSLKIAT GNKLDYLGI 
Sbjct: 109 LDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGIC 168

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
           +LIVTSM+SIL+YG+YD  P F  F+L+T+SFG AC+IVSLKDKFR REWRPYRAGLFV 
Sbjct: 169 ILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVC 228

Query: 221 FGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIW 280
           FGLS+++PI +G+ YY   E W +IQL WV+L G  YI GA LYG+RFPEK   G FDIW
Sbjct: 229 FGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIW 288

Query: 281 GHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           GHSHQ+FH LVV+A+ CH++ +L SYELVH+ +
Sbjct: 289 GHSHQLFHFLVVIASLCHMRGVLNSYELVHIKM 321

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  370 bits (950), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 174/270 (64%), Positives = 210/270 (77%)

Query: 44  WDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLFDK 103
           WD++P+WQKDNEHI  GYV+ETNSF  CF+SLF++HNE+ N+YSH+VPG+     +L D 
Sbjct: 56  WDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDI 115

Query: 104 YAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVVLI 163
             I  F TTTF DY +I+LF  GAF+CLILSS FH  KSHSL +A +GNKLDYLGIV+LI
Sbjct: 116 NIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILI 175

Query: 164 VTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFGL 223
           VTSMISIL+YGFYD   FF+ FS +T+ FG AC  VSL +KFRSREWRPYRA LFV FGL
Sbjct: 176 VTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGL 235

Query: 224 SAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWGHS 283
           SAV P+LTG+ YYG  +T+ RIQLKW+V EG FYIFGAFLY +R+PE+   G FD+WGHS
Sbjct: 236 SAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHS 295

Query: 284 HQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           HQIFH+ VV+AA+ H   LL +YE  H  L
Sbjct: 296 HQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  294 bits (752), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 142/275 (51%), Positives = 195/275 (70%), Gaps = 2/275 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           L T++E+P+WQKDNE I+ GYVRET S   CF SL Y HNET N+Y+HLVPGV + L ++
Sbjct: 31  LCTFEELPDWQKDNELILDGYVRETRSVSECFKSLLYFHNETVNIYTHLVPGVTYLLMLM 90

Query: 101 F--DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
           F  D   I  F ++T TDY+IIN F LGAF CL+ SS FHC K HS + +   +K+DY+G
Sbjct: 91  FLTDFILIPKFPSSTMTDYIIINFFLLGAFVCLMCSSCFHCLKQHSEEHSDIWSKVDYMG 150

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I+VLI  SM+SIL+YGF+D+   F  F+++T+  GS CA   L D+F S+ +R +RA  F
Sbjct: 151 IIVLISCSMVSILYYGFHDHLFHFKIFTVVTVILGSCCAAFVLNDRFNSKNFRVFRASFF 210

Query: 219 VAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFD 278
           V+FG S ++PI+ G++ +G  E+  R+QLK+V LE VFYI GA  YG R PE +  G FD
Sbjct: 211 VSFGFSGLVPIIFGLVKFGISESVHRVQLKYVGLEAVFYIGGAVFYGFRIPENFGPGKFD 270

Query: 279 IWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           + GHSHQIFH++VV+ + CHL+A++GSY  +H  +
Sbjct: 271 LVGHSHQIFHVMVVLGSLCHLRAVVGSYIFMHTGV 305

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  293 bits (750), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 135/275 (49%), Positives = 192/275 (69%), Gaps = 2/275 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           L  ++E+P+WQ+DN+ I+AGYVRETNS ++CF+SL Y HNET N+Y+HL+P   + + ++
Sbjct: 34  LCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVNIYTHLIPSGTYLVMLM 93

Query: 101 F--DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
           F  D + I  F TTT +DY++IN F LGAF CL+ S+ FHC K HS   +   +K+DY+G
Sbjct: 94  FFTDLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVDYMG 153

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I+VLI  S +S+L+YGFYD    F  F++  +  GS CA   L D+F ++ WR  RAG F
Sbjct: 154 IIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFF 213

Query: 219 VAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFD 278
           V FG S ++PI+ G++ +G  E+  R+QL++V+LE +FYI GA +YG R PE  + G FD
Sbjct: 214 VTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAVIYGFRIPETLLPGKFD 273

Query: 279 IWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
             GHSHQIFH+LVV+ + CH +ALLGSY  +H  +
Sbjct: 274 FVGHSHQIFHILVVLGSLCHFRALLGSYFFMHTGI 308

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  291 bits (746), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 192/275 (69%), Gaps = 2/275 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LY + E+PEWQ+DN+ I+ GY+RET S  +C  SLF  +NET N+Y+HLV  V +FL ML
Sbjct: 32  LYDFHELPEWQQDNDKILTGYIRETKSVLKCVRSLFIWNNETVNIYTHLVSAVSYFLLML 91

Query: 101 --FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
              D   +  F T+TFTDY +IN + LGAF CL+ SS FH FK HS   +   +K+DY+G
Sbjct: 92  GITDLVMVPHFPTSTFTDYSVINFYLLGAFGCLMCSSCFHTFKQHSGPHSDAWSKVDYMG 151

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I+VLI  SMIS+++YGF+D+  +F  F++LTL+  +AC +  L DKF  +++RP RAG F
Sbjct: 152 IIVLITCSMISLIYYGFFDHMEYFRLFTVLTLTLATACTVCVLSDKFNHKDFRPLRAGFF 211

Query: 219 VAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFD 278
           +AFGLS V P+  G++ +G      R+QLK++ LE +FYI GA +YG R PE    G FD
Sbjct: 212 IAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAGALIYGFRIPETMFPGRFD 271

Query: 279 IWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
            WGHSHQIFH+LVV+A+F HLKA++GSY   H +L
Sbjct: 272 FWGHSHQIFHVLVVIASFLHLKAVMGSYIFKHSHL 306

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  289 bits (740), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 138/275 (50%), Positives = 196/275 (71%), Gaps = 2/275 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LY++ E+PEWQKDNE II GYVRETNS+ +CF SL Y HNE+ N+Y+HL+PG+V+F+ +L
Sbjct: 45  LYSFHELPEWQKDNELIIQGYVRETNSWFKCFHSLSYFHNESINIYTHLIPGLVYFIMLL 104

Query: 101 F--DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
           F  D   + SF +TT  DY++I+ + LGAF CL+ SS FHC K HS   + F +K+DY+G
Sbjct: 105 FYTDLLVVPSFPSTTIMDYIVIDFYLLGAFICLVGSSCFHCLKQHSEDQSNFWSKIDYVG 164

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I+ LI  S+IS+L+YG++D+  +F  F+L+TL   + C +  L ++F ++ +RP RAG F
Sbjct: 165 IICLISCSLISLLYYGYFDHFIYFKVFTLITLILATICTVCVLDERFNAKNFRPIRAGFF 224

Query: 219 VAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFD 278
           V F  SAV+PI TG++ +   E   RIQL++V  E  FY+ GA LYG R PE +  G FD
Sbjct: 225 VVFATSAVIPICTGLIKFDYVEVINRIQLRFVGWETFFYVVGALLYGYRIPEIFAPGRFD 284

Query: 279 IWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           + G SHQIFH++VV+ +  HLKA++GSYE +H +L
Sbjct: 285 LVGSSHQIFHVMVVIGSLFHLKAVIGSYEFMHKSL 319

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  287 bits (735), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 132/275 (48%), Positives = 189/275 (68%), Gaps = 2/275 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           L  ++E+PEWQ+DNE I+AGYVRET S R+C +SL Y HNET N+Y+HL+P   + + ++
Sbjct: 35  LCRFEELPEWQRDNEKILAGYVRETRSMRKCLESLTYFHNETLNIYTHLIPSGTYLVLLM 94

Query: 101 F--DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
           F  D + I  F +TT +DY++IN + LGAF CL+ S+ FHC K HS   +   +K+DY+G
Sbjct: 95  FFTDVFLIPHFPSTTMSDYIMINFYLLGAFLCLLCSTCFHCLKQHSEAQSNIWSKVDYMG 154

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I+VLI  S +S+L+YGF+D    F  F++  +  GS CA   L D+F ++ WR  RAG F
Sbjct: 155 IIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFF 214

Query: 219 VAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFD 278
           V FG S ++PI+ G++ +G  E+  R+QL++V+LE  FYI GA +YG R PE  + G FD
Sbjct: 215 VTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVLLEAFFYIGGAIIYGFRIPETLIPGKFD 274

Query: 279 IWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
             GHSHQIFH+LVV+ + CH +AL+GSY  +H  +
Sbjct: 275 FVGHSHQIFHILVVLGSLCHFRALIGSYFFMHTGI 309

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  278 bits (710), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 133/275 (48%), Positives = 191/275 (69%), Gaps = 2/275 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LY ++E+PEWQ+DN+ I+ GYVRET S  RC DSL Y +NE+ N+Y+HL+  V +F+ +L
Sbjct: 32  LYHFNELPEWQQDNDKILTGYVRETKSVLRCLDSLSYWNNESVNIYTHLLSAVAYFVLLL 91

Query: 101 F--DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
           F  D   I SF +TT TDY+IIN + LGAF CL+ SS FHCFK HS   +   +K+DY+G
Sbjct: 92  FFTDILLIPSFPSTTMTDYIIINFYLLGAFVCLMCSSCFHCFKQHSNSQSDAWSKVDYMG 151

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I+ LI  S+IS+L+YG++D+  +F  FS++T+    AC++  L D+F + + RP RA  F
Sbjct: 152 IIGLISCSVISLLYYGYFDHVFYFKLFSVITVVLAMACSVCVLSDRFNTSDMRPLRASFF 211

Query: 219 VAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFD 278
           + F  S+V+PI TG+  +G  E + R+QL++V  E  FY+ GA LYG R PE    G FD
Sbjct: 212 ITFAFSSVIPIATGMFKFGWTEVFHRVQLRFVGWEAFFYLSGALLYGYRIPETIAPGKFD 271

Query: 279 IWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
             G SHQ+FH+LVV+ +FCHL+A++GSY  +H ++
Sbjct: 272 FIGSSHQLFHVLVVLGSFCHLRAVMGSYMFMHAHI 306

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  277 bits (708), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 130/275 (47%), Positives = 193/275 (70%), Gaps = 2/275 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFL--T 98
           L+ +DE+PEWQKDN+ I+ GYVRET S+++C  SLFY +NET N+Y+HLVP V++F+   
Sbjct: 40  LHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAVIYFVFAI 99

Query: 99  MLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
            L + + I  F +T+++DY +IN+F +GAF+CL+ SS FHC K HS K + F +KLDYLG
Sbjct: 100 TLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLG 159

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I+ LI  SMI I+++G++D+  +F  F+++TL   + C +  L +KF +  +RP+RA  F
Sbjct: 160 IISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHEKFNTSTFRPFRAMFF 219

Query: 219 VAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFD 278
           + FG S +LP+ TG   +G      RI++ +V  E +FYI GA +YG R PE    G FD
Sbjct: 220 ILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFD 279

Query: 279 IWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
             G SHQIFH++VV+ + CHLKA++GSY+L+H ++
Sbjct: 280 FLGSSHQIFHIMVVLGSICHLKAIIGSYKLMHSHI 314

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  276 bits (707), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 130/275 (47%), Positives = 193/275 (70%), Gaps = 2/275 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFL--T 98
           L+ +DE+PEWQKDN+ I+ GYVRET S+++C  SLFY +NET N+Y+HLVP +V+F+   
Sbjct: 40  LHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAI 99

Query: 99  MLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
            L + + I  F +T+++DY +IN+F +GAF+CL+ SS FHC K HS K + F +KLDYLG
Sbjct: 100 TLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLG 159

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I+ LI  SMI I+++G++D+  +F  F+++TL   + C +  L DKF +  +RP+RA  F
Sbjct: 160 IISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFF 219

Query: 219 VAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFD 278
           + FG S +LP+ TG   +G      RI++ +V  E +FYI GA +YG R PE    G FD
Sbjct: 220 ILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFD 279

Query: 279 IWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
            +G SHQIFH++VV+ + CHLKA++ SY+L+H ++
Sbjct: 280 FFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHI 314

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  274 bits (700), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 128/275 (46%), Positives = 191/275 (69%), Gaps = 2/275 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFL--T 98
           L+ +DE+PEWQKDN+ I+ GYVRET S+++C  SLFY +NET N+Y+HLVP +++FL   
Sbjct: 40  LHNFDELPEWQKDNDKILTGYVRETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAI 99

Query: 99  MLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
            L + + I  F +T+++DY +IN+F +GAF+CL+ SS FHC K HS + + F +KLDYLG
Sbjct: 100 TLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLG 159

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I+ LI  SMI I+++G++D+  +F  F+ +TL   + C +  L +KF +  +RP+RA  F
Sbjct: 160 IISLISCSMIPIIYFGYFDHVSYFSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFF 219

Query: 219 VAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFD 278
           + FG S +LP+ TG   +G      RI++ +V  E +FYI GA +YG R PE    G FD
Sbjct: 220 ILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFD 279

Query: 279 IWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
             G SHQIFH++VV+ + CHLKA++ SY+L+H ++
Sbjct: 280 FLGSSHQIFHIMVVLGSLCHLKAIIDSYKLMHSHI 314

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  274 bits (700), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 190/272 (69%), Gaps = 2/272 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFL--T 98
           L+ + E+P+WQ+DN+ I+ GYVRET S+++C  SLFY +NET N+Y+HLVP +V+F+   
Sbjct: 39  LHDFHELPDWQRDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGV 98

Query: 99  MLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
            L + + I  F +TT++DY +IN+F +GAF CL+ SS FHC K HS K + F +KLDYLG
Sbjct: 99  TLTNYFLIPVFPSTTWSDYTVINIFLMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLG 158

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I+ LI  SMI I+++G++D+  +F  F+++TL   + C I  L DKF +  +RP+RA  F
Sbjct: 159 IISLISCSMIPIIYFGYFDHASYFSLFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFF 218

Query: 219 VAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFD 278
           + FG S +LP+ TG+  +G      RI++ +V  E +FYI GA +YG R PE    G FD
Sbjct: 219 ILFGFSGLLPLTTGLFKFGLQGVLNRIRVSFVFWEALFYISGALIYGFRIPETLAPGKFD 278

Query: 279 IWGHSHQIFHLLVVVAAFCHLKALLGSYELVH 310
            +G SHQIFH++VV+ + CHLKA++ SY+L+H
Sbjct: 279 FFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMH 310

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  273 bits (698), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 132/270 (48%), Positives = 184/270 (68%), Gaps = 2/270 (0%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLF--DK 103
           E+P+WQKDNE I+ GYVRETNS ++C  SL   +NE+ N+YSHL+  + +F+ +LF  D 
Sbjct: 46  ELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVLLFYTDI 105

Query: 104 YAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVVLI 163
             I SF +TTF DY++I+L+ LGAFTCLI SS FHC K HS   +   +K+DY+GI+ LI
Sbjct: 106 LCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYIGIICLI 165

Query: 164 VTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFGL 223
             S+IS+L+YG+ D+  +F  F+++TL   + C I  L  +F S+ +RP RAG F+ F +
Sbjct: 166 TCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGFFILFSM 225

Query: 224 SAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWGHS 283
           SAV+PI  G   +G  E   RIQL++V  E  FY+ GA LYG R PE    G FD+ G S
Sbjct: 226 SAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNFDLVGSS 285

Query: 284 HQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           HQIFH++V++ +  HLKA+LGSY  +H N+
Sbjct: 286 HQIFHIMVILGSVFHLKAVLGSYTFMHSNI 315

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  271 bits (693), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 139/292 (47%), Positives = 194/292 (66%), Gaps = 4/292 (1%)

Query: 23  DDDNVSXXXXXXXXXXXXLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNET 82
           D+D               L  +DE+PEWQKDN+ I+ GYVRETNSF  CF SLFY++NET
Sbjct: 35  DNDTSQKPKTNRRKRKIHLSKFDELPEWQKDNDKILTGYVRETNSFIHCFQSLFYLNNET 94

Query: 83  GNVYSHLVPGVVFF---LTMLFDKY-AIVSFETTTFTDYLIINLFFLGAFTCLILSSTFH 138
            N+Y+HL+P +++    LT +F  + AI  F TT+  DY++IN+F LGAFTCL+LSS FH
Sbjct: 95  INIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYIVINIFILGAFTCLLLSSCFH 154

Query: 139 CFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAI 198
           C K HS K  T  +KLDY+GI++LI  S+I IL++G++D   +F  F++LT SF   C+I
Sbjct: 155 CLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDRLSYFKFFTILTFSFAIVCSI 214

Query: 199 VSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYI 258
           + L +KF    +RP RAGLF+ F  + ++P++TG   +G      RI L +V+LE +FYI
Sbjct: 215 IVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGYKGVMERISLNFVLLEAIFYI 274

Query: 259 FGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVH 310
            G  LYG R PE +  G FD++G SHQIFH+ VV+ + CH  A++ SY L+H
Sbjct: 275 IGTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLGSICHFGAVIKSYCLMH 326

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  266 bits (681), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 128/275 (46%), Positives = 185/275 (67%), Gaps = 4/275 (1%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTM- 99
           L+ ++E+PEWQKDN+ I+ GYVRETNSF+RC  SL Y++NE+ N+Y+HL+P V F++++ 
Sbjct: 38  LWHFNELPEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESVNIYTHLIPAV-FYISLS 96

Query: 100 --LFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYL 157
             L + + I  + +T+  DY+IIN+FFLGAF CL+ SS FHC K HS       +KLDYL
Sbjct: 97  LYLANVFLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMKQHSESQCNVWSKLDYL 156

Query: 158 GIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGL 217
           GI+ LI  S + +++YG++D+   F  F+ +TL     C++  L DKF + E+RP RA  
Sbjct: 157 GIICLISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVLTDKFNTTEYRPIRASF 216

Query: 218 FVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTF 277
           F  FG S ++P+  G + +G      RI L ++ LE +FYI GA +YG RFPE    G F
Sbjct: 217 FTLFGFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGAIIYGFRFPETIAPGKF 276

Query: 278 DIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMN 312
           D +G SHQIFH++VV+ + CHL A++ SY L+H N
Sbjct: 277 DFFGSSHQIFHIMVVLGSICHLFAMVESYHLIHSN 311

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  264 bits (674), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 178/268 (66%), Gaps = 2/268 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LYT+DE+P WQKDNE I++GYVRETNS + C  ++ Y +NE+ N+Y+HL+PGV + +  L
Sbjct: 34  LYTFDELPAWQKDNELILSGYVRETNSVKECLRAMTYFNNESINIYTHLIPGVAYLVLFL 93

Query: 101 FDKYAIVS--FETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
                +++         ++ ++  + LGAFTCL  SS FHC K HS   +   +K+DYLG
Sbjct: 94  IFADLVLAQLLPGLDAGEHRMLRFYLLGAFTCLACSSCFHCLKQHSEPHSRLWSKVDYLG 153

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I+  I  S IS+L+YG++     F  FS LT++  SACA++ L D F +  +RP RA LF
Sbjct: 154 ILAQITCSTISLLYYGYHSYPSHFVFFSTLTVALCSACAVLVLNDSFNTVAFRPLRAFLF 213

Query: 219 VAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFD 278
           +AFGLS V+P+L G   +G  E   RIQLK+V+ E VFYI GA +YG R PE++  G FD
Sbjct: 214 MAFGLSGVIPVLAGSYQFGFAEWAARIQLKYVLYEAVFYITGALVYGFRIPERFAPGKFD 273

Query: 279 IWGHSHQIFHLLVVVAAFCHLKALLGSY 306
           + GHSHQIFHLLVV+   CH +A+ GSY
Sbjct: 274 MVGHSHQIFHLLVVLGTLCHFRAVTGSY 301

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  261 bits (666), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 185/275 (67%), Gaps = 2/275 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTM- 99
           LY + E+PEWQ+DN+ II GY+RET S + C  SLF  HNE+ N+YSHLVP + + + + 
Sbjct: 32  LYRYSELPEWQQDNDKIITGYIRETKSVKECVKSLFLFHNESINIYSHLVPTITYLVLLV 91

Query: 100 -LFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
            L D + +  F  +T    ++I+ F LG+  CL  SS FHC K HS       +K+DY+G
Sbjct: 92  GLADMFLVPQFPNSTMMQSVMIHFFLLGSVLCLGCSSFFHCLKQHSESHCHIWSKVDYMG 151

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I+++I  S+IS+L+YGF+D+   F  F++ T+  G+ C + +L DKF S+ +RP+RA  +
Sbjct: 152 IIIMITCSIISLLYYGFHDHIFHFKCFTVFTVILGTICTVFALHDKFNSKTFRPFRAMFY 211

Query: 219 VAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFD 278
           V FGLS ++PI+TG   +G +E   R+QLK+V+LE +FYI GA +YG RFPE    G FD
Sbjct: 212 VTFGLSGIVPIVTGFWKFGAYEAIRRVQLKYVLLEAMFYIAGAVIYGFRFPEVLAPGKFD 271

Query: 279 IWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
             GHSHQIFH++VV+ + CH +A+LGSY  +H  +
Sbjct: 272 FVGHSHQIFHIMVVLGSICHFRAILGSYVFMHTGM 306

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  258 bits (660), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 177/268 (66%), Gaps = 2/268 (0%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LY++DE+PEWQKDNE I  GYVRETNSF  C  S+ Y +NE+ N+Y+HLVP V +F+ +L
Sbjct: 22  LYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSVTYFILLL 81

Query: 101 FDKYAIVS--FETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
                +V+  F  TT  +Y++I+ +  G F CL+ S+ FHC K HS       +K+DY+G
Sbjct: 82  LFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIWSKVDYIG 141

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I+V I +S++SIL+YGFYD+       S+LTL+ G  C    L D+F + ++R  RA  F
Sbjct: 142 IIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYRLLRAIFF 201

Query: 219 VAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFD 278
             FG S V+P+L G+  +G  E   RIQLK+V+   +FYIFGA +YG R PE    G FD
Sbjct: 202 TVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEALAPGKFD 261

Query: 279 IWGHSHQIFHLLVVVAAFCHLKALLGSY 306
             GHSHQIFHLLVV+ + CH +A++GSY
Sbjct: 262 FIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  255 bits (651), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 129/276 (46%), Positives = 189/276 (68%), Gaps = 4/276 (1%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTM- 99
           L+ ++E+PEWQ+DN+ I+ GYVRET SF++C  SL Y +NET N+Y+HL+P + F+LT+ 
Sbjct: 39  LFNFNELPEWQRDNDKILTGYVRETKSFKQCLQSLLYWNNETINIYTHLIPAL-FYLTIS 97

Query: 100 --LFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYL 157
             L +   +  F TT+  DY +IN+F +GAF CLILSS FHC K HS +  T  +KLDY+
Sbjct: 98  VTLINYVVVPHFPTTSIMDYFVINVFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYM 157

Query: 158 GIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGL 217
           GI++LI  S+I ++++G++D+  +   F +LT SF + C+I  L +KF    +RP+RA +
Sbjct: 158 GIIILISCSLIPMIYFGYFDHLYYVNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIV 217

Query: 218 FVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTF 277
           F+ F  S  +PILTG   +G H  + R+ LK+V  E +FYI GA LYG R PE +  G F
Sbjct: 218 FMLFSFSGFIPILTGFYLFGFHGVFERVALKFVAWEALFYITGATLYGFRIPECFKPGDF 277

Query: 278 DIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           D  G SHQIFH+LVV+ + CH +A++ SY L+H ++
Sbjct: 278 DFLGSSHQIFHILVVLGSICHFRAVIKSYILMHSSM 313

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  253 bits (646), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 120/273 (43%), Positives = 179/273 (65%), Gaps = 3/273 (1%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           LYT++E+P WQ+DNE I+ GY+RETNS++ C  SL + HNET N+YSH +   ++ L ++
Sbjct: 43  LYTYEELPSWQQDNEMILTGYIRETNSWKLCLRSLTFFHNETINIYSHGISAAIYLLLLV 102

Query: 101 F---DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYL 157
           F   +   + SF TTT  DYL+++++ LGA TCL LSS FHC K HS   +   +K+DY+
Sbjct: 103 FFFTNLIYLPSFPTTTLHDYLVLDIYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYI 162

Query: 158 GIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGL 217
           GI+ LI  S IS+L++G+ D+  +F  F++ T      C +    +KF +R+W+  RA  
Sbjct: 163 GIICLITCSTISLLYFGYRDHFNYFKFFAISTFILAITCTVFVTMEKFNTRDWKHVRALF 222

Query: 218 FVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTF 277
           F+AF  S ++P++TG+  +G  E W R+QL  + LE + Y+ GA LYG R PE +  G F
Sbjct: 223 FIAFAGSGLIPLITGINIFGFPEVWQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGKF 282

Query: 278 DIWGHSHQIFHLLVVVAAFCHLKALLGSYELVH 310
           D  G+SHQ FH+ VV+ +  HL+AL+GSY  +H
Sbjct: 283 DNIGNSHQWFHIFVVLGSLLHLRALVGSYYFMH 315

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  251 bits (641), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 123/276 (44%), Positives = 183/276 (66%), Gaps = 6/276 (2%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFF---- 96
           LY + E+P WQ+DN+ I+ GYVRETNSF +C +SLFY++NE+ N+YSHL+P +++     
Sbjct: 39  LYHFHELPTWQQDNDKILGGYVRETNSFTKCIESLFYLNNESINIYSHLIPSLIYLTIAV 98

Query: 97  -LTMLFDKY-AIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKL 154
            L +  D++  I  + TTT  D++ IN+F +GAF CL+ S  FH  K HS     F +++
Sbjct: 99  MLLIEIDQFLNIPIYPTTTKYDFIFINIFLVGAFLCLLGSGCFHLLKQHSELQCNFWSRI 158

Query: 155 DYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYR 214
           DY+GI+VLI  SM+ +L+YGF+D+   FY F  LTL+F S C+I+ + + F   ++R  R
Sbjct: 159 DYMGIIVLISCSMMPVLYYGFFDHIVLFYCFITLTLAFASVCSIIVMSETFNLSKYRLLR 218

Query: 215 AGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVN 274
           A +F AFG S ++P++ G   +G    + RI LK++  E VFY+ GA LYG R PE  + 
Sbjct: 219 ACVFAAFGFSGLIPMIVGFSKFGLSGVFQRISLKFIFWESVFYLVGATLYGFRIPESILP 278

Query: 275 GTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVH 310
           G FD++G SHQ+FH  VV+ +  H KA++ SY L+H
Sbjct: 279 GKFDLFGSSHQLFHCFVVIGSVLHFKAVIESYILMH 314

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  239 bits (609), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 124/276 (44%), Positives = 182/276 (65%), Gaps = 3/276 (1%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFL--T 98
           L  ++E+P WQ+DN+ I  GYVRET S RRC  SL Y +NE+ N+YSHLVP V++    T
Sbjct: 47  LCRYEELPAWQQDNDCIRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGAT 106

Query: 99  MLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLG 158
           +   ++ +  F TTT++DYLIIN F +GA  CL+ SS FHC K HS +     +++DY+G
Sbjct: 107 LALSQWGVPRFPTTTWSDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMG 166

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDK-FRSREWRPYRAGL 217
           I++LI  S I ++++G++D       F+ +T++ G AC+ V L +K F S  ++  RA  
Sbjct: 167 IILLIACSTIPMIYFGYFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAF 226

Query: 218 FVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTF 277
           F+AF  + ++P+ TG + +G      RI LK+V  E VFYI GA LYG R PE ++ G  
Sbjct: 227 FIAFAFNGLIPMATGFVKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKV 286

Query: 278 DIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
           D+WG+SHQ+FH++VV  + CHLKA+L SY L+H +L
Sbjct: 287 DLWGNSHQMFHVMVVFGSLCHLKAVLESYSLMHRHL 322

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  155 bits (391), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/283 (30%), Positives = 147/283 (51%), Gaps = 28/283 (9%)

Query: 41  LYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTML 100
           L  ++++P+WQKDN  I+  YVRETNS  +   S+F  H+E+ N+++HL+P +++     
Sbjct: 8   LCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPALLY---AK 64

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
           F   AI + E  ++     I  + +    C +LSS FH FK  S++   F  KLDY+GI 
Sbjct: 65  FTYNAITTLEQVSYP----IVFYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGIS 120

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREW---------- 210
           +LI  +++S+   GF ++       + +T +      ++ L  K   ++           
Sbjct: 121 LLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDNDGTL 180

Query: 211 -----------RPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIF 259
                      +  RA LF + GLS ++P++TG+  YGP   + +I +  V+   + YI 
Sbjct: 181 SEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVLCYIV 240

Query: 260 GAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKAL 302
           G  +Y  + PEK+  G FD+ G SHQ+FH+ +V    CH  A+
Sbjct: 241 GTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAI 283

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  154 bits (388), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 95/274 (34%), Positives = 152/274 (55%), Gaps = 7/274 (2%)

Query: 45  DEIPEWQKD--NEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLF- 101
            E+P+WQK   N  II GYVRETNS  +C  ++ Y +N+T N+  + V   V+F  +LF 
Sbjct: 45  KELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFF 104

Query: 102 -DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIV 160
            D Y I S   TT +DY+++N +  GAF    L+S F+  +SHSL       KL +L  +
Sbjct: 105 TDLYLIPSSPATTMSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFI 164

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
             I TS+I+ L+Y F+DN  +F   ++ TL   S  AI +L ++F  R+ R  R  + + 
Sbjct: 165 NYISTSIITQLYYTFFDNVFYFKFLTISTLLISSIFAIFTLSEQFL-RKNRSQRNMVSIT 223

Query: 221 FGLS-AVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDI 279
           F +S  +LP  + +  +       R++ K ++LE   Y+F   L  ++ PE++ +  FD 
Sbjct: 224 FIVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPERF-SENFDF 282

Query: 280 WGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
            G+S  I+H+ +++ +  H K LL SY  +H  L
Sbjct: 283 IGNSENIYHICIILGSLLHFKMLLNSYFFMHSGL 316

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  151 bits (382), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 90/276 (32%), Positives = 163/276 (59%), Gaps = 11/276 (3%)

Query: 42  YTWDEIPEWQKD--NEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTM 99
           Y   E+PEWQ++  +  +I G+++ETNSF++C  S  Y HN + N+  + +   V+F+ +
Sbjct: 34  YKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGIAATVYFMLL 93

Query: 100 LF--DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYL 157
            F  D Y I SF +TT +DY+++NL+ L A    ++ + F+  KSHS + A    KL+ +
Sbjct: 94  FFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQAFLWYKLNNI 153

Query: 158 GIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGS--ACAIVSLKDKFRSREWRPYRA 215
           G++  I +S++++L+Y ++D   +F  F+++TL   +   C+I+S  D F ++  R  + 
Sbjct: 154 GLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIIS--DSF-NKMTRIRKN 210

Query: 216 GLFVAF-GLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVN 274
            L +A+  L  ++P L  ++ +G  +   RI L  ++LE   Y FG  +   + PE++ N
Sbjct: 211 FLLLAYIILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQLPERFFN 270

Query: 275 GTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVH 310
            +FD  G+S  ++ L ++V +F H K L+ SY L+H
Sbjct: 271 -SFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMH 305

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score =  109 bits (273), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 82/285 (28%), Positives = 142/285 (49%), Gaps = 18/285 (6%)

Query: 43  TWDEIPEWQKD--NEHIIAGYVRETN-SFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTM 99
           T +++P W +   N  I  GY   TN ++  C   L   +N++ ++Y +LV G++  + +
Sbjct: 12  TLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNLVCGLISGVML 71

Query: 100 LF--DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYL 157
           LF  D   I S  +TT TDY+IINLF +   T     +     K HS       N+   L
Sbjct: 72  LFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEYQGKLWNQAKQL 131

Query: 158 GIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGL 217
            +V+L+  S++++L+Y F+D+   F  F + T    S  +IV + D+++    R  +   
Sbjct: 132 ALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYK----RVQKLSC 187

Query: 218 FVAFG-LSAVLPILTGVMYYGPHETWTRIQLKWVVL--EGVFYIFGAFLYGIRFPEKYVN 274
            V FG LS  LPI   ++ +G  +++ + ++ + VL  E V Y   A L   R PE  ++
Sbjct: 188 VVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAMLQLTRLPELTLS 247

Query: 275 G------TFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313
                    D  G+S Q+  L+ + A   H   ++ +YE+VH ++
Sbjct: 248 TLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVHASI 292

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 94.4 bits (233), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 105/208 (50%), Gaps = 6/208 (2%)

Query: 111 TTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKI-ATFGNKLDYLGIVVLIVTSMIS 169
           TTT TDY++ N + L  F   ++   +H  K+ SL+       K  YL  + L+++S I+
Sbjct: 96  TTTMTDYIVFNFYLLNVFVFCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQIT 155

Query: 170 ILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFG-LSAVLP 228
           IL+Y FYD   FF  F+LL    G A   V L DK  S + R  +   F++   +   LP
Sbjct: 156 ILYYLFYDYVFFFKIFTLLMTFIGLAAYFVILTDKLNSYK-RFNKTVFFISVSVVCCSLP 214

Query: 229 ILTGVMYY-GPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYV--NGTFDIWGHSHQ 285
           +LT ++ + G      RI+L  +  E V  +  + +Y  RFPE     N   + W HS  
Sbjct: 215 LLTAIITFDGLENLKDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEY 274

Query: 286 IFHLLVVVAAFCHLKALLGSYELVHMNL 313
            FHLL+   AF H   L+ SY L+H +L
Sbjct: 275 FFHLLISGTAFYHFFILIQSYILMHSSL 302

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 90.1 bits (222), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 105/208 (50%), Gaps = 6/208 (2%)

Query: 111 TTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKI-ATFGNKLDYLGIVVLIVTSMIS 169
           TTT TDY++ N + L  F   ++   +H  K+ SL+       K  YL  + L+++S I+
Sbjct: 96  TTTMTDYIVFNFYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQIT 155

Query: 170 ILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFG-LSAVLP 228
           IL+Y FYD   FF  F+LL    G       L DK  S + R  +   F++   +   LP
Sbjct: 156 ILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLNSSK-RFNKTVFFISVSVVCCSLP 214

Query: 229 ILTGVMYY-GPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYV--NGTFDIWGHSHQ 285
           +LT ++ + G      RI++K +  E V  +  + +Y  RFPE     N   + W HS  
Sbjct: 215 LLTAIITFDGLENLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSEY 274

Query: 286 IFHLLVVVAAFCHLKALLGSYELVHMNL 313
           +FHL++   AF H   L+ SY L+H +L
Sbjct: 275 LFHLVISGTAFYHFFILIQSYILMHSSL 302

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 89.7 bits (221), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 123/243 (50%), Gaps = 9/243 (3%)

Query: 79  HNETGNVYSHLVPGVVFFLTMLF--DKYAIVSFETTT-FTDYLIINLFFLGAFTCLILSS 135
            NE+     +L+  ++ F  ++F  D Y I  F TTT  TDY++ N + L  F   ++  
Sbjct: 61  RNESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHF 120

Query: 136 TFHCFKSHSLKI-ATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGS 194
            +H  K+ SL+       K  YL  + L+++S I+IL+Y FYD   FF  F+LL    G 
Sbjct: 121 IYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGL 180

Query: 195 ACAIVSLKDKFRSREWRPYRAGLFVAFG-LSAVLPILTGVMYY-GPHETWTRIQLKWVVL 252
                 L DK  S + R  +   F++   +   LP+LT ++ + G      RI++  +  
Sbjct: 181 VAYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFDGLENLKERIKVNAITW 239

Query: 253 EGVFYIFGAFLYGIRFPEKYVNGTF--DIWGHSHQIFHLLVVVAAFCHLKALLGSYELVH 310
           E V  +  + +Y  RFPE ++ G    + W HS  +FHL++  AAF H   L+ SY L+H
Sbjct: 240 ELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAAFYHFFILIQSYILMH 299

Query: 311 MNL 313
            +L
Sbjct: 300 SSL 302

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 87.0 bits (214), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 120/243 (49%), Gaps = 9/243 (3%)

Query: 79  HNETGNVYSHLVPGVVFFLTMLF--DKYAIVSFETTT-FTDYLIINLFFLGAFTCLILSS 135
            NE+     +L+  ++ F  ++F  D Y I  F TTT  TDY++ N + L  F   ++  
Sbjct: 61  RNESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHF 120

Query: 136 TFHCFKSHSLKI-ATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGS 194
            +H  K+ SL+       K  YL  + L+++S I+IL+Y FYD   FF  F+LL    G 
Sbjct: 121 IYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGL 180

Query: 195 ACAIVSLKDKFRSREWRPYRAGLFVAFG-LSAVLPILTGVMYY-GPHETWTRIQLKWVVL 252
                 L DK  S + R  +   F++   +   LP+LT ++ + G      RI++  +  
Sbjct: 181 VAYFFILTDKLISSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITW 239

Query: 253 EGVFYIFGAFLYGIRFPEKYV--NGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVH 310
           E V  +  + +Y  RFPE     N   + W HS  +FHLL+   AF H   L+ SY L+H
Sbjct: 240 ELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMH 299

Query: 311 MNL 313
            +L
Sbjct: 300 SSL 302

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 104/231 (45%), Gaps = 6/231 (2%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLFDKYA 105
           ++P   ++N +II  Y R  +S ++   S+F +HNE  N++SHL+ G ++FL +LF    
Sbjct: 197 QLPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLL-GAIYFLYVLFHDLP 254

Query: 106 ---IVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHS-LKIATFGNKLDYLGIVV 161
              IVS      T  L + LF   +  C++ S+ +H F   S LK+      +DY GI +
Sbjct: 255 NSIIVSSSMVPTTAKLFLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSGISI 314

Query: 162 LIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAF 221
           LI +S++SI F   YD       +   +   G     ++    F S E RP R   F+  
Sbjct: 315 LITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFILL 374

Query: 222 GLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKY 272
                  +L  V           + L       V+Y+ G   YG   PE++
Sbjct: 375 SSCGAFALLHLVFLEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPERF 425

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 113/242 (46%), Gaps = 26/242 (10%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFY---IHNETGNVYSHLVPGVVFFLTMLFD 102
           ++P   ++N +II GY R  +   +   S+F     HNET N++SHL+  + F   +LF+
Sbjct: 255 QLPFPWRENRYIINGY-RFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFE 313

Query: 103 --KYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFK-SHSLKIATFGNKLDYLGI 159
             K  IV       +   I+ LF L    C++ S  +H F  + S+K+      +DY GI
Sbjct: 314 FPKSFIVQSPEVPPSAKYIVYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSGI 373

Query: 160 VVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFV 219
            +LI  S+++  F   YD+      +  L+L FG     ++   KF S E RP R   F+
Sbjct: 374 TILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFFI 433

Query: 220 ---AFGLSAVLPI--LTGVMY----YGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPE 270
              A G  A   +  L G+ Y    Y P      +  K +    V+Y+ G F YG   PE
Sbjct: 434 LLAALGGLAFFHVAYLEGMAYAAWLYSP------VTSKSI----VWYLIGVFFYGSFIPE 483

Query: 271 KY 272
           ++
Sbjct: 484 RF 485

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 108/240 (45%), Gaps = 22/240 (9%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYI---HNETGNVYSHLVPGVVFFLTMLFD 102
           ++P   ++N +II  Y R  +S ++   S+F     HNE+ N+++HL+  +      ++D
Sbjct: 254 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNESSNIWTHLLGAIYLIYLSIYD 312

Query: 103 --KYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHS-LKIATFGNKLDYLGI 159
                I   E    T  LI+ LF   A  CL+ S  +H F   S LK+ +    +DY GI
Sbjct: 313 FPNSEIFQSEKVPTTAKLIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVDYSGI 372

Query: 160 VVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFV 219
            +LI  S+++  F   Y +      +  ++LS G     ++   KF   E RP R   F+
Sbjct: 373 TILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIKFFI 432

Query: 220 AFGLSAVLPI-----LTGVMYYGPHETW--TRIQLKWVVLEGVFYIFGAFLYGIRFPEKY 272
                 VL       LT + Y     TW  T +  K +    V+Y+ G   YG   PE++
Sbjct: 433 LLASMGVLSFLHLTYLTNLQY----ATWLLTPVTNKSI----VWYLVGVVFYGSFIPERF 484

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 111/237 (46%), Gaps = 15/237 (6%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFY---IHNETGNVYSHLVPG--VVFFLTML 100
           E+P   ++N++II GY R  + F +   S+F    +HNET N+++H++    +++ LT+ 
Sbjct: 248 ELPFPWRENKYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVD 306

Query: 101 FDK-YAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFK-SHSLKIATFGNKLDYLG 158
           F K + ++  E    T   II +F      C+  S  +H F  + S+++      +DY G
Sbjct: 307 FQKTFIVLDTEHVPATTKYIIYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCVDYTG 366

Query: 159 IVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
           I +LI  S++S  +   YD       + +L+  F      ++   KF S E RP R   F
Sbjct: 367 ITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLYLNWSPKFDSPEARPLRIKFF 426

Query: 219 VAFGLSAVLPILTGVMYYG-PHETW--TRIQLKWVVLEGVFYIFGAFLYGIRFPEKY 272
           V       L  +  V   G     W  + +  K V    ++YI G F YG   PE++
Sbjct: 427 VLLAAVGGLSFVNLVCLEGLSRAIWLFSPVTNKSV----IYYIIGVFFYGSFIPERF 479

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 106/234 (45%), Gaps = 10/234 (4%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYI---HNETGNVYSHLVPGVVFFLTMLFD 102
           ++P   ++N +II  Y R  +S ++   S+F     HNET N+++HL+ G+      ++D
Sbjct: 220 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMAVYD 278

Query: 103 --KYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFK-SHSLKIATFGNKLDYLGI 159
             +  I   +    T  LI+ LF   A  CL  S  +H F  + +LK+ +    +DY GI
Sbjct: 279 FPRSEIFLSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDYSGI 338

Query: 160 VVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFV 219
            +LI  S+++  F   Y +      +  ++LS G     ++   KF   E RP R   FV
Sbjct: 339 SILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKFFV 398

Query: 220 AFGLSAVLPIL-TGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKY 272
                 VL  L    +    + TW    +    +  V+Y  G   YG   PE++
Sbjct: 399 LLASMGVLSFLHLTFLTDWKYATWLLAPVTNKSI--VWYCIGVVFYGSFIPERF 450

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 102/237 (43%), Gaps = 16/237 (6%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYI---HNETGNVYSHLVPGVV--FFLTML 100
           E+P   ++N +II G+ R  +S R+   S+      HNET N++SHLV   V  + L   
Sbjct: 109 ELPYAWRENRYIIYGH-RFYHSHRKSLLSVLNAYGWHNETINIWSHLVGAAVLAYLLCWG 167

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHS-LKIATFGNKLDYLGI 159
           + +  +             I  F      C+  S  +H F     LK+ +    +DY GI
Sbjct: 168 WPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCHLKLRSRFVCVDYTGI 227

Query: 160 VVLIVTSMISILFYGFYD-NGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
            +L+  S+++ +    Y  + P  Y + + ++  G+A  +++    F   E RP R  ++
Sbjct: 228 TLLVTASVVTTVAVTLYGLSRPLMYAYMVASIGLGTAAGVMNWSPHFDRPEARPLRIAVY 287

Query: 219 V---AFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKY 272
           V   A GL + + +   V +   H     +    V    V+Y  G   Y    PE++
Sbjct: 288 VGLAALGLVSFVHVWMQVRWASAH-----LMAPLVYKSLVWYGIGVVFYATLVPERW 339

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 104/235 (44%), Gaps = 12/235 (5%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYI--HNETGNVYSHLVP--GVVFFLTMLF 101
           E+P   ++N +II  Y    ++ +    ++ +   HNET N++SH +    VV+     F
Sbjct: 221 ELPFPWRENRYIIHNYRFYDSNVKSLLSAINWYGWHNETSNIWSHFLGFFYVVYLAVYEF 280

Query: 102 DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHS-LKIATFGNKLDYLGIV 160
            +  +   +    +   ++ +F   A  CLI S+ +H F   + LK+      +DY GI 
Sbjct: 281 PQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMRRRFACVDYSGIS 340

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
           +LI  S+++  F    D+ P    +  ++L+ G     ++   +F + E RP R   F+ 
Sbjct: 341 ILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDTPEARPLRIRFFML 400

Query: 221 FGLSAVLPILTGVMYYGPHETWT-RIQLKWVVLEG--VFYIFGAFLYGIRFPEKY 272
                VL  +         E+W   + L   +     V+Y+ G   YG   PE++
Sbjct: 401 LAAMGVLSFINASYL----ESWAYAVDLLSPITNKSIVWYLVGVVFYGSFIPERF 451

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 63.9 bits (154), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 109/239 (45%), Gaps = 20/239 (8%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSL---FYIHNETGNVYSHL--VPGVVFFLTML 100
           ++P   ++N +II GY R  +S  +C  S+   +  HNET N++SHL     +++    +
Sbjct: 118 QLPFPWRENRYIIKGY-RFYDSNVKCLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFV 176

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFK---SHSLKIATFGNKLDYL 157
           +    +   E    T  +++ +F +    C++ S  +H F    S++L+       +DY 
Sbjct: 177 YPNTEVYQSELIPTTAKMLLFVFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCC--VDYT 234

Query: 158 GIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGL 217
           GI +LI  S+++  +        + + +  L+L+ G+    ++   KF   E RP R   
Sbjct: 235 GITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLRIKF 294

Query: 218 FVAFG----LSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKY 272
           FV       LS V  I T  +    H  W    +  +    ++Y+ G F YG   PEKY
Sbjct: 295 FVTLSAMGCLSFVHLIFTTSLR---HACWLLAPI--ISKSTIWYVIGVFFYGSFIPEKY 348

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 103/236 (43%), Gaps = 14/236 (5%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYI---HNETGNVYSHLVPGVVFFLTMLFD 102
           ++P   ++N +II GY R  N+  +   S+F     HNET N++SHL+  +      ++D
Sbjct: 220 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYD 278

Query: 103 --KYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHS-LKIATFGNKLDYLGI 159
             +  +            I+ +F   A  C++ S  +H F   S LK+ +    +DY GI
Sbjct: 279 FPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 338

Query: 160 VVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFV 219
            +LI  S+++  F   Y      Y +  ++L+ G     ++   +F   E RP R   F+
Sbjct: 339 TILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 398

Query: 220 AFGLSAVLPILTGVMYYGPHETWT---RIQLKWVVLEGVFYIFGAFLYGIRFPEKY 272
                 VL  L  +     H   T    +  K V    V+Y+ G   YG   PE++
Sbjct: 399 LLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSV----VWYLVGVVFYGSFIPERF 450

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 101/236 (42%), Gaps = 14/236 (5%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSL---FYIHNETGNVYSHLVPGVVFFLTML-- 100
           E+P   ++N  II GY R  NS ++   S+   +  HNET N+++HL+ G+     M   
Sbjct: 218 ELPFPWRENRCIINGY-RFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMFYQ 276

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSL-KIATFGNKLDYLGI 159
           F    +   E       LI  +F + A  CL  S  +H F   SL ++      +DY GI
Sbjct: 277 FPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYSGI 336

Query: 160 VVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFV 219
            +LI  S+++  F   Y        +  L+ + G     ++   KF   E RP R   F+
Sbjct: 337 SILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRIKFFI 396

Query: 220 AFGLSAVLPILTGVMYYG-PHETW--TRIQLKWVVLEGVFYIFGAFLYGIRFPEKY 272
                 +L  L         H TW  + I  K V    V+Y+ G   YG   PE++
Sbjct: 397 LLASMGILSFLHLTFITSLSHSTWLLSPITKKSV----VWYLVGVVFYGSFIPERW 448

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 117/285 (41%), Gaps = 39/285 (13%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYI--HNETGNVYSHLVPGVVFFLTMLFDK 103
           E+P   ++N +II GY    +  +     + +   HNET N++SHL  G V+   +LF +
Sbjct: 303 ELPFPWRENRYIIHGYRFYDSHVKSVLSVVNWYGWHNETLNIWSHLF-GAVYLAYLLFIQ 361

Query: 104 YAIVSF---ETTTFTDYLIINLFFLGAFTCLILSSTFHCFK-SHSLKIATFGNKLDYLGI 159
                    +       LII +F +    CL+ SS +H    +  L +      +DY GI
Sbjct: 362 LPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSVWHTLNGTCCLPLRCKFACIDYTGI 421

Query: 160 VVLIVTSMISILFYGFYDNGPFFYGFSL-----LTLSFGSACAIVSLKDKFRSREWRPYR 214
            VLI  S++S  F   Y+        S+     L+L  G   + ++   +F   E RP+R
Sbjct: 422 TVLITASILSTEFVSVYNLATQSLSTSMTVYMSLSLCLGIFGSFMNWSPRFDRPESRPFR 481

Query: 215 AGLFVAF-GLSAV----LPILTGV----MYYGPHETWTRIQLKWVVLEGVFYIFGAFLYG 265
              +V   GL  +    L I  G+     ++ P   W R          ++Y+ G   YG
Sbjct: 482 IAFYVLLAGLGMISFLHLTISRGIDHSSQFFKP--VWNR--------SLIWYLIGVVFYG 531

Query: 266 IRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVH 310
              PE+        W    ++ + +   A  C    +L  ++ VH
Sbjct: 532 SFIPER--------WRTDVELDYTIPTDAELCSNLDILTKHKHVH 568

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 109/236 (46%), Gaps = 14/236 (5%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSL---FYIHNETGNVYSHLVPGVVFFLTML-- 100
           ++P   ++N++II GY R   S ++ F S+   +  HNET N+++HL+ G+         
Sbjct: 209 QLPFPYRENKYIIHGY-RFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYH 267

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFK-SHSLKIATFGNKLDYLGI 159
           F    I   +        I+ +F   A  C+  S  +H F  +H L++ +    +DY GI
Sbjct: 268 FPHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTGI 327

Query: 160 VVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFV 219
            +LI  S++++ F   YD       + + +L+ G     ++   KF   E RP R   F+
Sbjct: 328 TILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFFI 387

Query: 220 ---AFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKY 272
                G S+ + ++    +    +  T +  K V    V+Y+ G F YG   PE++
Sbjct: 388 LLATVGCSSFIRLVFLTNWRYAADLLTPLTNKSV----VWYLIGVFFYGSFIPERF 439

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 104/238 (43%), Gaps = 18/238 (7%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYI---HNETGNVYSHLVPGVVFFLTMLFD 102
           ++P   ++N +II GY R  N+  +   S+F     HNET N++SHL+  +      ++D
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYD 277

Query: 103 --KYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHS-LKIATFGNKLDYLGI 159
             +  +            I+ +F   A  C++ S  +H F   S LK+ +    +DY GI
Sbjct: 278 FPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 337

Query: 160 VVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFV 219
            +LI  S+++  F   Y        +  ++L+ G     ++   +F   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 220 AFGLSAVLP-----ILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKY 272
                 VL       LT + Y      ++ +  K V    V+Y+ G   YG   PE++
Sbjct: 398 LLATMGVLSFLHLIFLTDLRYAA--RLFSPVTYKSV----VWYLVGVAFYGSFIPERF 449

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 108/244 (44%), Gaps = 25/244 (10%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYI---HNETGNVYSHLVPGVVFFLTMLFD 102
           E+P   ++N  II GY R  NS+ +   S+F     HNET N+++HL  G ++F  ++F 
Sbjct: 219 ELPFPWRENRFIIHGY-RFYNSYSKSLLSIFNWYGWHNETVNIWTHLC-GALYFAFLIFK 276

Query: 103 KYAIVSFETTTFTDYLIIN-------LFFLGAFTCLILSSTFHCFKS-HSLKIATFGNKL 154
            ++    +TT +   L+         +F      C + S  +H F     LK  +    +
Sbjct: 277 GFS----QTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSNCACV 332

Query: 155 DYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLL-----TLSFGSACAIVSLKDKFRSRE 209
           DY GI VL+  S+++  F     +    + +SLL     + + G+    ++   KF   E
Sbjct: 333 DYTGITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPE 392

Query: 210 WRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGV-FYIFGAFLYGIRF 268
            RP R   ++          L   ++    ++   I  K V ++ + +YI G   YG   
Sbjct: 393 SRPLRIAFYLLLASFGFFSYLHSRLFNTAVDSSDLI--KPVFMKSLAWYIIGVVFYGTFI 450

Query: 269 PEKY 272
           PE++
Sbjct: 451 PERW 454

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 115/251 (45%), Gaps = 36/251 (14%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSL---FYIHNETGNVYSHLVPGVVFFLTMLFD 102
           E+P   ++N  II GY R  +S  +   S+   +  HNET N+++HL  G ++   + F 
Sbjct: 236 ELPFPWRENRFIIHGY-RFYHSHTKSLLSILNWYGWHNETTNIWTHLF-GSLYIAYLAFY 293

Query: 103 KYA----IVSFETTTFTDYLIINLFFLGA-FTCLILSSTFHCFK-SHSLKIATFGNKLDY 156
           ++      +S +   F  Y++    FLGA F CL+ S T+H F  +  L + +    +DY
Sbjct: 294 EFPQSSVYLSGDVPQFAKYMV--YLFLGAGFKCLVSSVTWHTFNGTCKLHLRSKFACMDY 351

Query: 157 LGIVVLIVTSMISILFYGFYDNGP-----------FFYGFSLLTLSFGSACAIVSLKDKF 205
            GI VLI  S+++  F   Y NG            F+   S +   FG     ++   +F
Sbjct: 352 TGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFG---VFMNWSPRF 408

Query: 206 RSREWRPYRAG---LFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGV-FYIFGA 261
              E RP R     L    G  A L  LT +  +  H +W    ++ V+ + V +Y+ G 
Sbjct: 409 DRPESRPLRIAFYLLLAGMGFLAFLH-LTLITNFA-HSSWL---IRPVLDKSVCWYLIGV 463

Query: 262 FLYGIRFPEKY 272
             YG   PE++
Sbjct: 464 IFYGSFIPERW 474

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 105/242 (43%), Gaps = 26/242 (10%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSL---FYIHNETGNVYSHLVPG--VVFFLTML 100
           ++P   ++N +II GY R  N+  +   S+   +  HNET N++SHL+    +++     
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYD 277

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHS-LKIATFGNKLDYLGI 159
           F +  +            I+ +F   A  C++ S  +H F   S L++ +    +DY GI
Sbjct: 278 FPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGI 337

Query: 160 VVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFV 219
            +LI  S+++  F   Y        +  ++L+ G     ++   +F   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 220 AFGLSAVLP-----ILTGVMY----YGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPE 270
                 VL       LT + Y    +GP      +  K V    V+Y+ G   YG   PE
Sbjct: 398 LLATMGVLSFLHLIFLTDIYYASRLFGP------VTYKSV----VWYLVGVVFYGSFIPE 447

Query: 271 KY 272
           ++
Sbjct: 448 RF 449

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 104/238 (43%), Gaps = 17/238 (7%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYI---HNETGNVYSHLVPGVVFFLTML-- 100
           E+P+  ++N +II G+ R  +S ++   S+  +   HNET N++SH+   ++    ML  
Sbjct: 244 ELPQPWRENPYIIYGH-RFYHSHKKSLLSILNVYGWHNETINIWSHIAGAIILLYIMLRG 302

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHS-LKIATFGNKLDYLGI 159
           F    + +           I +F L    C++ S  +H F     L + +  + +DY GI
Sbjct: 303 FPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCHLPLRSRFSCVDYTGI 362

Query: 160 VVLIVTSMISILFYGFYDNGP-FFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
            +LI  S+++   +  Y   P   Y +  ++L  G   A  +   +F   + R +R   +
Sbjct: 363 TILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRIFRVAFY 422

Query: 219 VAF-GLSAVLPILTGVMYYGPHETWTRIQLKWVVLEG---VFYIFGAFLYGIRFPEKY 272
           V   GL      L   ++   H  W+  +L    L     V+Y+ G   Y    PE++
Sbjct: 423 VILAGLG-----LISFVHLTVHSDWSSSRLMITPLINKSIVWYLIGVVFYATLVPERW 475

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 104/235 (44%), Gaps = 12/235 (5%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFD--SLFYIHNETGNVYSHLVPGVVFFLTML--- 100
           ++P   ++N  II GY    + ++      + +  HNET N+++HL  G ++ L +    
Sbjct: 136 QLPFPWRENRFIIHGYRFYDSHYKSLLSIVNWYGWHNETANIWTHL-GGALYVLWLAVYD 194

Query: 101 FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFK-SHSLKIATFGNKLDYLGI 159
           F + ++   E        I+ +F   A  C++ S   H F  +  L + +    +DY GI
Sbjct: 195 FPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFACVDYSGI 254

Query: 160 VVLIVTSMISILFYGFYDNGPFFYGFSL-LTLSFGSACAIVSLKDKFRSREWRPYRAGLF 218
            +LI  S+++  F   Y N P+   F L ++   G    I++   KF   E RP R   F
Sbjct: 255 TMLITASILTTEFVTMY-NYPWSLRFYLAVSTVLGIFGVIMNWSPKFDRPEARPLRIKFF 313

Query: 219 VAFGLSAVLPILT-GVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKY 272
           +       L  +  G++    + +W    +    L  V+Y+ G   YG   PE++
Sbjct: 314 ILLAAMGGLSFMQLGLLGGWKYASWLMAPVTHKSL--VWYLLGVAFYGSFVPERF 366

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 102/242 (42%), Gaps = 21/242 (8%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYI---HNETGNVYSHLVPGVVFFLTML-- 100
           E+P   ++N  II GY R  NS+++   S+F     HNET N+++HL  G   +L  L  
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHL--GGALYLAYLLF 295

Query: 101 --FDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKS-HSLKIATFGNKLDYL 157
             F + A+   E        +  +F L    C + S  +H F     L+  +    +DY 
Sbjct: 296 RGFSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNGICHLQQRSNCACVDYT 355

Query: 158 GIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIV-----SLKDKFRSREWRP 212
           GI +L+  S+++  F          + +SLL  +  S+   V     +   KF   E RP
Sbjct: 356 GITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPESRP 415

Query: 213 YRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEG--VFYIFGAFLYGIRFPE 270
            R   ++          L   ++   H + +  +L   VL     +Y+ G   YG   PE
Sbjct: 416 LRIAFYLLLASFGFFSYLHSRIF---HTSISSSELIKPVLSKSLAWYLIGVVFYGTFIPE 472

Query: 271 KY 272
           ++
Sbjct: 473 RW 474

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 97/235 (41%), Gaps = 12/235 (5%)

Query: 46  EIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYI--HNETGNVYSHLVPG--VVFFLTMLF 101
           ++P   ++N +II GY      ++     + +   HNET N+++HL+    +V+     F
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYDF 278

Query: 102 DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHS-LKIATFGNKLDYLGIV 160
               +            I+  F   A  C++ S  +H F   S L + +    +DY GI 
Sbjct: 279 PHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVDYSGIT 338

Query: 161 VLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVA 220
           +LI  S+++  F   Y        +  ++L+ G     ++   +F   E RP R   F+ 
Sbjct: 339 ILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRIRFFIL 398

Query: 221 FGLSAVLPILTGVMYYGPH-ETW--TRIQLKWVVLEGVFYIFGAFLYGIRFPEKY 272
                VL  L  +     H   W  + +  K V    V+Y+ G   YG   PE++
Sbjct: 399 LATMGVLSFLHLIFLTDLHYAIWLFSPVTNKSV----VWYLVGVVFYGSFIPERF 449

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 102/222 (45%), Gaps = 12/222 (5%)

Query: 93  VVFFLTMLF--DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATF 150
            V+F+ ++F  D Y +    +TT TDY+++N+F   AF C        CF +      T 
Sbjct: 104 AVYFVLLVFFTDVYLVPRHVSTTMTDYVLLNVFLATAFQCAAC-HMVQCFTT------TA 156

Query: 151 GNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFG---SACAIVSLKDKFRS 207
           G+ L  + ++     S +++L+Y +YDN  +F   +L T ++    +A  + S       
Sbjct: 157 GSVLSTITMLNHWACSAVTLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNSPK 216

Query: 208 REWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIR 267
           R+W   R  L V   +   +P++ G++ +G  +   R+  + ++ E   Y+     YG  
Sbjct: 217 RQWWSRRTLLLVYVVVLVSVPLVVGLLRFGTAKVLRRLDWRLLLAELAVYLISGVFYGGT 276

Query: 268 FPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELV 309
             +      F +  H+  + HL +++ AF  ++A      LV
Sbjct: 277 EKDTLPKLPFYVAFHTASLIHLQLLLNAFHLMRAGTNKPTLV 318

>KAFR0C01460 Chr3 (300109..300768) [660 bp, 219 aa] {ON} Anc_3.90
           YOL101C
          Length = 219

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 81/208 (38%), Gaps = 41/208 (19%)

Query: 94  VFFLTMLFDKYAIVSFETT-TFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGN 152
           +F L    D Y I  +++  T TDY+IIN++      CL  S   +  K    KI    N
Sbjct: 49  LFLLVFFTDVYLISRYKSVMTMTDYIIINVYIA---ICLKFS-ILNLLKKEK-KIMKNLN 103

Query: 153 KLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRP 212
            L  + IV        S+L+Y +YDN  +F   SLL          +S+           
Sbjct: 104 NLQIISIV--------SLLYYIYYDNIFYFKVLSLLIFCINLLIQSISIDQ--------- 146

Query: 213 YRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPE-K 271
                     LS  + I+    Y+ P  +  R+    + LE    +       + F   K
Sbjct: 147 --------VNLSTSITII----YFLPLVSNNRVDSNLLTLE---ILLNCVTLSLNFSNSK 191

Query: 272 YVNGTFDIWGHSHQIFHLLVVVAAFCHL 299
            V   F I  +S  + HLLV++ +F  +
Sbjct: 192 LVVKNFVI--NSTNLLHLLVIIRSFTKI 217

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.331    0.145    0.466 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,017,916
Number of extensions: 1364874
Number of successful extensions: 3481
Number of sequences better than 10.0: 79
Number of HSP's gapped: 3472
Number of HSP's successfully gapped: 80
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 65 (29.6 bits)