Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H008706.17ON61261226430.0
ZYRO0C07876g6.17ON68166913471e-178
KAFR0L003806.17ON54060913241e-177
TDEL0G045206.17ON67968713371e-177
Skud_5.276.17ON61562913211e-175
Suva_5.56.17ON61963613211e-175
KNAG0M011406.17ON59462113181e-175
Smik_5.256.17ON61563413001e-172
YEL062W (NPR2)6.17ON61563112951e-171
Kpol_1045.726.17ON69569812701e-167
CAGL0L13288g6.17ON64666112051e-157
Ecym_30216.17ON67467712041e-157
KLLA0D01067g6.17ON66065811831e-154
TBLA0G010106.17ON71046811661e-151
Kwal_56.224116.17ON68969111611e-150
KLTH0C11308g6.17ON69068611281e-145
ACR009W6.17ON68067010941e-140
TPHA0J003106.17ON67568610811e-138
NDAI0D008606.17ON66645110621e-136
SAKL0E01100g6.17ON7105117949e-96
CAGL0D03168g5.206ON2082135781.0
TBLA0C036305.206ON2387135771.3
Suva_12.765.206ON202490761.8
Skud_10.2185.206ON202590761.8
YJL005W (CYR1)5.206ON202690761.8
ZYRO0B10362g5.206ON215790752.3
TPHA0D040303.443ON256256752.3
Kpol_1004.325.541ON98858742.8
TDEL0E042305.206ON189090733.9
CAGL0G02805g2.265ON29248714.6
Ecym_53642.199ON120482725.0
TDEL0E013304.238ON165765716.7
Kpol_534.515.206ON196358716.8
Smik_10.2745.206ON203390716.8
NDAI0E004008.821ON1881134708.9
NCAS0A097801.222ON36875699.0
TPHA0E010607.366ON44543699.6
KAFR0L016207.372ON49377699.8
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NCAS0H00870
         (1839 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...  1022   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   523   e-178
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   514   e-177
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   519   e-177
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   513   e-175
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    513   e-175
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   512   e-175
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   505   e-172
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   503   e-171
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   493   e-167
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   468   e-157
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   468   e-157
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   460   e-154
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   453   e-151
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   451   e-150
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   439   e-145
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   426   e-140
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   421   e-138
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   413   e-136
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   310   9e-96
CAGL0D03168g Chr4 complement(324192..330440) [6249 bp, 2082 aa] ...    35   1.0  
TBLA0C03630 Chr3 (860550..867713) [7164 bp, 2387 aa] {ON} Anc_5....    34   1.3  
Suva_12.76 Chr12 (107539..113613) [6075 bp, 2024 aa] {ON} YJL005...    34   1.8  
Skud_10.218 Chr10 (392657..398734) [6078 bp, 2025 aa] {ON} YJL00...    34   1.8  
YJL005W Chr10 (425157..431237) [6081 bp, 2026 aa] {ON}  CYR1Aden...    34   1.8  
ZYRO0B10362g Chr2 complement(812053..818526) [6474 bp, 2157 aa] ...    33   2.3  
TPHA0D04030 Chr4 (850344..858032) [7689 bp, 2562 aa] {ON} Anc_3....    33   2.3  
Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {O...    33   2.8  
TDEL0E04230 Chr5 complement(789369..795041) [5673 bp, 1890 aa] {...    33   3.9  
CAGL0G02805g Chr7 (258452..259330) [879 bp, 292 aa] {ON} highly ...    32   4.6  
Ecym_5364 Chr5 (738965..742579) [3615 bp, 1204 aa] {ON} similar ...    32   5.0  
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....    32   6.7  
Kpol_534.51 s534 (129416..135307) [5892 bp, 1963 aa] {ON} (12941...    32   6.8  
Smik_10.274 Chr10 (422245..428346) [6102 bp, 2033 aa] {ON} YJL00...    32   6.8  
NDAI0E00400 Chr5 complement(65678..71323) [5646 bp, 1881 aa] {ON...    32   8.9  
NCAS0A09780 Chr1 (1954548..1955654) [1107 bp, 368 aa] {ON} Anc_1...    31   9.0  
TPHA0E01060 Chr5 (218359..219696) [1338 bp, 445 aa] {ON}               31   9.6  
KAFR0L01620 Chr12 complement(293645..295126) [1482 bp, 493 aa] {...    31   9.8  

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
            YEL062W
          Length = 612

 Score = 1022 bits (2643), Expect = 0.0
 Identities = 518/612 (84%), Positives = 518/612 (84%)
 Frame = +1

Query: 1    MQNSNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPK 180
            MQNSNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPK
Sbjct: 1    MQNSNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPK 60

Query: 181  NQLCNRLLTFKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGK 360
            NQLCNRLLTFKYENYRIVSYPITINAPYYAR           PYECETSPYEPSIARLGK
Sbjct: 61   NQLCNRLLTFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGK 120

Query: 361  MFKILEEQSQILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRX 540
            MFKILEEQSQILSKAENDPIYFKSDYV              S              GSR 
Sbjct: 121  MFKILEEQSQILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRF 180

Query: 541  XXXXXXXXXXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI 720
                       VTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI
Sbjct: 181  ETDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI 240

Query: 721  SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY 900
            SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY
Sbjct: 241  SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY 300

Query: 901  YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQP 1080
            YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQP
Sbjct: 301  YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQP 360

Query: 1081 STPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACL 1260
            STPK                     YMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACL
Sbjct: 361  STPKHSRTTSLSSSMSGSVNSHEHSYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACL 420

Query: 1261 FDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEG 1440
            FDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEG
Sbjct: 421  FDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEG 480

Query: 1441 IQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINVDGADELLKNVYKKLERH 1620
            IQRIERLNDIDAHRLQIR                      INVDGADELLKNVYKKLERH
Sbjct: 481  IQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKNVYKKLERH 540

Query: 1621 SKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERW 1800
            SKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERW
Sbjct: 541  SKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERW 600

Query: 1801 LDELGNYKIITC 1836
            LDELGNYKIITC
Sbjct: 601  LDELGNYKIITC 612

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar to
            uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
            Regulator of nitrogen permeases transcription is induced
            in response to proline and urea contains two PEST
            sequences
          Length = 681

 Score =  523 bits (1347), Expect = e-178
 Identities = 299/669 (44%), Positives = 381/669 (56%), Gaps = 68/669 (10%)
 Frame = +1

Query: 28   NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 207
            + FEGF+PIHT+FY++FHPT+GT+V YE+PP NL   +INFD IKNYIIPK QLC++LLT
Sbjct: 17   DQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKLLT 76

Query: 208  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 387
             KY+ YRIV YP+T+N+PYYAR           PY+CETS YEP+IARLGKMF++LEEQ+
Sbjct: 77   LKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEEQN 136

Query: 388  QILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXXX 567
            QILSKAENDPIYF                   S               +           
Sbjct: 137  QILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNEIMKDLESEK- 195

Query: 568  XXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSL 747
               + FSVQDL+MRI+QDLNNYSECLIPID+GN ++IK+FPL K PPN  IS+EDVP+S 
Sbjct: 196  ---SDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPL-KTPPNSCISIEDVPIST 251

Query: 748  INLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 927
            +NL  +IDVNWDPTML IVPYI+G+N ISKIAKL+ +D  LV+EC+KHLVYYNCVI+ DI
Sbjct: 252  VNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILADI 311

Query: 928  FQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE----------NNGNKQ 1077
            FQFSN+YAPTSLI  FLTD  +A++CQ++V L   S LS +PFE          +    Q
Sbjct: 312  FQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDDMDQSKNQ 371

Query: 1078 PSTPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKAC 1257
             S  +                              +  S SST+ N  H    HLPTKAC
Sbjct: 372  ESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFNQRSQSSFSSTNTNVTHDLARHLPTKAC 431

Query: 1258 LFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPS-- 1431
            LFDLYR+LS GVT+R WY  N   I +N++DVR+FI FG+I+GLIYRC S+P+ ++ S  
Sbjct: 432  LFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPVMKKMSIF 491

Query: 1432 --NEGIQRIERLNDIDAH---RLQIRXXXXXXXXXXXXXXXXXXXXXXINVDGADELLKN 1596
                 +     LN +      +  +                        +VD ADE+L+N
Sbjct: 492  DLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEGSKMHQNFSVDIADEVLRN 551

Query: 1597 VYKKL----------------------------------------ERHSKVSFMDKEKNE 1656
            VYKKL                                        ER SKV+F D  K++
Sbjct: 552  VYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKPERVSKVAF-DMNKDD 610

Query: 1657 SM-----------KTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERWL 1803
             +           K  E  +       ++ +LL+SI + + LDKICVKL K R +VE  L
Sbjct: 611  PVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEELL 670

Query: 1804 DELGNYKII 1830
             ELG+YKII
Sbjct: 671  HELGDYKII 679

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
            Anc_6.17 YEL062W
          Length = 540

 Score =  514 bits (1324), Expect = e-177
 Identities = 276/609 (45%), Positives = 376/609 (61%), Gaps = 10/609 (1%)
 Frame = +1

Query: 34   FEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTFK 213
            FEGF PIHTIF+SIFHPTEG+KVCY+FPP+NL  ++INFD+IKN++IPK QLC+RLLT +
Sbjct: 5    FEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRLLTLE 64

Query: 214  YENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQSQI 393
            Y+NYR+VSYP+ +++  YAR            Y+C+T PYEP+I RLGKMFK LEEQSQI
Sbjct: 65   YKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEEQSQI 124

Query: 394  LSKAENDPIYFKS----DYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXX 561
            LSK++    +FK     D+V                                        
Sbjct: 125  LSKSQRTSAFFKDGEDVDFVD--------------------------------------- 145

Query: 562  XXXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPM 741
                 TKFS+QDL+MR+YQDLNNYSECLIPID+GN+INIK+FP+LKPP +  IS+EDVP+
Sbjct: 146  -----TKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPL 200

Query: 742  SLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIIT 921
            S++NL+ ++D+NWDPTML+I+P+I+GVN I+ I+ L+ +DP LVIECIKHL+YYNCVIIT
Sbjct: 201  SIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIIT 260

Query: 922  DIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPF----ENNGNKQPSTP 1089
            DIFQFSN+YAP+SLI +FL D  +A  CQ+YVVLP GSK++ LP     ++  N    T 
Sbjct: 261  DIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSDMTQ 320

Query: 1090 KXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTD--PNNPHFELAHLPTKACLF 1263
            K                       +T    +++ +LSS++   +NP  +   LP+K  LF
Sbjct: 321  KALSSSRSSFSSYFSHKSAYARVSETAHHHQSTSTLSSSEGQQDNPR-QGQVLPSKCTLF 379

Query: 1264 DLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEGI 1443
            DLYRSL+YG T+ +WY+ N + I EN++DVRKFIKFG+I  +IYR H YPI +  + +  
Sbjct: 380  DLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIMEHKTFKSP 439

Query: 1444 QRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINVDGADELLKNVYKKLERHS 1623
               +R ND                               I  D  D +L ++Y KL   S
Sbjct: 440  LLSDRQND-----------------------KIVLSTSDIKFDVGDRILNSIYNKL---S 473

Query: 1624 KVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERWL 1803
            KV+F   +K ES    + G    + + E+++L  ++E  E+ D+IC KLGKS+ +VE  +
Sbjct: 474  KVTFDRDKKLES----KIGNSRNLGESEKNILFNALERHESFDRICSKLGKSKNEVESII 529

Query: 1804 DELGNYKII 1830
             E+G Y  I
Sbjct: 530  SEIGEYMTI 538

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
            YEL062W
          Length = 679

 Score =  519 bits (1337), Expect = e-177
 Identities = 300/687 (43%), Positives = 391/687 (56%), Gaps = 86/687 (12%)
 Frame = +1

Query: 28   NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 207
            + FEGF+PIHTIFY++FHPTEGTKV YEFPP NL + +INFD IKNYIIPK QLC++LLT
Sbjct: 3    DQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKLLT 62

Query: 208  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 387
             KY+NYRI SYP+T+N+P YAR           PY+C+TSPYEP+IARLGKMFK+LEEQ+
Sbjct: 63   LKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEEQN 122

Query: 388  QILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXXX 567
             ILSKAE DPI++    V                              S           
Sbjct: 123  LILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAY----ASEKYHKIMTDIE 178

Query: 568  XXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSL 747
               + FS++DL++R+YQDLNNYSECLIPID+GN ++IK+FP++ PP N  IS+EDVP+S 
Sbjct: 179  SADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPP-NSNISIEDVPVST 237

Query: 748  INLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 927
            +NLN VIDVNWDPTML IVPYING+N ISKIAKL+ +DP LVIECIKHL+YYNCV++ DI
Sbjct: 238  VNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADI 297

Query: 928  FQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE---------------- 1059
            FQFSN+YAPTS + +FLTD  ++T+CQ+YVV    S L  LPF+                
Sbjct: 298  FQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDHELAD 357

Query: 1060 ------NNGNKQPSTPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNP 1221
                   +G++  S                        Y  T + S++S S ++T+P+N 
Sbjct: 358  SHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYR-TGKHSQSSFSSNNTNPSN- 415

Query: 1222 HFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRC 1401
                 +LPTK+CLFDLYRSLS G +LR WY  +   I  N +DVR+FI FG+I GLIYRC
Sbjct: 416  -MLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRC 474

Query: 1402 HSYPIPQRPSNEGIQRIERLNDIDAHRLQIR---------XXXXXXXXXXXXXXXXXXXX 1554
            +SYPI +      + +     DI  H ++                               
Sbjct: 475  YSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYERQRNKHH 534

Query: 1555 XXINVDGADELLKNVYKKL----------------------------------------- 1611
              +N+D ADE+L+NVYKKL                                         
Sbjct: 535  KALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQN 594

Query: 1612 -ERHSKVSFMDKEK------------NESMKTDEKGRPSTMTKEERS-VLLKSIESLENL 1749
             +R SKVSF DK++            N+ +K DE+ +   + + ER  +LL+S+E+ ++L
Sbjct: 595  SDRPSKVSF-DKQQEIGHISKGMSSSNDKVKMDEEAK---LERRERDLILLESVEAADSL 650

Query: 1750 DKICVKLGKSRQQVERWLDELGNYKII 1830
            D ICVKL  SR  VE  +  LG YKII
Sbjct: 651  DTICVKLEMSRYDVEALIQNLGEYKII 677

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  513 bits (1321), Expect = e-175
 Identities = 284/629 (45%), Positives = 378/629 (60%), Gaps = 28/629 (4%)
 Frame = +1

Query: 28   NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 207
            ++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL N  INF+TIKNYIIPK  LC++L+T
Sbjct: 3    SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKLIT 62

Query: 208  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 387
            FKY  YRIV YP+TIN+P YAR           PY+CETSPYEP+I RLGKMFK+LEEQ+
Sbjct: 63   FKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQN 122

Query: 388  QILSKAENDPIYF-----KSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXX 552
            Q+LSK+E D ++F     ++  +              S                R     
Sbjct: 123  QLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSRYN 182

Query: 553  XXXXXXXV--TKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISL 726
                   +  + FS+QDL+MRI+QDLNNYSECLIPID+GN ++IK+FPLL+PP    +SL
Sbjct: 183  DLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTT-CVSL 241

Query: 727  EDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYN 906
            EDVP+S +NL  +IDVNWDPTM++IVPYI+G+N I+KI+KL+++DP LVIECI+HL+YY 
Sbjct: 242  EDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYYK 301

Query: 907  CVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENN------- 1065
            CV ++DIFQFSN+YAP+SLI +FLTDQ MA+ CQ+YV  P  SK+S LP   N       
Sbjct: 302  CVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADRD 361

Query: 1066 -----------GNKQPSTPKXXXXXXXXXXXXXXXXXXXXXYMDTI---QKSETSLSLSS 1203
                        +  PS P                      +       ++S+TSLS S+
Sbjct: 362  SPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQTSLSSSN 421

Query: 1204 TDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIR 1383
               N+       LPT++CLFDLYRSLS G TL+SWY+S   I+ ENN+DVR+FI FG+ R
Sbjct: 422  LRANDNRNRF--LPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLER 479

Query: 1384 GLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXI 1563
             +IYRC+S+P+              LN     R ++                        
Sbjct: 480  RIIYRCYSFPV-------------MLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASF 526

Query: 1564 NVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLE 1743
            +V G+    +    K ER SKVSF + ++  S+ T E   P    +EER +L  SI S E
Sbjct: 527  SVVGSKNSGQPNNVKSERPSKVSF-EMQRAGSLATGEATIPKLSDEEER-ILENSIRSAE 584

Query: 1744 NLDKICVKLGKSRQQVERWLDELGNYKII 1830
            + D ICV L KS+ +VE +L+ELG +K+I
Sbjct: 585  SFDNICVLLSKSKLEVENYLNELGEFKVI 613

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  513 bits (1321), Expect = e-175
 Identities = 283/636 (44%), Positives = 380/636 (59%), Gaps = 35/636 (5%)
 Frame = +1

Query: 28   NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 207
            ++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL +  INF+TIKNYIIPK  LC++L+T
Sbjct: 3    SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKLIT 62

Query: 208  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 387
            FKY  YRIV YP+TIN+P YAR           PY+CETSPYEP+I RLGKMFK+LEEQ+
Sbjct: 63   FKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQN 122

Query: 388  QILSKAENDPIYF-----KSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXX 552
            Q+LSK+E DP++F     ++  +              S                R     
Sbjct: 123  QLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNRFN 182

Query: 553  XXXXXXXV-------TKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPN 711
                   +       + FS+QDL+MRI+QDLNNYSECLIPID GN ++IK+FPLL+PP  
Sbjct: 183  GEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPPTT 242

Query: 712  HLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKH 891
              +SLEDVP+S +NL  +IDVNWDPTM+ IVPYI+G+N I+KI+K + +DP LVIECI+H
Sbjct: 243  -CVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIRH 301

Query: 892  LVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENN-- 1065
            L+YY CV ++DIFQFSN+YAP+SLI +FLTD  MAT CQ+YV  P  SKLS+LP   N  
Sbjct: 302  LIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNFD 361

Query: 1066 ----------------GNKQPSTPKXXXXXXXXXXXXXXXXXXXXXYMDTIQK-SETSLS 1194
                             +  PS P                      +    +   ++  S
Sbjct: 362  SVDQDLTSFSVRRKSKSSSVPSNPNSRTTSFSSTSKVSQNSSLNSSFSSVSKDWRQSQTS 421

Query: 1195 LSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFG 1374
             SST+ +        LPT++CLFDLYRSLS G TL+SWY+   T + ENN+D+R+FI FG
Sbjct: 422  CSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFG 481

Query: 1375 IIRGLIYRCHSYP----IPQRPSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXX 1542
            + R +IYRC+S+P    +  R + E      +    + + L+ R                
Sbjct: 482  LERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKR---------------- 525

Query: 1543 XXXXXXINVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLL 1722
                  ++V G+    +   K  ER SKVSF + ++  S+ T +   P  ++ EE+ +L 
Sbjct: 526  -DYNHSLSVTGSKSTTQTNVKS-ERPSKVSF-EMQRANSLATGKNKIPK-LSDEEKKILE 581

Query: 1723 KSIESLENLDKICVKLGKSRQQVERWLDELGNYKII 1830
            KSI S EN DKICV LGKS+Q+VE +L ELG +K+I
Sbjct: 582  KSIRSAENFDKICVLLGKSKQEVENYLSELGEFKVI 617

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
            Anc_6.17 YEL062W
          Length = 594

 Score =  512 bits (1318), Expect = e-175
 Identities = 281/621 (45%), Positives = 366/621 (58%), Gaps = 17/621 (2%)
 Frame = +1

Query: 25   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 204
            ++ FEGF+PIHT+FY+IFHPTEG+KVCY+FPP NL ++ INFD IKNYIIPK QLC+RLL
Sbjct: 2    MSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRLL 61

Query: 205  TFKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQ 384
            T KY NYRIVSYP+ + +  YAR           PYEC TSPYEP+I RLGKMF++LEEQ
Sbjct: 62   TMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEEQ 121

Query: 385  SQILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXX 564
            SQ+LS+AE D   FK D +              +                          
Sbjct: 122  SQVLSRAERDDSLFKGDKLPFD-----------NNSAKNQAPLTHALISKTKSFSPDKKT 170

Query: 565  XXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMS 744
               +   SVQDLIMRIYQDLNNYSECLIPID+GN I+IK+FPL+ PP +  +S+EDVPM 
Sbjct: 171  EGDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPML 230

Query: 745  LINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITD 924
            ++ L  +ID+NWDPTM++I+P+INGVN I  IA+L+ +DP LVIECIKHL+YY CVIITD
Sbjct: 231  VVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITD 290

Query: 925  IFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE-------NNGNKQPS 1083
            IFQFSN+YAP+SLI  FLTD  MA  CQ YV LP  S+L H+P +       NN +K+ +
Sbjct: 291  IFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGSRNNKHKKSN 350

Query: 1084 TPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSST-DPNNPHFELAHLPTKACL 1260
            +                        M   ++SE+SLS   T           + PT+  L
Sbjct: 351  SLSSTGVLSWQSNSQYSNNSSEFYSMSNKKRSESSLSSEGTPGAGRSDDHTIYYPTRMVL 410

Query: 1261 FDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEG 1440
            FDLYRSLS G+TL  WY +N T I  N +DVRKFI+FG I+ +IYR  SYP+ ++     
Sbjct: 411  FDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLEK----- 465

Query: 1441 IQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINVDGADELLKNVYKKLERH 1620
                 R N I A ++                         I  D  D L  ++Y    R 
Sbjct: 466  -----RRNSIIAKQM----GKSKMAEKAPHSKNAFFSTSDIKFDDGDRLFNSLY---ARF 513

Query: 1621 SKVSFMDKEKN--ESMKTDEKG-------RPSTMTKEERSVLLKSIESLENLDKICVKLG 1773
            SKVSF  + +N  E    D  G           +TKEE+  LL ++++LE+ DKICV+LG
Sbjct: 514  SKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNLESFDKICVQLG 573

Query: 1774 KSRQQVERWLDELGNYKIITC 1836
            +SR ++   + ++G Y++I C
Sbjct: 574  RSRVEIANLIADIGEYRVINC 594

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
            YEL062W (REAL)
          Length = 615

 Score =  505 bits (1300), Expect = e-172
 Identities = 284/634 (44%), Positives = 377/634 (59%), Gaps = 32/634 (5%)
 Frame = +1

Query: 25   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 204
            L++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL N  INF+TIKNYIIPK  LC++L+
Sbjct: 2    LSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKLI 61

Query: 205  TFKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQ 384
            TFKY  YRIV YP+TIN+P YAR           PY+CETSPYEP+I RLGKMFK+LEEQ
Sbjct: 62   TFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQ 121

Query: 385  SQILSKAENDPIYF-----KSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXX 549
            +Q+LSK+E DP++F     ++  +              S                R    
Sbjct: 122  NQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSRY 181

Query: 550  XXXXXXXXVTK--FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLIS 723
                    + +  FS+QDL+MRI+QDLNNYSECLIPID+GN ++IK+FPLL+PP    +S
Sbjct: 182  NDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTT-CVS 240

Query: 724  LEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYY 903
            LEDVP+S +NL  +IDVNWDPTM+NIVPYI+G+N I+KI+KL+ +DP LVIECI+HL+YY
Sbjct: 241  LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300

Query: 904  NCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENN------ 1065
             CV ++DIFQFSN+YAP+S I +FLTD  MA  CQ YV  P  SK+S LP   N      
Sbjct: 301  KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL 360

Query: 1066 ------------GNKQPSTPKXXXXXXXXXXXXXXXXXXXXXYMDTI---QKSETSLSLS 1200
                         +  PS P                      +       ++S+TS S S
Sbjct: 361  DSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQTSCSSS 420

Query: 1201 STDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGII 1380
            +   +N       LPT++CLFDLYRSLS G TL++WY+S   II +NN+D+R+FI FG+ 
Sbjct: 421  NIHISNNRNRF--LPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLE 478

Query: 1381 RGLIYRCHSYP----IPQRPSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXX 1548
            + +IYR +SYP    +  R + E    I + +  +++  + +                  
Sbjct: 479  KRIIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAV--- 535

Query: 1549 XXXXINVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKS 1728
                        L  N+  K  R SKVSF D +K  S+ T E   P     EER +L +S
Sbjct: 536  ------------LFNNI--KSGRPSKVSF-DMQKASSLITGESTIPKLSDDEER-ILEES 579

Query: 1729 IESLENLDKICVKLGKSRQQVERWLDELGNYKII 1830
            + S EN DKICV LGK + +VE +L+ELG +KII
Sbjct: 580  VRSAENFDKICVLLGKPKLEVENYLNELGEFKII 613

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
            SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
            Npr2/3 complex mediates downregulation of TORC1 activity
            upon amino acid limitation; SEA complex is a
            coatomer-related complex that associates dynamically with
            the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
            required for non-nitrogen-starvation (NNS)-induced
            autophagy; Iml1p interacts primarily with phosphorylated
            Npr2p; homolog of human NPRL2; target of Grr1p; required
            for growth on urea and proline
          Length = 615

 Score =  503 bits (1295), Expect = e-171
 Identities = 277/631 (43%), Positives = 378/631 (59%), Gaps = 29/631 (4%)
 Frame = +1

Query: 25   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 204
            L++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL N  INF+T KNYIIPK  LC++L+
Sbjct: 2    LSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKLI 61

Query: 205  TFKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQ 384
            TFKY  YRIV YP+TIN+P YAR           PY+CETSPYEP+I RLGKMFK+LEEQ
Sbjct: 62   TFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQ 121

Query: 385  SQILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXX 564
            +Q+LSK+E DP++F    V              S                +         
Sbjct: 122  NQLLSKSERDPVFFDLK-VLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 565  XXXVTK--------FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI 720
               + K        FS+QDL+MRI+QDLNNYSECLIPID+GN ++IK+FPLL+PP    +
Sbjct: 181  YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTT-CV 239

Query: 721  SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY 900
            SLEDVP+S +NL  +IDVNWDPTM++IVPYI+G+N I+KI+KL+ +DP LVIECI+HL+Y
Sbjct: 240  SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIY 299

Query: 901  YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPF-------- 1056
            Y CV ++DIFQFSN+YAP+SLI +FLTD  MA+ CQ+YV  P  SK+S+LP         
Sbjct: 300  YKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGD 359

Query: 1057 ----------ENNGNKQPSTPKXXXXXXXXXXXXXXXXXXXXXYMDTI---QKSETSLSL 1197
                      ++  +  PS P                      +       ++S+TS S 
Sbjct: 360  QDSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQTSCSS 419

Query: 1198 SSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGI 1377
            S+    N       LPT++CLFDLYRSLS G TL++WY+S   I+ ENN+D+R+FI FG+
Sbjct: 420  SNIHVINNRNRF--LPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGL 477

Query: 1378 IRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXX 1557
             + +IYRC+S+P+     N G +  + +  I    L                        
Sbjct: 478  EKRIIYRCYSFPV---MINAGSREPKEMTPIITKDL----------VNNDKLLEKRNHNH 524

Query: 1558 XINVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIES 1737
             ++  G+    ++   K ER SKVSF + ++  S+ T +   P  ++ EE  +L +SI +
Sbjct: 525  LLSATGSRNTAQSGNLKPERPSKVSF-EMQRVSSLATGKSTMPK-LSDEEEGILEESIRN 582

Query: 1738 LENLDKICVKLGKSRQQVERWLDELGNYKII 1830
             E  DKICV L K + +VE +L+ELG +K+I
Sbjct: 583  AETFDKICVLLSKPKLEVESYLNELGEFKVI 613

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
            (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  493 bits (1270), Expect = e-167
 Identities = 294/698 (42%), Positives = 378/698 (54%), Gaps = 99/698 (14%)
 Frame = +1

Query: 34   FEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTFK 213
            F+GF PIHTIFYS+FHPTEG KVCY+FPP NL N+ INFD+I++Y+IPK QLCN+LLT K
Sbjct: 4    FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 214  YENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQSQI 393
            Y NYRI+ YPITIN   YAR           PYEC+TSPYE  I +LGKMF++LEEQSQ 
Sbjct: 64   YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 394  LSKAENDPIYF----------KSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXX 543
            LSKAE D  YF            D                S               S+  
Sbjct: 124  LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 544  XXXXXXXXXXVTKF--------SVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLK 699
                      + +F        S+QD IMR+YQDLNNYSECLIPID GN ++IK+FPLL+
Sbjct: 184  SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 700  PPPNHLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIE 879
            PPP   IS+EDVP+S +NL  +IDVNWDPTML IVP+I+GVN I+KIAKL+ +D +LVIE
Sbjct: 244  PPP-ATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIE 302

Query: 880  CIKHLVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE 1059
            CIKH +YY CV+I+DIFQFSN+YAPTSL+ +FLTD  MAT+CQ YV +P  S L  LP E
Sbjct: 303  CIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLE 362

Query: 1060 --------NNGNKQPSTPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSL-------- 1191
                    ++G+   +  K                       ++   S + L        
Sbjct: 363  SLSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHRSE 422

Query: 1192 -SLSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIK 1368
             S+SS + N+ +  +  LPT++ LFDLYRSLS GVTL+ WY+ N   I  N +D+RKFI 
Sbjct: 423  SSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDIRKFII 482

Query: 1369 FGIIRGLIYRCHSYPIPQRPSNEGIQRIERLNDI--------DAHRLQIRXXXXXXXXXX 1524
            FGII GL+YRC S+P+    + E I ++++  DI        D  + Q+           
Sbjct: 483  FGIINGLLYRCQSFPV--TANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDIFSTSDIK 540

Query: 1525 XXXXXXXXXXXXI---NVDGADELLKNVYKKLERH------------------------- 1620
                        I   ++D AD +LKNVYKKL                            
Sbjct: 541  VGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSLF 600

Query: 1621 ----------------SKVSFM------------DKEKNESMKTDEKGRPSTMTKEERSV 1716
                            SKVSF             D  +NE +   EK     + K+   +
Sbjct: 601  ESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEK-----LRKQNEQI 655

Query: 1717 LLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKII 1830
            LL+++ES ENLDKICV L K R +VE  L  L ++K+I
Sbjct: 656  LLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVI 693

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
            {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
            YEL062w nitrogen permease regulator
          Length = 646

 Score =  468 bits (1205), Expect = e-157
 Identities = 268/661 (40%), Positives = 367/661 (55%), Gaps = 58/661 (8%)
 Frame = +1

Query: 28   NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 207
            + FEGF+ IH+IFYS FHPTEG+KV ++FPP++L N  INFD+IKNY+IPK  LC+RL+T
Sbjct: 3    SQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRLIT 62

Query: 208  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 387
            FKY NYRI  YP+T+N+  YAR           P+ CETSPYEP+I RLGKMF++LE Q+
Sbjct: 63   FKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEIQN 122

Query: 388  QILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXXX 567
            QILSK+END I F                                               
Sbjct: 123  QILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISNIK 182

Query: 568  XXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSL 747
               + F++ DL+MR+YQDLN YSECLIPID GN ++IK+FPLL PP  + IS+E VP+SL
Sbjct: 183  KKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPY-ISIEHVPISL 241

Query: 748  INLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 927
            +NL  ++DVNWDP ML I+PYING+N+I +I++L+  +  LVIECI+HLVYY C+++TDI
Sbjct: 242  VNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCIVLTDI 301

Query: 928  FQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLP-FENNG------------ 1068
            F+FSNVYAPTS +  FL D  MAT+CQ+YV+LPI SK++ L  + ++G            
Sbjct: 302  FEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNGDIGSR 361

Query: 1069 NKQPSTPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNPHFELAHLPT 1248
            N   ST                             K ++  S+S+ + NN      HLPT
Sbjct: 362  NNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTGNSNNGQNIHKHLPT 421

Query: 1249 KACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRP 1428
            ++ LFDLYRSLS G+TL+ WY  N  II +N +DVR+FI FG++R +IYRC +Y +    
Sbjct: 422  RSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYSVIN-- 479

Query: 1429 SNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINVDGADELLKNVYKK 1608
            S + +Q + +LN+++                             I+   ADE L N YKK
Sbjct: 480  STDHLQNLWKLNELE--------------NPISMENISKLQSNHIDSLAADEALMNAYKK 525

Query: 1609 L-------------------------------------ERHSKVSF--MDKEKN-----E 1656
            L                                     +R SKVSF  + +++N      
Sbjct: 526  LSLKVPSKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGS 585

Query: 1657 SMKTD-EKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKIIT 1833
            ++KT  ++     ++K +R ++LK++   E LDKICV L   RQ V   L ELG  K+I 
Sbjct: 586  NIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLIN 645

Query: 1834 C 1836
            C
Sbjct: 646  C 646

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
            similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  468 bits (1204), Expect = e-157
 Identities = 271/677 (40%), Positives = 366/677 (54%), Gaps = 76/677 (11%)
 Frame = +1

Query: 28   NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 207
            NHF+GF+PIH+IFYS+FHPTEGTKV ++FPP +L N  I+FDTIKNY+IPK QLCN+LLT
Sbjct: 3    NHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKLLT 62

Query: 208  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 387
            FKY +YR+V YP+ INA YYAR           PY+  TSPYEP+I RLGKMF++LEEQS
Sbjct: 63   FKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEEQS 122

Query: 388  QILSKAENDPIYFK---SDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXX 558
            Q+LSK E DPIY+     D                                         
Sbjct: 123  QVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEIMK 182

Query: 559  XXXXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVP 738
                   + S++DLI ++Y+DLNNYSECLIP+D GN I+IK+FPLL PP N   S+EDVP
Sbjct: 183  HIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPP-NSCFSVEDVP 241

Query: 739  MSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVII 918
            ++ +NL + +DVNWDPTM+ IVPYING+N I+KI+K + +D  LV+EC+KHL+YY+CV++
Sbjct: 242  IAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVVL 301

Query: 919  TDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFEN----NGNKQPST 1086
             D+FQFSN+YAPTS +  FLTD  +A +CQ YV+    S+L  LPFE     N ++ P+ 
Sbjct: 302  VDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRNPTA 361

Query: 1087 PKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNPH----FELAH----- 1239
                                     +  QK   + SL S +P+  H     E  H     
Sbjct: 362  STITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPS-EPSITHSSKNSEFNHENNKG 420

Query: 1240 -----LPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCH 1404
                 LPT++CLFDLYRSLS G T++ WY+ N  +I +N +DVR+FI FG+ R LIYRC+
Sbjct: 421  ILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRCY 480

Query: 1405 SYPIPQRPSNEGIQRIERLNDIDAHRLQIR------------XXXXXXXXXXXXXXXXXX 1548
            SYP+      + I  ++ L   D   L                                 
Sbjct: 481  SYPVA-----KSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQFRK 535

Query: 1549 XXXXINVDGADELLKNVYKKLE-------------RHSKVS------------------- 1632
                 N D ADE+L++ YKKL              R  K+S                   
Sbjct: 536  KPLVPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKLSSSTS 595

Query: 1633 --------FMDKEKNESMKTDEKGRPSTMTKEERS---VLLKSIESLENLDKICVKLGKS 1779
                      D+  N+  +  ++   ST  K +R    +LLKSI+++++ DKI +KL  +
Sbjct: 596  GTAKVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEIN 655

Query: 1780 RQQVERWLDELGNYKII 1830
            +Q+VE  L   G Y II
Sbjct: 656  KQEVEELLKATGEYNII 672

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
            similar to uniprot|P39923 Saccharomyces cerevisiae
            YEL062W NPR2 Regulator of nitrogen permeases
            transcription is induced in response to proline and urea
            contains two PEST sequences
          Length = 660

 Score =  460 bits (1183), Expect = e-154
 Identities = 273/658 (41%), Positives = 360/658 (54%), Gaps = 59/658 (8%)
 Frame = +1

Query: 34   FEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTFK 213
            F+GF+PIHT+FY++FHPTEG+KV ++FPP +L N  I+FDTIKNYIIPK QLCN+LLTFK
Sbjct: 5    FDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKLLTFK 64

Query: 214  YENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQSQI 393
            Y  YRIV YP+ +NA YYAR           PY+C TSPYEP+IARLGKMFK+LEEQSQI
Sbjct: 65   YGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEEQSQI 124

Query: 394  LSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXXXXX 573
            LSK+E +P+YF+                  S                             
Sbjct: 125  LSKSEQNPVYFQLK--SNDSNAADQSTEMGSITISEHTDIKSTGDDGEKYLEIIKELAKN 182

Query: 574  VTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLIN 753
                 ++DL+M+++ DLNNYSECLIPID+GN I+IK+FP+  PP ++ IS+EDVP++++N
Sbjct: 183  QKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSN-ISVEDVPIAVVN 241

Query: 754  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 933
            L+++IDVNWDPTM+ IVPYING+N +++IA   ++D  LV ECIKHL+YYNCVI++DIFQ
Sbjct: 242  LSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILSDIFQ 301

Query: 934  FSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE---NN----GNKQPSTP- 1089
            FSN+YAPTS I +FLT+  +A  CQ + V     K S LPFE   NN    G KQ ST  
Sbjct: 302  FSNIYAPTSEIHNFLTNPAVAKACQLF-VQGDSLKQSLLPFEGRPNNIYPTGRKQASTST 360

Query: 1090 -KXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNPHFELAH------LPT 1248
                                   + + +  S TS    +    N             LPT
Sbjct: 361  VHSRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAHASENTSLATGENQMKRILPT 420

Query: 1249 KACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRP 1428
            ++CLFDLY+SLS G T++ WY+ N  II +N +DVRK I FGI R LIYR +SYPI +  
Sbjct: 421  RSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYPIVKNV 480

Query: 1429 SNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINVDGADELLKNVYKK 1608
                I +     +   H                             +D ADELLK++Y+K
Sbjct: 481  GTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQSDKLDAADELLKSLYQK 540

Query: 1609 LE------------------------------------RHSKVSF----MDKEKNESMKT 1668
            L                                      H KVSF      ++K  +   
Sbjct: 541  LSLKQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGSHQKVSFDFGTAGQQKTVTEVP 600

Query: 1669 D----EKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKII 1830
            D    EK       KEE  +LL+S+ + E  DK+C KL KSR +VE  L +LG+Y I+
Sbjct: 601  DLGDGEKVEVWKKKKEEELILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIV 658

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
            Anc_6.17 YEL062W
          Length = 710

 Score =  453 bits (1166), Expect = e-151
 Identities = 231/468 (49%), Positives = 302/468 (64%), Gaps = 4/468 (0%)
 Frame = +1

Query: 25   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 204
            ++HFEGF+PIHT+FYSIFHPTEGTKV YEFPP NL  ++INFDTIKNYIIPK QLC++LL
Sbjct: 2    IDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKLL 61

Query: 205  TFKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQ 384
            T KY +YR+VSYP+TIN+  YAR           P  CETSPYEP IARLGKMF++LEEQ
Sbjct: 62   TLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEEQ 121

Query: 385  SQILSKAENDPIYFKSDY-VXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXX 561
            +Q+LS+AEND +YF + + +              +                         
Sbjct: 122  NQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLSLSEYP 181

Query: 562  XXXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPM 741
                 + FSVQDLIMRI+QDLNNYSECLIPID+GN ++IK+FP + PP +  IS EDVP+
Sbjct: 182  DNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPP-SISISYEDVPV 240

Query: 742  SLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIIT 921
            ++++L++V+DVNWDPTML IVP+I+ +N IS+IA L+ +D   V+ECI+HLVYY  VI++
Sbjct: 241  AMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVILS 300

Query: 922  DIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGN---KQPSTPK 1092
            DIFQF+N+YAPTS +  FLTD  +AT CQ YV LP  S    LP E + N    + S   
Sbjct: 301  DIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINTDLDEYSNSG 360

Query: 1093 XXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACLFDLY 1272
                                 Y     +S  S  +SS +    ++    LPTK+CLFDLY
Sbjct: 361  SAIYPNNEILENDDRLRWPMYYKPRNSQSSLSSGISSGNERTSNY----LPTKSCLFDLY 416

Query: 1273 RSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPI 1416
            RSLS G  L  WY  + ++I  N +D+R+FI FG++RGL+YRC++ PI
Sbjct: 417  RSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPI 464

 Score = 51.6 bits (122), Expect = 5e-06
 Identities = 22/43 (51%), Positives = 32/43 (74%)
 Frame = +1

Query: 1708 RSVLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKIITC 1836
            R +LL+S+   +N+DKIC+KL K R++VE  L E+G+Y II C
Sbjct: 668  RRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIINC 710

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
            YEL062W (NPR2) - Non-membrane-embedded, PEST
            sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  451 bits (1161), Expect = e-150
 Identities = 268/691 (38%), Positives = 359/691 (51%), Gaps = 89/691 (12%)
 Frame = +1

Query: 31   HFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTF 210
            HF+GF+P+H I Y+IFHPTEGTKV ++FPP  L    I FDTIKNY+IPK QLCN+LLTF
Sbjct: 4    HFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKLLTF 63

Query: 211  KYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQSQ 390
            KY ++R+V YP+ + APYYAR           PY+C TSPYE +IARLGKMF +LEEQSQ
Sbjct: 64   KYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEEQSQ 123

Query: 391  ILSKAENDPIYF----KSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXX 558
            ILSKAEN  +YF    +  +               +                        
Sbjct: 124  ILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHEILK 183

Query: 559  XXXXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVP 738
                   + SV+DLI +IY+DLNNYSECLIPID GN ++IK+FPLL PP + L S EDVP
Sbjct: 184  DLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCL-SFEDVP 242

Query: 739  MSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVII 918
            M  +NL  +IDVNWDPTML IVPYING N I+K+AKL+ +D  LV+ECI+HL+YYNCVI+
Sbjct: 243  MPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCVIL 302

Query: 919  TDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE--------NN--- 1065
             DIFQF N+YAPTS +  FLT+  +AT+CQ YV L   + +S LPFE        NN   
Sbjct: 303  ADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNNIPV 362

Query: 1066 ------------GNKQPSTPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTD 1209
                        G +                            +     S+ SL  S   
Sbjct: 363  RNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLGNSEGG 422

Query: 1210 PNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGL 1389
             NN  F      +K+CLFD+YRSLS G T++ WY+++   I    +DVR+FI FG+I GL
Sbjct: 423  FNNKVF----FTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGL 478

Query: 1390 IYRCHSYPIPQRPSNEGIQRIERLNDIDA--------------HRLQIRXXXXXXXXXXX 1527
            +YRC+S+PI +      + +   L+D D+              + +              
Sbjct: 479  LYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLESSS 538

Query: 1528 XXXXXXXXXXXINVDGADELLKNVYKKLE-RHSKVSFMDKEKNESMK------TDEKGRP 1686
                        N D A+++L +VY+KL    +KV    +  N  M+       D  G  
Sbjct: 539  SKLRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGET 598

Query: 1687 S-------------------------TMTKEERS----------------VLLKSIESLE 1743
            S                         + T E+R                 +LLKS+  +E
Sbjct: 599  SVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKRKDELLLLKSVRDVE 658

Query: 1744 NLDKICVKLGKSRQQVERWLDELGNYKIITC 1836
            N DKIC +LG+ R++VE+ L++LG Y ++ C
Sbjct: 659  NFDKICTRLGRDREEVEKMLEDLGPYNVVHC 689

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar to
            uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
            Regulator of nitrogen permeases transcription is induced
            in response to proline and urea contains two PEST
            sequences
          Length = 690

 Score =  439 bits (1128), Expect = e-145
 Identities = 266/686 (38%), Positives = 357/686 (52%), Gaps = 86/686 (12%)
 Frame = +1

Query: 31   HFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTF 210
            HF+GF+P+H IFYS+FHPTEGTKV ++FP   L    I FDTIKNY+IPK QLCN+LLTF
Sbjct: 4    HFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKLLTF 63

Query: 211  KYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQSQ 390
            KY  +R+V YP+ + APYYAR           PY+C TSPYEP+I RLGKMF +LEEQSQ
Sbjct: 64   KYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEEQSQ 123

Query: 391  ILSKAENDPIYF----KSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXX 558
            ILSKAEN  +YF    ++                 S               S        
Sbjct: 124  ILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYEILK 183

Query: 559  XXXXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVP 738
                   K ++ DLI +IY+DLN+YSECLIPID GN ++IK+FPLL PP +   S+EDVP
Sbjct: 184  DLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSS-CFSIEDVP 242

Query: 739  MSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVII 918
            +S +NL  +IDVNWDPTML IVP+ING+N I+K+AK + +D  LV+ECIKHL+YYNCVI+
Sbjct: 243  ISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCVIL 302

Query: 919  TDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE------NNGNKQP 1080
            TDIFQFSN+YA T+ +  FLT+  +A +CQ YV     + L +LPFE        GN + 
Sbjct: 303  TDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNIRD 362

Query: 1081 STPKXXXXXXXXXXXXXXXXXXXXXYMDTI--QKSETSLSLSSTDP----NNPHF----- 1227
             +                        MD +  +   T  S SS+ P    ++  F     
Sbjct: 363  RSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGNSDA 422

Query: 1228 ----ELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIY 1395
                +L    +K+CLFDLYRSL+ G T+R WY+++   I    +DVR+FI FG++ GLIY
Sbjct: 423  GLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGLIY 482

Query: 1396 RCHSYPIPQRPS-NEGIQRIERLNDID----AHRLQIRXXXXXXXXXXXXXXXXXXXXXX 1560
            R +SYP+ +     E ++ +   N        H L+                        
Sbjct: 483  RSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLENAGFK 542

Query: 1561 I---------NVDGADELLKNVYKKLERHSK-----------------------VSFMDK 1644
                        D A+E+L +VY+KL    K                            +
Sbjct: 543  ARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTDISTR 602

Query: 1645 EKNESMKTDEKGRP--------STMTKEERS----------------VLLKSIESLENLD 1752
            E   SM +D K +         +T + +ER                 +LLKS+ S+ N D
Sbjct: 603  ESANSMGSDIKNKVAFDVRKTLATSSADERRRSEILRSIEEKRNEELILLKSVRSVHNFD 662

Query: 1753 KICVKLGKSRQQVERWLDELGNYKII 1830
            KIC  LGK R++VE  L ELG Y ++
Sbjct: 663  KICTLLGKDRERVESMLSELGPYNVL 688

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  426 bits (1094), Expect = e-140
 Identities = 252/670 (37%), Positives = 355/670 (52%), Gaps = 69/670 (10%)
 Frame = +1

Query: 28   NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 207
            N F+GF+PIH IFY++FHPTEGTKV ++FP  +L    I FDTIKNY+IPK+QLCN+L+T
Sbjct: 10   NKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKLVT 69

Query: 208  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 387
            FK+ +YR+V YP+ I APYYAR           PY+  TSPYEP+IARL KM ++LEEQS
Sbjct: 70   FKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEEQS 129

Query: 388  QILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXXX 567
            Q+LSK E DP+Y++                                  +           
Sbjct: 130  QMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHEIMKHI 189

Query: 568  XXVTK-FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMS 744
                K   ++DLI ++Y+DLNNYSECLIP+D GN I+IK+FPLL PP N  +S EDVP++
Sbjct: 190  NSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPP-NSCLSFEDVPIA 248

Query: 745  LINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITD 924
             +NL N++DVNWDPTML IVP+ING+N I+KI+K + +   LV+ECIKHLVYY+CV + D
Sbjct: 249  KVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVALVD 308

Query: 925  IFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE---NNGNKQPSTPKX 1095
            +FQFSN+YAPT+L+  FL D  +  +CQ YVV     ++  LPFE   N G+ +  T   
Sbjct: 309  MFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRNQTAST 368

Query: 1096 XXXXXXXXXXXXXXXXXXXXYMDTIQKSE--TSLSLSSTDPNNPHFE----------LAH 1239
                                  +  QKS   +SL+ S T  N  ++              
Sbjct: 369  NTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRNLESNCKRT 428

Query: 1240 LPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIP 1419
            LPT+  LFDLYRSL+ G TL+ WY++N + I EN +DVR+ I FG+   LIYRC+SYP+ 
Sbjct: 429  LPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRCYSYPVA 488

Query: 1420 QRPSN-EGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINV-------DG 1575
            +     E ++R + ++  D                              N+       D 
Sbjct: 489  KSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRVDFDGSSRSRNIPPFLNSSDV 548

Query: 1576 ADELLKNVYKKLE-------------------RHSKVSFMDKEKNESMKT--------DE 1674
            A+E+L+  Y+KL                      ++ +     + +SM T        D 
Sbjct: 549  AEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNTTRITFDI 608

Query: 1675 KGRPSTMTKEERS------------------VLLKSIESLENLDKICVKLGKSRQQVERW 1800
            + R  +   E R                   +LL+S++S+++ DKI V+L  ++ +VER 
Sbjct: 609  RNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVERL 668

Query: 1801 LDELGNYKII 1830
            L   G Y I+
Sbjct: 669  LKGTGEYNIV 678

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
            Anc_6.17 YEL062W
          Length = 675

 Score =  421 bits (1081), Expect = e-138
 Identities = 274/686 (39%), Positives = 344/686 (50%), Gaps = 83/686 (12%)
 Frame = +1

Query: 28   NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 207
            N F+GF+PIH IFYS+FHPTEGTKV YEFPP NL    INFD IKNY+IPK QLC++LLT
Sbjct: 3    NSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKLLT 62

Query: 208  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 387
             KY NYRIV YPI IN+  YAR           PYECETSPYEP + RLGKMF  LE Q 
Sbjct: 63   LKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEGQC 122

Query: 388  QILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXXX 567
            Q LSK E D  YF    +              +               +           
Sbjct: 123  QFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTNTQ 182

Query: 568  XXVTKFSVQDLIMRIYQDLNNYSECLIPIDK----GNDINIKVF---------------- 687
                   V+ L  + Y  + NY    I  DK     NDI ++VF                
Sbjct: 183  DKANSKEVEYLFSK-YNVIQNY----IKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDG 237

Query: 688  --------PLLKPPPNHLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIA 843
                    P L PP +  IS+EDVP+  +NLN +IDVNWDPTML IVPYI+G+N I KIA
Sbjct: 238  NAIDIKLFPTLMPPIDS-ISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIA 296

Query: 844  KLTKADPLLVIECIKHLVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVL 1023
             L+ +D +LVIECI+H VYY CVI++DIFQFSN+YAPTS I  FLTD  +AT+CQ YV  
Sbjct: 297  NLSNSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTS 356

Query: 1024 PIGSKLSHLPFENNGNKQPS-----------TPKXXXXXXXXXXXXXXXXXXXXXYMDTI 1170
            P  S LS LPF+  G K              T                         DT 
Sbjct: 357  PEDSLLSALPFK-KGRKMVKNRRSASIASHFTSSSSLRQNLNSKASSFISDEGHHNDDTA 415

Query: 1171 QKSETSL---------SLSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNA 1323
              +  S+         S SS + +  H    +LPTK+ LFDLYRSLS GV L  WYQ N 
Sbjct: 416  YPNHDSIYENRRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINF 475

Query: 1324 TIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIR--- 1494
              I +N +D+R+FI FGII+ +IYRCHSYP+P+  + E   ++  L ++      ++   
Sbjct: 476  NSIRDNFIDIRRFIIFGIIKRIIYRCHSYPLPK--NYEAFSKLNDLKNLQNGPKIVKNKS 533

Query: 1495 -------XXXXXXXXXXXXXXXXXXXXXXINVDGADELLKNVYKKL-------------- 1611
                                         ++VD AD +L NVYKKL              
Sbjct: 534  QSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSINGQG 593

Query: 1612 ERHSKVSFMDKEKNESMKTDEKGRPSTM----TKEERSV-------LLKSIESLENLDKI 1758
            +  SKV+F    KN+S   D  G  + +    TK  R +       LL +++S ENLD I
Sbjct: 594  QHPSKVAF----KNQSYDNDLPGLMNNLGIEATKFSREININDKIYLLDALQSAENLDNI 649

Query: 1759 CVKLGKSRQQVERWLDELGNYKIITC 1836
            C  L  SR++VE  L+EL  Y+II C
Sbjct: 650  CSNLELSREEVETLLNELTEYRIINC 675

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
            YEL062W
          Length = 666

 Score =  413 bits (1062), Expect = e-136
 Identities = 225/451 (49%), Positives = 292/451 (64%), Gaps = 31/451 (6%)
 Frame = +1

Query: 577  TKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLINL 756
            ++ SVQDLIMRIYQDLNNYSECLIPID GN+++IK+FPLLKPPP + +S+EDVPMSL++L
Sbjct: 225  SRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDL 284

Query: 757  NNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQF 936
              + DVNWDPTML ++P+ING+NDISKI+KL+ + P+LVIECIKHL+YYNCVIITDIFQF
Sbjct: 285  TKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQF 344

Query: 937  SNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE--------------NNGNK 1074
            SN Y+ TSLI +FLTD  MAT CQNYVVLP+GSKL+ LPF               ++ N+
Sbjct: 345  SNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNR 404

Query: 1075 QPSTPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNPHF-ELAHLPTK 1251
               TP                        D  ++SETSL+ SS DP+N +    AHLPTK
Sbjct: 405  HEKTPSFGSSITSNNGRSSFSA-------DDRKQSETSLN-SSNDPSNSNLISTAHLPTK 456

Query: 1252 ACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPI---PQ 1422
              LF+LYRSL+    L++WY+ N T I ENN+D+RKFIKFGII+GLIYRCHSYPI   P 
Sbjct: 457  MSLFELYRSLNQRTDLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIVITPV 516

Query: 1423 RPSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINV-DGADELLKNV 1599
              + E  +              +                         V D  D+L+K+ 
Sbjct: 517  VSAPESAKSTSPFVSSSGISSSVDSKQHTQKGPISRFPGLGSHVPSSGVRDTRDKLMKSF 576

Query: 1600 YKKLER---HSKVSFMDK-----EKNE----SMKTDEKGRPSTMTKEERSVLLKSIESLE 1743
            Y+KLE+   HSKVSF DK     ++N+    S   D+K + S +T ++R++LL SI +++
Sbjct: 577  YEKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSK-SQLTLKQRNILLDSISNMD 635

Query: 1744 NLDKICVKLGKSRQQVERWLDELGNYKIITC 1836
            N+DKICVKLG+ R Q+E WL E G+YK+I C
Sbjct: 636  NMDKICVKLGRPRSQIEEWLSEFGDYKVINC 666

 Score =  238 bits (608), Expect = 3e-69
 Identities = 112/143 (78%), Positives = 123/143 (86%)
 Frame = +1

Query: 10  SNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQL 189
           SNLN++NHFEGFMPIHTIFYSIFHPTEGTKV YEFPP NL+   I+FD IKNYIIPK QL
Sbjct: 5   SNLNSINHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQL 64

Query: 190 CNRLLTFKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFK 369
           CN+LLTFKY NYRIVSYPITIN+ +YAR           PY+CETSPYEP+IARLGKMFK
Sbjct: 65  CNKLLTFKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFK 124

Query: 370 ILEEQSQILSKAENDPIYFKSDY 438
           +LEEQ+QILSKAENDPIYFKSDY
Sbjct: 125 VLEEQNQILSKAENDPIYFKSDY 147

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
            similar to uniprot|P39923 Saccharomyces cerevisiae
            YEL062W NPR2 Regulator of nitrogen permeases
            transcription is induced in response to proline and urea
            contains two PEST sequences
          Length = 710

 Score =  310 bits (794), Expect = 9e-96
 Identities = 195/511 (38%), Positives = 266/511 (52%), Gaps = 94/511 (18%)
 Frame = +1

Query: 580  KFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLINLN 759
            + S++DLI ++YQDLNNYSEC IPID GN ++IK+FPLL PP N  +S EDVP+S +NL 
Sbjct: 203  RLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPLLAPP-NSCLSFEDVPISTVNLA 261

Query: 760  NVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQFS 939
             +IDVNWDPTML IVP+INGVN I+KIAK + +D  LVIEC+KHL+YYNCV++ DIFQFS
Sbjct: 262  KLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVIECVKHLIYYNCVVLADIFQFS 321

Query: 940  NVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGN--------KQPS---- 1083
            N+YA TSLI  FLTD  +A++CQ YV      +L  LPFE+  N        KQ S    
Sbjct: 322  NIYASTSLISEFLTDPTLASECQTYVT-SSDLELYRLPFESRPNLLSMHSSRKQNSSSTI 380

Query: 1084 -----------TPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNPHFE 1230
                       T                        M    +S  S + S+ D       
Sbjct: 381  HTVGVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLMRVRDRSGQSTTGSAVDEQESRL- 439

Query: 1231 LAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSY 1410
               LPTK+CLFDLYRSL  G T++ WY+ N  II +N++DVR+FI FGI+RGLIYRC++Y
Sbjct: 440  --LLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDVRRFITFGIVRGLIYRCYAY 497

Query: 1411 PIPQR-PSNEGIQRIERLNDIDAHRLQIR----------------XXXXXXXXXXXXXXX 1539
            P+ +   + E ++ ++  +D  + R +++                               
Sbjct: 498  PVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNVFSTADIKVDLEHSPGGAPAE 557

Query: 1540 XXXXXXXINVDGADELLKNVYKKL-----------ERHSKVSFM------DKEKNESMKT 1668
                    NVD A+E+LK+ YKKL             H+ +S +      +     S K 
Sbjct: 558  IFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLYHVHNPMSRLYGHDSGESSTKGSRKG 617

Query: 1669 DEKGRPSTMTKEERS-------------------------------------VLLKSIES 1737
              KG  STM  E RS                                     +LLKS++S
Sbjct: 618  SRKGSSSTMESETRSKVAFEKGRSPWQVEEDEKKERTEEVSNLLKEKRHEEFLLLKSVKS 677

Query: 1738 LENLDKICVKLGKSRQQVERWLDELGNYKII 1830
            ++  DKIC++L K R++VE+ L E+G+Y II
Sbjct: 678  VDTFDKICMRLEKDREEVEQLLKEMGHYNII 708

 Score =  207 bits (528), Expect = 1e-57
 Identities = 92/133 (69%), Positives = 108/133 (81%)
 Frame = +1

Query: 28  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 207
           +HF+GF+PIHT+FYS+FHPTEGTKV Y+FPP NL N  INFDTIKNY+IPK QLCN+LLT
Sbjct: 3   SHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKLLT 62

Query: 208 FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 387
           FKY  YR+  YP+ +NA YYAR           PY C TSPYEP++ARLGKMF++LEEQS
Sbjct: 63  FKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEEQS 122

Query: 388 QILSKAENDPIYF 426
           QILSKAENDP+YF
Sbjct: 123 QILSKAENDPVYF 135

>CAGL0D03168g Chr4 complement(324192..330440) [6249 bp, 2082 aa] {ON}
            similar to uniprot|P08678 Saccharomyces cerevisiae
            YJL005w CYR1 adenylate cyclase
          Length = 2082

 Score = 34.7 bits (78), Expect = 1.0
 Identities = 33/135 (24%), Positives = 58/135 (42%), Gaps = 3/135 (2%)
 Frame = +1

Query: 628  NYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLIN---LNNVIDVNWDPTMLN 798
            N  +C+  + K N  + K+     P          +    +N   L+ V+DV+      +
Sbjct: 1543 NLGDCMAVLSKNNGDHQKITKQHVPTKREEYERIRLSGGYVNNGKLDGVVDVSRAVGFFD 1602

Query: 799  IVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQFSNVYAPTSLICSFL 978
            ++P+I+   DIS +  +TKAD +L+I   K   Y +     DI +  +V  P  L    L
Sbjct: 1603 LLPHIHASPDIS-VINVTKADEMLIIGTHKLWEYMDIETACDIAR-EHVLEP-MLAAEEL 1659

Query: 979  TDQEMATQCQNYVVL 1023
             D  +A  C   + +
Sbjct: 1660 KDHAIAYGCSENITI 1674

>TBLA0C03630 Chr3 (860550..867713) [7164 bp, 2387 aa] {ON} Anc_5.206
            YJL005W
          Length = 2387

 Score = 34.3 bits (77), Expect = 1.3
 Identities = 33/135 (24%), Positives = 57/135 (42%), Gaps = 3/135 (2%)
 Frame = +1

Query: 628  NYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLIN---LNNVIDVNWDPTMLN 798
            N  +C+  + K N    K+  L  P          +    +N   L+  +DV+      +
Sbjct: 1852 NIGDCMAILSKNNGDYEKLTTLHVPYKTEEYERIRISGGYVNNDKLDGSVDVSRAVGFFD 1911

Query: 799  IVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQFSNVYAPTSLICSFL 978
            ++P+I+   DIS +  LTK+D +LVI   K   Y N     DI +  +  +   L    L
Sbjct: 1912 LLPHIHASPDISMVT-LTKSDQMLVIATHKLWEYVNYETACDIAREKS--SDPMLAAEEL 1968

Query: 979  TDQEMATQCQNYVVL 1023
             D  +A  C + + +
Sbjct: 1969 KDHAIAYGCSDNITI 1983

>Suva_12.76 Chr12 (107539..113613) [6075 bp, 2024 aa] {ON} YJL005W
            (REAL)
          Length = 2024

 Score = 33.9 bits (76), Expect = 1.8
 Identities = 26/90 (28%), Positives = 43/90 (47%)
 Frame = +1

Query: 754  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 933
            L+ V+DV+      +++P+I+   DIS +  LTKAD +L++   K   Y +   + DI +
Sbjct: 1531 LDGVVDVSRAVGFFDLLPHIHASPDIS-VVTLTKADEMLIVATHKLWEYMDVDTVCDIAR 1589

Query: 934  FSNVYAPTSLICSFLTDQEMATQCQNYVVL 1023
              N   P       L D  MA  C   + +
Sbjct: 1590 -ENSTDPLRAAAE-LKDHAMAYGCTENITI 1617

>Skud_10.218 Chr10 (392657..398734) [6078 bp, 2025 aa] {ON} YJL005W
            (REAL)
          Length = 2025

 Score = 33.9 bits (76), Expect = 1.8
 Identities = 26/90 (28%), Positives = 43/90 (47%)
 Frame = +1

Query: 754  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 933
            L+ V+DV+      +++P+I+   DIS +  LTKAD +L++   K   Y +   + DI +
Sbjct: 1532 LDGVVDVSRAVGFFDLLPHIHASPDIS-VVTLTKADEMLIVATHKLWEYMDVDTVCDIAR 1590

Query: 934  FSNVYAPTSLICSFLTDQEMATQCQNYVVL 1023
              N   P       L D  MA  C   + +
Sbjct: 1591 -ENSTDPLRAAAE-LKDHAMAYGCTENITI 1618

>YJL005W Chr10 (425157..431237) [6081 bp, 2026 aa] {ON}  CYR1Adenylate
            cyclase, required for cAMP production and cAMP-dependent
            protein kinase signaling; the cAMP pathway controls a
            variety of cellular processes, including metabolism, cell
            cycle, stress response, stationary phase, and sporulation
          Length = 2026

 Score = 33.9 bits (76), Expect = 1.8
 Identities = 26/90 (28%), Positives = 43/90 (47%)
 Frame = +1

Query: 754  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 933
            L+ V+DV+      +++P+I+   DIS +  LTKAD +L++   K   Y +   + DI +
Sbjct: 1533 LDGVVDVSRAVGFFDLLPHIHASPDIS-VVTLTKADEMLIVATHKLWEYMDVDTVCDIAR 1591

Query: 934  FSNVYAPTSLICSFLTDQEMATQCQNYVVL 1023
              N   P       L D  MA  C   + +
Sbjct: 1592 -ENSTDPLRAAAE-LKDHAMAYGCTENITI 1619

>ZYRO0B10362g Chr2 complement(812053..818526) [6474 bp, 2157 aa] {ON}
            some similarities with uniprot|P08678 Saccharomyces
            cerevisiae YJL005W CYR1 Adenylate cyclase required for
            cAMP production and cAMP-dependent protein kinase
            signaling involved in cell cycle control and glucose and
            nitrogen repression of sporulation
          Length = 2157

 Score = 33.5 bits (75), Expect = 2.3
 Identities = 25/90 (27%), Positives = 46/90 (51%)
 Frame = +1

Query: 754  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 933
            L+ V+DV+      +++P+I+   DIS + +LTKAD +LVI   K   Y +     DI +
Sbjct: 1672 LDGVVDVSRAVGFFDLLPHIHASPDISMV-QLTKADEMLVIATHKLWQYMDFETACDIAR 1730

Query: 934  FSNVYAPTSLICSFLTDQEMATQCQNYVVL 1023
             ++  +   L    + D  +A  C + + +
Sbjct: 1731 ENS--SQPMLAAEAMKDHAIAYGCSDNLTI 1758

>TPHA0D04030 Chr4 (850344..858032) [7689 bp, 2562 aa] {ON} Anc_3.443
            YPR117W
          Length = 2562

 Score = 33.5 bits (75), Expect = 2.3
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 4/56 (7%)
 Frame = +1

Query: 31   HFEGFMPIHTIFYSIFHPTEGTKVCYE----FPPKNLSNFHINFDTIKNYIIPKNQ 186
            H+   MP+  IF+ +  P  G  V  E    F P      HI  D + NY+ PKN+
Sbjct: 2273 HYTKDMPMLEIFWLLSSPVGGISVLEEMIVSFQPIIFRMDHITADKLMNYLFPKNE 2328

>Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {ON}
           complement(64627..67593) [2967 nt, 989 aa]
          Length = 988

 Score = 33.1 bits (74), Expect = 2.8
 Identities = 17/58 (29%), Positives = 32/58 (55%)
 Frame = +1

Query: 574 VTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSL 747
           VT  S+Q  + ++ Q+L+ +   L PI+K   +NI+ +P L   P  + +L + P  +
Sbjct: 756 VTTDSIQQ-VAKVKQELDTFVGSLSPIEKNGGVNIESYPKLAQKPGVMSTLINFPFQV 812

>TDEL0E04230 Chr5 complement(789369..795041) [5673 bp, 1890 aa] {ON}
            Anc_5.206 YJL005W
          Length = 1890

 Score = 32.7 bits (73), Expect = 3.9
 Identities = 25/90 (27%), Positives = 45/90 (50%)
 Frame = +1

Query: 754  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 933
            L+ V+DV+      +++P+I+   DIS +  LTKAD +L++   K   Y +     DI +
Sbjct: 1398 LDGVVDVSRAVGFFDLLPHIHASPDIS-LVTLTKADEMLIVATHKLWEYMDFETACDIAR 1456

Query: 934  FSNVYAPTSLICSFLTDQEMATQCQNYVVL 1023
              N   P  L  + + D  +A  C + + +
Sbjct: 1457 -ENAAEP-MLAAAAMKDHAIAYGCSDNLTI 1484

>CAGL0G02805g Chr7 (258452..259330) [879 bp, 292 aa] {ON} highly
           similar to uniprot|P40484 Saccharomyces cerevisiae
           YIL106w MOB1 required for completion of mitosis and
           maintenance of ploidy
          Length = 292

 Score = 32.0 bits (71), Expect = 4.6
 Identities = 15/48 (31%), Positives = 21/48 (43%)
 Frame = -3

Query: 655 QWVLDTPSNYSDLDISSLLNLARKILSHHLLPHQRNLFRTDYHRYCHY 512
           +W  D   N S     +      K +  H++P  R LFR   H YCH+
Sbjct: 197 KWCQDQFDNESIFPAKTSGQFPDKFIERHVIPILRRLFRVYAHIYCHH 244

>Ecym_5364 Chr5 (738965..742579) [3615 bp, 1204 aa] {ON} similar to
            Ashbya gossypii ACL086C
          Length = 1204

 Score = 32.3 bits (72), Expect = 5.0
 Identities = 20/82 (24%), Positives = 43/82 (52%)
 Frame = +1

Query: 1567 VDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLEN 1746
            VD   + L+ + ++  +H  +S    +  ES+ +DEK R  +++K+E   + +S + L N
Sbjct: 106  VDEVQQRLQKIKQEQGKHDAISSKLVDHWESLGSDEKKRILSISKDEVFNVTRSYQWLHN 165

Query: 1747 LDKICVKLGKSRQQVERWLDEL 1812
             +  C   G+    +++ LD +
Sbjct: 166  CN--CTMCGRRSVSLDQELDSI 185

>TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4.238
            YDL058W
          Length = 1657

 Score = 32.0 bits (71), Expect = 6.7
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = +1

Query: 1579 DELLKNVYKKLERHS--KVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLD 1752
            +E +KN+  KLE  S  K S  +K + +S+  ++    +   +EE + L K IESLE L 
Sbjct: 1443 EETVKNLEVKLETLSSEKQSLKEKLQGQSISLND----NESLREENNSLKKKIESLEELT 1498

Query: 1753 KICVK 1767
              C K
Sbjct: 1499 DACDK 1503

>Kpol_534.51 s534 (129416..135307) [5892 bp, 1963 aa] {ON}
            (129416..135307) [5892 nt, 1964 aa]
          Length = 1963

 Score = 32.0 bits (71), Expect = 6.8
 Identities = 21/58 (36%), Positives = 32/58 (55%)
 Frame = +1

Query: 754  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 927
            L+  +DV+      +++P+I+   DIS + KLTKAD +LVI   K   Y +     DI
Sbjct: 1468 LDGGVDVSRAVGFFHLLPHIHASPDIS-VVKLTKADEILVIATHKLWEYMDYETACDI 1524

>Smik_10.274 Chr10 (422245..428346) [6102 bp, 2033 aa] {ON} YJL005W
            (REAL)
          Length = 2033

 Score = 32.0 bits (71), Expect = 6.8
 Identities = 24/90 (26%), Positives = 43/90 (47%)
 Frame = +1

Query: 754  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 933
            L+ V+DV+      +++P+I+   D+S +  LTKAD +L++   K   + +   + DI +
Sbjct: 1540 LDGVVDVSRAVGFFDLLPHIHASPDVS-VVTLTKADEMLIVATHKLWEFMDVDTVCDIAR 1598

Query: 934  FSNVYAPTSLICSFLTDQEMATQCQNYVVL 1023
              N   P       L D  MA  C   + +
Sbjct: 1599 -ENSTDPLRAAAE-LKDHAMAYGCTENITI 1626

>NDAI0E00400 Chr5 complement(65678..71323) [5646 bp, 1881 aa] {ON}
           Anc_8.821 YML103C
          Length = 1881

 Score = 31.6 bits (70), Expect = 8.9
 Identities = 36/134 (26%), Positives = 62/134 (46%), Gaps = 12/134 (8%)
 Frame = +1

Query: 577 TKFSVQDLIMRIYQDLNNYSECLI--------PIDKGNDINIKVFPLLKPPPNHLISLED 732
           T  ++QDLIM + ++ N   E L+        PI K N  N      ++   N LISL  
Sbjct: 193 TVLTIQDLIMAVLKERNAILETLLILLSNIDFPIIKDNLFNFFTIESIENISNDLISLF- 251

Query: 733 VPMSLINLNNVIDVNWDPTMLNIVPYIN--GVNDISKIAKLTKADPLLVIECIKHLVYYN 906
              SLI  N+ I+  +D   ++   +++    ND  K     +   L+ ++   +L+Y  
Sbjct: 252 --QSLIEENSTINY-YDNIFIDEKIFLDNANANDTGKNNNNDRLVQLIDLKNSNNLIYIT 308

Query: 907 CV--IITDIFQFSN 942
            +  I+T++F  SN
Sbjct: 309 NLLKILTNLFLNSN 322

>NCAS0A09780 Chr1 (1954548..1955654) [1107 bp, 368 aa] {ON} Anc_1.222
            YJL131C
          Length = 368

 Score = 31.2 bits (69), Expect = 9.0
 Identities = 19/75 (25%), Positives = 37/75 (49%)
 Frame = +1

Query: 1606 KLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQ 1785
            K+     V F++KE  +    + +G    +  +E+ + + +IE  +N     VKL +S+ 
Sbjct: 123  KINHRGTVKFLNKETKQLEVGNLRGFLKGIDLKEKGISIVNIEKEQNQSIPVVKLVESKV 182

Query: 1786 QVERWLDELGNYKII 1830
             ++ + DEL   K I
Sbjct: 183  ALKAFSDELAKQKAI 197

>TPHA0E01060 Chr5 (218359..219696) [1338 bp, 445 aa] {ON} 
          Length = 445

 Score = 31.2 bits (69), Expect = 9.6
 Identities = 14/43 (32%), Positives = 23/43 (53%)
 Frame = +1

Query: 1618 HSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLEN 1746
            H  ++F+DK K  + + ++  R +     E   LL  I+SLEN
Sbjct: 222  HDNITFIDKLKLSNQEEEKYSRTTVQKNYETQALLNRIQSLEN 264

>KAFR0L01620 Chr12 complement(293645..295126) [1482 bp, 493 aa] {ON}
           Anc_7.372 YER088C
          Length = 493

 Score = 31.2 bits (69), Expect = 9.8
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)
 Frame = +1

Query: 619 DLNNYSECLIPIDKGNDIN--IKVFPLLKPPPNHLI---SLEDVPMSLINLNNVIDVNWD 783
           D+NNY+  +  +DKG++++  +K       P N L+      ++ +S  N      V+ +
Sbjct: 142 DVNNYNAIINALDKGSNLDEFVKENSHSGSPSNALLISPYSSNISVSNFNATKPPKVDGN 201

Query: 784 PTMLNIVPYINGVNDIS 834
           P++  IVP IN V  +S
Sbjct: 202 PSLNLIVPSINHVQTVS 218

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 155,493,309
Number of extensions: 3288647
Number of successful extensions: 9766
Number of sequences better than 10.0: 38
Number of HSP's gapped: 9734
Number of HSP's successfully gapped: 92
Length of query: 613
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 497
Effective length of database: 40,180,143
Effective search space: 19969531071
Effective search space used: 19969531071
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)