Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H008706.17ON61261232640.0
NDAI0D008606.17ON66667316810.0
KNAG0M011406.17ON59462714740.0
ZYRO0C07876g6.17ON68168614260.0
TDEL0G045206.17ON67968614230.0
Kpol_1045.726.17ON69569914220.0
Skud_5.276.17ON61563614150.0
Suva_5.56.17ON61963413680.0
Smik_5.256.17ON61563213531e-180
KAFR0L003806.17ON54061413401e-179
SAKL0E01100g6.17ON71071013551e-179
YEL062W (NPR2)6.17ON61563413411e-178
TPHA0J003106.17ON67568412841e-169
Ecym_30216.17ON67468212821e-169
Kwal_56.224116.17ON68970312731e-167
CAGL0L13288g6.17ON64666912601e-166
KLLA0D01067g6.17ON66066612491e-164
ACR009W6.17ON68067312421e-163
KLTH0C11308g6.17ON69069212261e-160
TBLA0G010106.17ON71048011721e-152
ZYRO0B10362g5.206ON215790880.060
Suva_12.765.206ON202494880.060
Skud_10.2185.206ON202594880.061
YJL005W (CYR1)5.206ON202694880.062
Smik_10.2745.206ON203391830.22
CAGL0D03168g5.206ON208294820.31
TPHA0D040303.443ON256259761.6
Kpol_534.515.206ON196358761.7
TDEL0E042305.206ON189058751.8
KAFR0C004603.279ON15736712.0
TBLA0C036305.206ON238790752.3
Kpol_1004.325.541ON98869742.9
KNAG0J024003.318ON767210733.7
KLLA0C01969g1.66ON101683715.9
NDAI0C004802.633ON598100707.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H00870
         (612 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...  1261   0.0  
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   652   0.0  
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   572   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   553   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   552   0.0  
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   552   0.0  
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   549   0.0  
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    531   0.0  
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   525   e-180
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   520   e-179
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   526   e-179
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   521   e-178
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   499   e-169
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   498   e-169
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   494   e-167
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   489   e-166
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   485   e-164
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   483   e-163
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   476   e-160
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   456   e-152
ZYRO0B10362g Chr2 complement(812053..818526) [6474 bp, 2157 aa] ...    39   0.060
Suva_12.76 Chr12 (107539..113613) [6075 bp, 2024 aa] {ON} YJL005...    39   0.060
Skud_10.218 Chr10 (392657..398734) [6078 bp, 2025 aa] {ON} YJL00...    39   0.061
YJL005W Chr10 (425157..431237) [6081 bp, 2026 aa] {ON}  CYR1Aden...    39   0.062
Smik_10.274 Chr10 (422245..428346) [6102 bp, 2033 aa] {ON} YJL00...    37   0.22 
CAGL0D03168g Chr4 complement(324192..330440) [6249 bp, 2082 aa] ...    36   0.31 
TPHA0D04030 Chr4 (850344..858032) [7689 bp, 2562 aa] {ON} Anc_3....    34   1.6  
Kpol_534.51 s534 (129416..135307) [5892 bp, 1963 aa] {ON} (12941...    34   1.7  
TDEL0E04230 Chr5 complement(789369..795041) [5673 bp, 1890 aa] {...    33   1.8  
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    32   2.0  
TBLA0C03630 Chr3 (860550..867713) [7164 bp, 2387 aa] {ON} Anc_5....    33   2.3  
Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {O...    33   2.9  
KNAG0J02400 Chr10 complement(455506..457809) [2304 bp, 767 aa] {...    33   3.7  
KLLA0C01969g Chr3 (157410..160460) [3051 bp, 1016 aa] {ON} simil...    32   5.9  
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    32   7.3  

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score = 1261 bits (3264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/612 (100%), Positives = 612/612 (100%)

Query: 1   MQNSNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPK 60
           MQNSNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPK
Sbjct: 1   MQNSNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPK 60

Query: 61  NQLCNRLLTFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGK 120
           NQLCNRLLTFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGK
Sbjct: 61  NQLCNRLLTFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGK 120

Query: 121 MFKILEEQSQILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRF 180
           MFKILEEQSQILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRF
Sbjct: 121 MFKILEEQSQILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRF 180

Query: 181 ETDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI 240
           ETDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI
Sbjct: 181 ETDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI 240

Query: 241 SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY 300
           SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY
Sbjct: 241 SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY 300

Query: 301 YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQP 360
           YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQP
Sbjct: 301 YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQP 360

Query: 361 STPKHSRTTSLSSSMSGSVNSHEHSYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACL 420
           STPKHSRTTSLSSSMSGSVNSHEHSYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACL
Sbjct: 361 STPKHSRTTSLSSSMSGSVNSHEHSYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACL 420

Query: 421 FDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEG 480
           FDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEG
Sbjct: 421 FDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEG 480

Query: 481 IQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKNVYKKLERH 540
           IQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKNVYKKLERH
Sbjct: 481 IQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKNVYKKLERH 540

Query: 541 SKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERW 600
           SKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERW
Sbjct: 541 SKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERW 600

Query: 601 LDELGNYKIITC 612
           LDELGNYKIITC
Sbjct: 601 LDELGNYKIITC 612

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/673 (54%), Positives = 458/673 (68%), Gaps = 75/673 (11%)

Query: 4   SNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQL 63
           SNLN++NHFEGFMPIHTIFYSIFHPTEGTKV YEFPP NL+   I+FD IKNYIIPK QL
Sbjct: 5   SNLNSINHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQL 64

Query: 64  CNRLLTFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFK 123
           CN+LLTFKY NYRIVSYPITIN+ +YARNFFSFNFVFVFPY+CETSPYEP+IARLGKMFK
Sbjct: 65  CNKLLTFKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFK 124

Query: 124 ILEEQSQILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFETD 183
           +LEEQ+QILSKAENDPIYFKSDY P +P T IIP          +ND   N    + E  
Sbjct: 125 VLEEQNQILSKAENDPIYFKSDYTPYQP-TLIIP-------TNNDNDGKRNKKLMKKENT 176

Query: 184 FFGEEE---------------------------------------DGVTKFSVQDLIMRI 204
            F   +                                       +  ++ SVQDLIMRI
Sbjct: 177 IFSTRQQRSNSNRILEENSNSNSNSNSNSNGNENDNNYNTIEQYLNNNSRISVQDLIMRI 236

Query: 205 YQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLINLNNVIDVNWDPTM 264
           YQDLNNYSECLIPID GN+++IK+FPLLKPPP + +S+EDVPMSL++L  + DVNWDPTM
Sbjct: 237 YQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTM 296

Query: 265 LNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQFSNVYAPTSLICS 324
           L ++P+ING+NDISKI+KL+ + P+LVIECIKHL+YYNCVIITDIFQFSN Y+ TSLI +
Sbjct: 297 LKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLIST 356

Query: 325 FLTDQEMATQCQNYVVLPIGSKLSHLPF--ENNGNKQPSTP------KHSRTTSLSSSMS 376
           FLTD  MAT CQNYVVLP+GSKL+ LPF  E   + Q S+       +H +T S  SS++
Sbjct: 357 FLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSIT 416

Query: 377 GSVNSHEHSYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSW 436
            S N       D  ++SETSL+ S+   N+     AHLPTK  LF+LYRSL+    L++W
Sbjct: 417 -SNNGRSSFSADDRKQSETSLNSSNDPSNSNLISTAHLPTKMSLFELYRSLNQRTDLKNW 475

Query: 437 YQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQ 496
           Y+ N T I ENN+D+RKFIKFGII+GLIYRCHSYPI   P     +  +  +   +    
Sbjct: 476 YKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIVITPVVSAPESAKSTSPFVSSSGI 535

Query: 497 IRSSGSAARSNSG-----SGSGSSASPSSINVDGADELLKNVYKKLER---HSKVSFMDK 548
             S  S   +  G      G GS   PSS   D  D+L+K+ Y+KLE+   HSKVSF DK
Sbjct: 536 SSSVDSKQHTQKGPISRFPGLGSHV-PSSGVRDTRDKLMKSFYEKLEKGKNHSKVSFSDK 594

Query: 549 -----EKNESMKT----DEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVER 599
                ++N+   T    D+K + S +T ++R++LL SI +++N+DKICVKLG+ R Q+E 
Sbjct: 595 IAFQNDENDHSATSSDNDDKSK-SQLTLKQRNILLDSISNMDNMDKICVKLGRPRSQIEE 653

Query: 600 WLDELGNYKIITC 612
           WL E G+YK+I C
Sbjct: 654 WLSEFGDYKVINC 666

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/627 (49%), Positives = 401/627 (63%), Gaps = 57/627 (9%)

Query: 9   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 68
           ++ FEGF+PIHT+FY+IFHPTEG+KVCY+FPP NL ++ INFD IKNYIIPK QLC+RLL
Sbjct: 2   MSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRLL 61

Query: 69  TFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQ 128
           T KY NYRIVSYP+ + +  YARN+F FNFVFVFPYEC TSPYEP+I RLGKMF++LEEQ
Sbjct: 62  TMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEEQ 121

Query: 129 SQILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFETDFFGEE 188
           SQ+LS+AE D   FK D +P +         + S +N+    H   +    F  D   + 
Sbjct: 122 SQVLSRAERDDSLFKGDKLPFD---------NNSAKNQAPLTHALISKTKSFSPD--KKT 170

Query: 189 EDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMS 248
           E  +   SVQDLIMRIYQDLNNYSECLIPID+GN I+IK+FPL+ PP +  +S+EDVPM 
Sbjct: 171 EGDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPML 230

Query: 249 LINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITD 308
           ++ L  +ID+NWDPTM++I+P+INGVN I  IA+L+ +DP LVIECIKHL+YY CVIITD
Sbjct: 231 VVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITD 290

Query: 309 IFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQPSTP----- 363
           IFQFSN+YAP+SLI  FLTD  MA  CQ YV LP  S+L H+P       Q S P     
Sbjct: 291 IFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPL------QTSVPGSRNN 344

Query: 364 KHSRTTSLSSSMSGS--------VNSHEHSYMDTIQKSETSLSLSST-DPNNPHFELAHL 414
           KH ++ SLSS+   S         NS E   M   ++SE+SLS   T           + 
Sbjct: 345 KHKKSNSLSSTGVLSWQSNSQYSNNSSEFYSMSNKKRSESSLSSEGTPGAGRSDDHTIYY 404

Query: 415 PTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQ 474
           PT+  LFDLYRSLS G+TL  WY +N T I  N +DVRKFI+FG I+ +IYR  SYP+ +
Sbjct: 405 PTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLE 464

Query: 475 RPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKNVY 534
           +          R N I A ++      S     +     +  S S I  D  D L  ++Y
Sbjct: 465 K----------RRNSIIAKQM----GKSKMAEKAPHSKNAFFSTSDIKFDDGDRLFNSLY 510

Query: 535 KKLERHSKVSFMDKEKN--ESMKTDEKG-------RPSTMTKEERSVLLKSIESLENLDK 585
               R SKVSF  + +N  E    D  G           +TKEE+  LL ++++LE+ DK
Sbjct: 511 ---ARFSKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNLESFDK 567

Query: 586 ICVKLGKSRQQVERWLDELGNYKIITC 612
           ICV+LG+SR ++   + ++G Y++I C
Sbjct: 568 ICVQLGRSRVEIANLIADIGEYRVINC 594

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/686 (48%), Positives = 437/686 (63%), Gaps = 108/686 (15%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           + FEGF+PIHT+FY++FHPT+GT+V YE+PP NL   +INFD IKNYIIPK QLC++LLT
Sbjct: 17  DQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKLLT 76

Query: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129
            KY+ YRIV YP+T+N+PYYARNFFSFNFVFVFPY+CETS YEP+IARLGKMF++LEEQ+
Sbjct: 77  LKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEEQN 136

Query: 130 QILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFETDFFGEEE 189
           QILSKAENDPIYF  D+   + TT    +++ + ++ +    +     +++  +   + E
Sbjct: 137 QILSKAENDPIYF--DFKLADNTTEQDGKLN-AEKSFKGLTKSQGMALAKY-NEIMKDLE 192

Query: 190 DGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSL 249
              + FSVQDL+MRI+QDLNNYSECLIPID+GN ++IK+FP LK PPN  IS+EDVP+S 
Sbjct: 193 SEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFP-LKTPPNSCISIEDVPIST 251

Query: 250 INLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 309
           +NL  +IDVNWDPTML IVPYI+G+N ISKIAKL+ +D  LV+EC+KHLVYYNCVI+ DI
Sbjct: 252 VNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILADI 311

Query: 310 FQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE-------NNGNKQPST 362
           FQFSN+YAPTSLI  FLTD  +A++CQ++V L   S LS +PFE       ++ ++  + 
Sbjct: 312 FQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDDMDQSKNQ 371

Query: 363 PKHSRTTSLSSSM----------SGSVNSHEHSYMDTIQKSETSLSLSSTDPNNPHFELA 412
              SRTTS+SS            S   N +  +     Q+S++  S SST+ N  H    
Sbjct: 372 ESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFN-----QRSQS--SFSSTNTNVTHDLAR 424

Query: 413 HLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPI 472
           HLPTKACLFDLYR+LS GVT+R WY  N   I +N++DVR+FI FG+I+GLIYRC S+P+
Sbjct: 425 HLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPV 484

Query: 473 PQRPSNEGIQRIERLNDIDAHRL-------QIRSSGSAAR-----------SNSGSGSGS 514
            ++ S         + D+ AH+L       Q+   G   +           S+   G GS
Sbjct: 485 MKKMS---------IFDL-AHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEGS 534

Query: 515 SASPSSINVDGADELLKNVYKKL------------------------------------- 537
                + +VD ADE+L+NVYKKL                                     
Sbjct: 535 KMH-QNFSVDIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHP 593

Query: 538 ---ERHSKVSF-MDK---------EKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLD 584
              ER SKV+F M+K         ++    K  E  +       ++ +LL+SI + + LD
Sbjct: 594 KKPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLD 653

Query: 585 KICVKLGKSRQQVERWLDELGNYKII 610
           KICVKL K R +VE  L ELG+YKII
Sbjct: 654 KICVKLEKPRHEVEELLHELGDYKII 679

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/686 (47%), Positives = 430/686 (62%), Gaps = 96/686 (13%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           + FEGF+PIHTIFY++FHPTEGTKV YEFPP NL + +INFD IKNYIIPK QLC++LLT
Sbjct: 3   DQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKLLT 62

Query: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129
            KY+NYRI SYP+T+N+P YARNFFSFNFVFVFPY+C+TSPYEP+IARLGKMFK+LEEQ+
Sbjct: 63  LKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEEQN 122

Query: 130 QILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFETDFFGEEE 189
            ILSKAE DPI++    V  +       +      N   +    +    +  TD     E
Sbjct: 123 LILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTDI----E 178

Query: 190 DGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSL 249
              + FS++DL++R+YQDLNNYSECLIPID+GN ++IK+FP++  PPN  IS+EDVP+S 
Sbjct: 179 SADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMT-PPNSNISIEDVPVST 237

Query: 250 INLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 309
           +NLN VIDVNWDPTML IVPYING+N ISKIAKL+ +DP LVIECIKHL+YYNCV++ DI
Sbjct: 238 VNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADI 297

Query: 310 FQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQPSTPKH---- 365
           FQFSN+YAPTS + +FLTD  ++T+CQ+YVV    S L  LPF+   +    +  H    
Sbjct: 298 FQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDHELAD 357

Query: 366 ---------SRTTSLSSSMSGSVNSH--------EHSYMDTIQKSETSLSLSSTDPNNPH 408
                    SRTTS+SS+     +S+        E S   T + S++S S ++T+P+N  
Sbjct: 358 SHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSFSSNNTNPSN-- 415

Query: 409 FELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCH 468
               +LPTK+CLFDLYRSLS G +LR WY  +   I  N +DVR+FI FG+I GLIYRC+
Sbjct: 416 MLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCY 475

Query: 469 SYPIPQRPSNEGIQRIERLNDIDAHRLQIRSSGSAAR---SNSGSGSG------SSASPS 519
           SYPI +      + +     DI  H ++   + + ++   S S    G       +    
Sbjct: 476 SYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYERQRNKHHK 535

Query: 520 SINVDGADELLKNVYKKL------------------------------------------ 537
           ++N+D ADE+L+NVYKKL                                          
Sbjct: 536 ALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQNS 595

Query: 538 ERHSKVSFMDKEK------------NESMKTDEKGRPSTMTKEERS-VLLKSIESLENLD 584
           +R SKVSF DK++            N+ +K DE+ +   + + ER  +LL+S+E+ ++LD
Sbjct: 596 DRPSKVSF-DKQQEIGHISKGMSSSNDKVKMDEEAK---LERRERDLILLESVEAADSLD 651

Query: 585 KICVKLGKSRQQVERWLDELGNYKII 610
            ICVKL  SR  VE  +  LG YKII
Sbjct: 652 TICVKLEMSRYDVEALIQNLGEYKII 677

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/699 (45%), Positives = 419/699 (59%), Gaps = 109/699 (15%)

Query: 12  FEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTFK 71
           F+GF PIHTIFYS+FHPTEG KVCY+FPP NL N+ INFD+I++Y+IPK QLCN+LLT K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 72  YENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQSQI 131
           Y NYRI+ YPITIN   YARN FSFN VFVFPYEC+TSPYE  I +LGKMF++LEEQSQ 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 132 LSKAENDPIYFKSDYV---PTEPTTTIIPQ-----------ISPSHRNKRNNDHNDNNDG 177
           LSKAE D  YF    +     +  + + P+            + ++    + +  D+   
Sbjct: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 178 SRFETDFFGEEEDGV----TKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLK 233
           S +  + + E ++ V    + FS+QD IMR+YQDLNNYSECLIPID GN ++IK+FPLL+
Sbjct: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 234 PPPNHLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIE 293
           PPP   IS+EDVP+S +NL  +IDVNWDPTML IVP+I+GVN I+KIAKL+ +D +LVIE
Sbjct: 244 PPP-ATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIE 302

Query: 294 CIKHLVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE 353
           CIKH +YY CV+I+DIFQFSN+YAPTSL+ +FLTD  MAT+CQ YV +P  S L  LP E
Sbjct: 303 CIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLE 362

Query: 354 --------NNGNKQPSTPK-----HSRTTSLSSSMSGSV---NSHEHSYMDT-IQKSETS 396
                   ++G+   +  K      SR  S  SS   S    NS  +S  D  + +  + 
Sbjct: 363 SLSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHRSE 422

Query: 397 LSLSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIK 456
            S+SS + N+ +  +  LPT++ LFDLYRSLS GVTL+ WY+ N   I  N +D+RKFI 
Sbjct: 423 SSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDIRKFII 482

Query: 457 FGIIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRS------------SGSAA 504
           FGII GL+YRC S+P+    + E I ++++  DI  +R + R             S S  
Sbjct: 483 FGIINGLLYRCQSFPVT--ANFEEINKVKKFKDI-QNRKETRKDKLQKQLSQDIFSTSDI 539

Query: 505 RSNSGSGSGSSASPSSINVDGADELLKNVYKKLERH------------------------ 540
           +      SG +    ++++D AD +LKNVYKKL                           
Sbjct: 540 KVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSL 599

Query: 541 -----------------SKVSFM------------DKEKNESMKTDEKGRPSTMTKEERS 571
                            SKVSF             D  +NE +   EK R     K+   
Sbjct: 600 FESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKLR-----KQNEQ 654

Query: 572 VLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKII 610
           +LL+++ES ENLDKICV L K R +VE  L  L ++K+I
Sbjct: 655 ILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVI 693

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/636 (50%), Positives = 427/636 (67%), Gaps = 60/636 (9%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           ++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL N  INF+TIKNYIIPK  LC++L+T
Sbjct: 3   SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKLIT 62

Query: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129
           FKY  YRIV YP+TIN+P YARNFFSFNFVFVFPY+CETSPYEP+I RLGKMFK+LEEQ+
Sbjct: 63  FKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQN 122

Query: 130 QILSKAENDPIYFKSDYVPTEPTTTIIPQI--SPSHRNKRNNDHNDNNDGSRFETDFFGE 187
           Q+LSK+E D ++F  D    E  +TI P    +P+  N  +N         +   D    
Sbjct: 123 QLLSKSEKDAVFF--DLKALE-NSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSS 179

Query: 188 EEDGVTK--------FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHL 239
             + +TK        FS+QDL+MRI+QDLNNYSECLIPID+GN ++IK+FPLL+ PP   
Sbjct: 180 RYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLR-PPTTC 238

Query: 240 ISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLV 299
           +SLEDVP+S +NL  +IDVNWDPTM++IVPYI+G+N I+KI+KL+++DP LVIECI+HL+
Sbjct: 239 VSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLI 298

Query: 300 YYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENN---- 355
           YY CV ++DIFQFSN+YAP+SLI +FLTDQ MA+ CQ+YV  P  SK+S LP   N    
Sbjct: 299 YYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSA 358

Query: 356 -----------GNKQPSTPKH--SRTTSLSSSMSGSVNSHEHSYMDTI----QKSETSLS 398
                       +K  S P +  SRTTS SS+   S NS  +S   ++    ++S+TSLS
Sbjct: 359 DRDSPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQTSLS 418

Query: 399 LSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFG 458
            S+   N+       LPT++CLFDLYRSLS G TL+SWY+S   I+ ENN+DVR+FI FG
Sbjct: 419 SSNLRANDNRNRF--LPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFG 476

Query: 459 IIRGLIYRCHSYP----IPQRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGS 514
           + R +IYRC+S+P    +  R   E  + I + +  D   L+ ++  +   S S  GS +
Sbjct: 477 LERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDA---SFSVVGSKN 533

Query: 515 SASPSSINVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLL 574
           S  P+++              K ER SKVSF + ++  S+ T E   P    +EER +L 
Sbjct: 534 SGQPNNV--------------KSERPSKVSF-EMQRAGSLATGEATIPKLSDEEER-ILE 577

Query: 575 KSIESLENLDKICVKLGKSRQQVERWLDELGNYKII 610
            SI S E+ D ICV L KS+ +VE +L+ELG +K+I
Sbjct: 578 NSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVI 613

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/634 (48%), Positives = 415/634 (65%), Gaps = 52/634 (8%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           ++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL +  INF+TIKNYIIPK  LC++L+T
Sbjct: 3   SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKLIT 62

Query: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129
           FKY  YRIV YP+TIN+P YARNFFSFNFVFVFPY+CETSPYEP+I RLGKMFK+LEEQ+
Sbjct: 63  FKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQN 122

Query: 130 QILSKAENDPIYFKSDYVPTE---PTTTIIPQISPSHRNKRNNDHNDNNDGSRFETDFF- 185
           Q+LSK+E DP++F    +      P+T   P  S    N        + D     ++ F 
Sbjct: 123 QLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNRFN 182

Query: 186 GEEEDGVTK--------FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPN 237
           GE+ + + K        FS+QDL+MRI+QDLNNYSECLIPID GN ++IK+FPLL+ PP 
Sbjct: 183 GEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLR-PPT 241

Query: 238 HLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKH 297
             +SLEDVP+S +NL  +IDVNWDPTM+ IVPYI+G+N I+KI+K + +DP LVIECI+H
Sbjct: 242 TCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIRH 301

Query: 298 LVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGN 357
           L+YY CV ++DIFQFSN+YAP+SLI +FLTD  MAT CQ+YV  P  SKLS+LP   N +
Sbjct: 302 LIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNFD 361

Query: 358 K---------------------QPSTPKHSRTTSLSSSMSGSVNSHEHSYMDTIQKSETS 396
                                  P++   S +++   S + S+NS   S     ++S+TS
Sbjct: 362 SVDQDLTSFSVRRKSKSSSVPSNPNSRTTSFSSTSKVSQNSSLNSSFSSVSKDWRQSQTS 421

Query: 397 LSLSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIK 456
            S ++T   +   +   LPT++CLFDLYRSLS G TL+SWY+   T + ENN+D+R+FI 
Sbjct: 422 CSSTNTHAISKRNQF--LPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFIT 479

Query: 457 FGIIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSA 516
           FG+ R +IYRC+S+P+     +   + +  +              +   SN  +      
Sbjct: 480 FGLERSIIYRCYSFPVMIHVGSRDTKEMTPV-------------ATKEPSNEDNSLKKRD 526

Query: 517 SPSSINVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKS 576
              S++V G+    +   K  ER SKVSF + ++  S+ T +   P  ++ EE+ +L KS
Sbjct: 527 YNHSLSVTGSKSTTQTNVKS-ERPSKVSF-EMQRANSLATGKNKIPK-LSDEEKKILEKS 583

Query: 577 IESLENLDKICVKLGKSRQQVERWLDELGNYKII 610
           I S EN DKICV LGKS+Q+VE +L ELG +K+I
Sbjct: 584 IRSAENFDKICVLLGKSKQEVENYLSELGEFKVI 617

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  525 bits (1353), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 319/632 (50%), Positives = 408/632 (64%), Gaps = 50/632 (7%)

Query: 9   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 68
           L++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL N  INF+TIKNYIIPK  LC++L+
Sbjct: 2   LSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKLI 61

Query: 69  TFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQ 128
           TFKY  YRIV YP+TIN+P YARNFFSFNFVFVFPY+CETSPYEP+I RLGKMFK+LEEQ
Sbjct: 62  TFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQ 121

Query: 129 SQILSKAENDPIYFKSDYV---PTEPTTTIIPQISPSHRNKRNNDHNDNNDG-----SRF 180
           +Q+LSK+E DP++F    +      P+T   P  S +  N        + D      SR+
Sbjct: 122 NQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSRY 181

Query: 181 ETDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI 240
             D   + E   + FS+QDL+MRI+QDLNNYSECLIPID+GN ++IK+FPLL+ PP   +
Sbjct: 182 -NDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLR-PPTTCV 239

Query: 241 SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY 300
           SLEDVP+S +NL  +IDVNWDPTM+NIVPYI+G+N I+KI+KL+ +DP LVIECI+HL+Y
Sbjct: 240 SLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIY 299

Query: 301 YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQ- 359
           Y CV ++DIFQFSN+YAP+S I +FLTD  MA  CQ YV  P  SK+S LP   N     
Sbjct: 300 YKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGD 359

Query: 360 -----------------PSTP----KHSRTTSLSSSMSGSVNSHEHSYMDTIQKSETSLS 398
                            PS P        +TS  S  S   +S   +Y D  Q S+TS S
Sbjct: 360 LDSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQ-SQTSCS 418

Query: 399 LSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFG 458
            S+   +N       LPT++CLFDLYRSLS G TL++WY+S   II +NN+D+R+FI FG
Sbjct: 419 SSNIHISNNRNRF--LPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFG 476

Query: 459 IIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASP 518
           + + +IYR +SYP+     + G +  +    I A         S   SNS        S 
Sbjct: 477 LEKRIIYRSYSYPVML---SVGPRETKETAPIIAK-------DSPNESNSSEKKYHEHSF 526

Query: 519 SSINVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIE 578
           S I    A  L  N+  K  R SKVSF D +K  S+ T E   P     EER +L +S+ 
Sbjct: 527 SIIRSKNA-VLFNNI--KSGRPSKVSF-DMQKASSLITGESTIPKLSDDEER-ILEESVR 581

Query: 579 SLENLDKICVKLGKSRQQVERWLDELGNYKII 610
           S EN DKICV LGK + +VE +L+ELG +KII
Sbjct: 582 SAENFDKICVLLGKPKLEVENYLNELGEFKII 613

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  520 bits (1340), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 291/614 (47%), Positives = 394/614 (64%), Gaps = 93/614 (15%)

Query: 11  HFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTF 70
            FEGF PIHTIF+SIFHPTEG+KVCY+FPP+NL  ++INFD+IKN++IPK QLC+RLLT 
Sbjct: 4   QFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRLLTL 63

Query: 71  KYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQSQ 130
           +Y+NYR+VSYP+ +++  YARNFFSFNFVF+F Y+C+T PYEP+I RLGKMFK LEEQSQ
Sbjct: 64  EYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEEQSQ 123

Query: 131 ILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFETDFFGEEED 190
           ILSK++    +FK                                          GE+ D
Sbjct: 124 ILSKSQRTSAFFKD-----------------------------------------GEDVD 142

Query: 191 GV-TKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSL 249
            V TKFS+QDL+MR+YQDLNNYSECLIPID+GN+INIK+FP+LKPP +  IS+EDVP+S+
Sbjct: 143 FVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSI 202

Query: 250 INLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 309
           +NL+ ++D+NWDPTML+I+P+I+GVN I+ I+ L+ +DP LVIECIKHL+YYNCVIITDI
Sbjct: 203 VNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDI 262

Query: 310 FQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQPSTPKHSRTT 369
           FQFSN+YAP+SLI +FL D  +A  CQ+YVVLP GSK++ LP  +  + + +    ++  
Sbjct: 263 FQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSDMTQKA 322

Query: 370 -------------SLSSSMSGSVNSHEHSYMDTIQKSETSLSLSSTDPNNPHFELAHLPT 416
                          S+    S  +H H       +S ++LS S    +NP  +   LP+
Sbjct: 323 LSSSRSSFSSYFSHKSAYARVSETAHHH-------QSTSTLSSSEGQQDNPR-QGQVLPS 374

Query: 417 KACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRP 476
           K  LFDLYRSL+YG T+ +WY+ N + I EN++DVRKFIKFG+I  +IYR H YPI +  
Sbjct: 375 KCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIMEHK 434

Query: 477 SNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKNVYKK 536
           + +     +R ND                           S S I  D  D +L ++Y K
Sbjct: 435 TFKSPLLSDRQND-----------------------KIVLSTSDIKFDVGDRILNSIYNK 471

Query: 537 LERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQ 596
           L   SKV+F   +K ES    + G    + + E+++L  ++E  E+ D+IC KLGKS+ +
Sbjct: 472 L---SKVTFDRDKKLES----KIGNSRNLGESEKNILFNALERHESFDRICSKLGKSKNE 524

Query: 597 VERWLDELGNYKII 610
           VE  + E+G Y  I
Sbjct: 525 VESIISEIGEYMTI 538

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  526 bits (1355), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 312/710 (43%), Positives = 422/710 (59%), Gaps = 113/710 (15%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           +HF+GF+PIHT+FYS+FHPTEGTKV Y+FPP NL N  INFDTIKNY+IPK QLCN+LLT
Sbjct: 3   SHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKLLT 62

Query: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129
           FKY  YR+  YP+ +NA YYARN F+FNFVFVFPY C TSPYEP++ARLGKMF++LEEQS
Sbjct: 63  FKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEEQS 122

Query: 130 QILSKAENDPIYFKSDYVPTEPTTTIIP-QISPSHRNKRN------NDHNDNNDGSRFET 182
           QILSKAENDP+YF      +   ++  P     S R K        N+  D+ +  + E 
Sbjct: 123 QILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKIEG 182

Query: 183 ---------DFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLK 233
                    +   + E G  + S++DLI ++YQDLNNYSEC IPID GN ++IK+FPLL 
Sbjct: 183 QGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPLL- 241

Query: 234 PPPNHLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIE 293
            PPN  +S EDVP+S +NL  +IDVNWDPTML IVP+INGVN I+KIAK + +D  LVIE
Sbjct: 242 APPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVIE 301

Query: 294 CIKHLVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVV--------LPIGS 345
           C+KHL+YYNCV++ DIFQFSN+YA TSLI  FLTD  +A++CQ YV         LP  S
Sbjct: 302 CVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRLPFES 361

Query: 346 KLSHLPFENNGNKQPSTPKHS--------RTTSLS--SSMSGSVNS----HEHSYMDTIQ 391
           + + L   ++  +  S+  H+        RT SL   S +S   N+       S M    
Sbjct: 362 RPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLMRVRD 421

Query: 392 KSETSLSLSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDV 451
           +S  S + S+ D          LPTK+CLFDLYRSL  G T++ WY+ N  II +N++DV
Sbjct: 422 RSGQSTTGSAVDEQESRL---LLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDV 478

Query: 452 RKFIKFGIIRGLIYRCHSYPIPQR-PSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGS 510
           R+FI FGI+RGLIYRC++YP+ +   + E ++ ++  +D  + R +++       +N+  
Sbjct: 479 RRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNVF 538

Query: 511 GSGS---------SASPSSI-------NVDGADELLKNVYKKL----------------- 537
            +             +P+ I       NVD A+E+LK+ YKKL                 
Sbjct: 539 STADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLYHVHNPM 598

Query: 538 ------------------------------ERHSKVSFMDKEKNESMKTDEKGRP----S 563
                                         E  SKV+F        ++ DEK       S
Sbjct: 599 SRLYGHDSGESSTKGSRKGSRKGSSSTMESETRSKVAFEKGRSPWQVEEDEKKERTEEVS 658

Query: 564 TMTKEERS---VLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKII 610
            + KE+R    +LLKS++S++  DKIC++L K R++VE+ L E+G+Y II
Sbjct: 659 NLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNII 708

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  521 bits (1341), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 310/634 (48%), Positives = 418/634 (65%), Gaps = 54/634 (8%)

Query: 9   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 68
           L++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL N  INF+T KNYIIPK  LC++L+
Sbjct: 2   LSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKLI 61

Query: 69  TFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQ 128
           TFKY  YRIV YP+TIN+P YARNFFSFNFVFVFPY+CETSPYEP+I RLGKMFK+LEEQ
Sbjct: 62  TFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQ 121

Query: 129 SQILSKAENDPIYFKSDYVPTEPTT--TIIPQISPSHRNKRNNDH----NDNND--GSRF 180
           +Q+LSK+E DP++F    +    TT  T  P  +P+  +     H     D  D   SR+
Sbjct: 122 NQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSRY 181

Query: 181 ETDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI 240
            +D   +     + FS+QDL+MRI+QDLNNYSECLIPID+GN ++IK+FPLL+ PP   +
Sbjct: 182 -SDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLR-PPTTCV 239

Query: 241 SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY 300
           SLEDVP+S +NL  +IDVNWDPTM++IVPYI+G+N I+KI+KL+ +DP LVIECI+HL+Y
Sbjct: 240 SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIY 299

Query: 301 YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE---NNGN 357
           Y CV ++DIFQFSN+YAP+SLI +FLTD  MA+ CQ+YV  P  SK+S+LP      +G+
Sbjct: 300 YKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGD 359

Query: 358 KQ---------------PSTPKHSRTTSLSSSMSGSVNSHEHS----YMDTIQKSETSLS 398
           +                PS P    T+  S+S     +S   S    Y D  Q S+TS S
Sbjct: 360 QDSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQ-SQTSCS 418

Query: 399 LSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFG 458
            S+    N       LPT++CLFDLYRSLS G TL++WY+S   I+ ENN+D+R+FI FG
Sbjct: 419 SSNIHVINNRNRF--LPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFG 476

Query: 459 IIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSG--SGSGSSA 516
           + + +IYRC+S+P+     N G +  + +  I    L         R+++   S +GS  
Sbjct: 477 LEKRIIYRCYSFPV---MINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSATGSRN 533

Query: 517 SPSSINVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKS 576
           +  S N+            K ER SKVSF + ++  S+ T +   P  ++ EE  +L +S
Sbjct: 534 TAQSGNL------------KPERPSKVSF-EMQRVSSLATGKSTMPK-LSDEEEGILEES 579

Query: 577 IESLENLDKICVKLGKSRQQVERWLDELGNYKII 610
           I + E  DKICV L K + +VE +L+ELG +K+I
Sbjct: 580 IRNAETFDKICVLLSKPKLEVESYLNELGEFKVI 613

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  499 bits (1284), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 312/684 (45%), Positives = 402/684 (58%), Gaps = 92/684 (13%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           N F+GF+PIH IFYS+FHPTEGTKV YEFPP NL    INFD IKNY+IPK QLC++LLT
Sbjct: 3   NSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKLLT 62

Query: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129
            KY NYRIV YPI IN+  YARN FSFN VFVFPYECETSPYEP + RLGKMF  LE Q 
Sbjct: 63  LKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEGQC 122

Query: 130 QILSKAENDPIYF---------KSDYVPTEP--------TTTIIPQISPSHRNKRNNDHN 172
           Q LSK E D  YF           D   TEP         + I+P IS       + +  
Sbjct: 123 QFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTNTQ 182

Query: 173 DNNDGSRFETDFFGEE------EDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINI 226
           D  +    E  F          ++   + S+ D++MR++QDLN+YSEC IPID GN I+I
Sbjct: 183 DKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAIDI 242

Query: 227 KVFPLLKPPPNHLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKA 286
           K+FP L PP +  IS+EDVP+  +NLN +IDVNWDPTML IVPYI+G+N I KIA L+ +
Sbjct: 243 KLFPTLMPPIDS-ISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSNS 301

Query: 287 DPLLVIECIKHLVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSK 346
           D +LVIECI+H VYY CVI++DIFQFSN+YAPTS I  FLTD  +AT+CQ YV  P  S 
Sbjct: 302 DAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDSL 361

Query: 347 LSHLPFENNGNKQPSTPKHSRTTSL------SSSMSGSVNSHEHSYM------------- 387
           LS LPF+    K     K+ R+ S+      SSS+  ++NS   S++             
Sbjct: 362 LSALPFK----KGRKMVKNRRSASIASHFTSSSSLRQNLNSKASSFISDEGHHNDDTAYP 417

Query: 388 --DTIQKSETSLSLSSTDPNNP--HFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATI 443
             D+I ++      S +  NN   H    +LPTK+ LFDLYRSLS GV L  WYQ N   
Sbjct: 418 NHDSIYENRRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNS 477

Query: 444 ITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRSSGSA 503
           I +N +D+R+FI FGII+ +IYRCHSYP+P+  + E   ++  L ++      +++   +
Sbjct: 478 IRDNFIDIRRFIIFGIIKRIIYRCHSYPLPK--NYEAFSKLNDLKNLQNGPKIVKNKSQS 535

Query: 504 ARSNSGSGS----------GSSASPSSINVDGADELLKNVYKKL--------------ER 539
              N  S S           +     +++VD AD +L NVYKKL              + 
Sbjct: 536 YTYNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSINGQGQH 595

Query: 540 HSKVSFMDKEKNESMKTDEKGRPSTM----TKEERSV-------LLKSIESLENLDKICV 588
            SKV+F    KN+S   D  G  + +    TK  R +       LL +++S ENLD IC 
Sbjct: 596 PSKVAF----KNQSYDNDLPGLMNNLGIEATKFSREININDKIYLLDALQSAENLDNICS 651

Query: 589 KLGKSRQQVERWLDELGNYKIITC 612
            L  SR++VE  L+EL  Y+II C
Sbjct: 652 NLELSREEVETLLNELTEYRIINC 675

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  498 bits (1282), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 295/682 (43%), Positives = 404/682 (59%), Gaps = 93/682 (13%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           NHF+GF+PIH+IFYS+FHPTEGTKV ++FPP +L N  I+FDTIKNY+IPK QLCN+LLT
Sbjct: 3   NHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKLLT 62

Query: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129
           FKY +YR+V YP+ INA YYARN FSF+FVFVFPY+  TSPYEP+I RLGKMF++LEEQS
Sbjct: 63  FKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEEQS 122

Query: 130 QILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFETDFFGEEE 189
           Q+LSK E DPIY+   ++ T+    +    +      +NN  N N+   R   +   E+ 
Sbjct: 123 QVLSKIERDPIYY---HLKTQDVKAV--DQNSEEPESKNNPQNCNDKIRRGHHEHAFEKY 177

Query: 190 DGVTK--------FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLIS 241
             + K         S++DLI ++Y+DLNNYSECLIP+D GN I+IK+FPLL  PPN   S
Sbjct: 178 HEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLA-PPNSCFS 236

Query: 242 LEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYY 301
           +EDVP++ +NL + +DVNWDPTM+ IVPYING+N I+KI+K + +D  LV+EC+KHL+YY
Sbjct: 237 VEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYY 296

Query: 302 NCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQPS 361
           +CV++ D+FQFSN+YAPTS +  FLTD  +A +CQ YV+    S+L  LPFE   N   S
Sbjct: 297 DCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHS 356

Query: 362 TPKHSRTTSLSS------------SMSGSVNSHEHSYMDTIQKSETSLSLSSTDP----- 404
               + T +  +            S S +    +    +T   SE S++ SS +      
Sbjct: 357 RNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHE 416

Query: 405 NNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLI 464
           NN       LPT++CLFDLYRSLS G T++ WY+ N  +I +N +DVR+FI FG+ R LI
Sbjct: 417 NNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLI 476

Query: 465 YRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNS-------------GSG 511
           YRC+SYP+ +      I  ++ L   D   L   +  S   +NS             G  
Sbjct: 477 YRCYSYPVAK-----SIGTLDMLKRFDYASLP-NNFMSPKNNNSNNVFSTADICVDFGEP 530

Query: 512 SGSSASPSSINVDGADELLKNVYKKLE-------------RHSKVSF------------- 545
           S     P   N D ADE+L++ YKKL              R  K+S              
Sbjct: 531 SQFRKKPLVPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKL 590

Query: 546 --------------MDKEKNESMKTDEKGRPSTMTKEERS---VLLKSIESLENLDKICV 588
                          D+  N+  +  ++   ST  K +R    +LLKSI+++++ DKI +
Sbjct: 591 SSSTSGTAKVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAI 650

Query: 589 KLGKSRQQVERWLDELGNYKII 610
           KL  ++Q+VE  L   G Y II
Sbjct: 651 KLEINKQEVEELLKATGEYNII 672

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  494 bits (1273), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 300/703 (42%), Positives = 408/703 (58%), Gaps = 116/703 (16%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
            HF+GF+P+H I Y+IFHPTEGTKV ++FPP  L    I FDTIKNY+IPK QLCN+LLT
Sbjct: 3   GHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKLLT 62

Query: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129
           FKY ++R+V YP+ + APYYARN FSF+FVFVFPY+C TSPYE +IARLGKMF +LEEQS
Sbjct: 63  FKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEEQS 122

Query: 130 QILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHND------NNDGSRFETD 183
           QILSKAEN  +YF+           +  + S  H N+   + N+      NN+ S+ E+ 
Sbjct: 123 QILSKAENSHVYFQ-----------LKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESH 171

Query: 184 FFGEEE--------DGVTK-FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKP 234
            +  E+        +G  K  SV+DLI +IY+DLNNYSECLIPID GN ++IK+FPLL P
Sbjct: 172 GYAFEKYHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSP 231

Query: 235 PPNHLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIEC 294
           P + L S EDVPM  +NL  +IDVNWDPTML IVPYING N I+K+AKL+ +D  LV+EC
Sbjct: 232 PSSCL-SFEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVEC 290

Query: 295 IKHLVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE- 353
           I+HL+YYNCVI+ DIFQF N+YAPTS +  FLT+  +AT+CQ YV L   + +S LPFE 
Sbjct: 291 IRHLLYYNCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFER 350

Query: 354 ------------NNGNKQPSTPKHSRTTSLSSS-------MSGSVNSHEHSYMDTIQ--- 391
                        N +      +  R  S+  S        SG       S+  +IQ   
Sbjct: 351 KPSRTTYNNIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHN 410

Query: 392 KSETSLSLSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDV 451
            S+ SL  S    NN  F      +K+CLFD+YRSLS G T++ WY+++   I    +DV
Sbjct: 411 VSDASLGNSEGGFNNKVF----FTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDV 466

Query: 452 RKFIKFGIIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSG 511
           R+FI FG+I GL+YRC+S+PI +      + +   L+D D+       SG++  +N+   
Sbjct: 467 RRFITFGVIHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLS 526

Query: 512 S-----GSSASPSSI---------NVDGADELLKNVYKKLE-RHSKVSFMDKEKNESMKT 556
           +     G  +S S +         N D A+++L +VY+KL    +KV    +  N  M+ 
Sbjct: 527 AAEIRIGLESSSSKLRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRM 586

Query: 557 ------DEKGRPS-------------------------TMTKEERS-------------- 571
                 D  G  S                         + T E+R               
Sbjct: 587 FGNCSDDSSGETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKRKD 646

Query: 572 --VLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKIITC 612
             +LLKS+  +EN DKIC +LG+ R++VE+ L++LG Y ++ C
Sbjct: 647 ELLLLKSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVHC 689

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  489 bits (1260), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 294/669 (43%), Positives = 418/669 (62%), Gaps = 93/669 (13%)

Query: 11  HFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTF 70
            FEGF+ IH+IFYS FHPTEG+KV ++FPP++L N  INFD+IKNY+IPK  LC+RL+TF
Sbjct: 4   QFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRLITF 63

Query: 71  KYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQSQ 130
           KY NYRI  YP+T+N+  YARNFFSFNFVFVFP+ CETSPYEP+I RLGKMF++LE Q+Q
Sbjct: 64  KYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEIQNQ 123

Query: 131 ILSKAENDPIYF--------------KSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNND 176
           ILSK+END I F               S+Y+  +  ++I+         + NN       
Sbjct: 124 ILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNN------- 176

Query: 177 GSRFETDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPP 236
                       +   + F++ DL+MR+YQDLN YSECLIPID GN ++IK+FPLL PP 
Sbjct: 177 -------IISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPT 229

Query: 237 NHLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIK 296
            + IS+E VP+SL+NL  ++DVNWDP ML I+PYING+N+I +I++L+  +  LVIECI+
Sbjct: 230 PY-ISIEHVPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIR 288

Query: 297 HLVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNG 356
           HLVYY C+++TDIF+FSNVYAPTS +  FL D  MAT+CQ+YV+LPI SK++ L    + 
Sbjct: 289 HLVYYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHH 348

Query: 357 NKQPS------TPKHSRTTSLSS---------SMSGSVNSHEHSYMDTIQKSETSLSLSS 401
            K  +      +  +S +TSL S         S S SV+  + ++    ++SE+  S+S+
Sbjct: 349 GKHSAFNGDIGSRNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSES--SIST 406

Query: 402 TDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIR 461
            + NN      HLPT++ LFDLYRSLS G+TL+ WY  N  II +N +DVR+FI FG++R
Sbjct: 407 GNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLR 466

Query: 462 GLIYRCHSYPIPQRPSNEGIQRIERLNDID---------------------------AHR 494
            +IYRC +Y +    S + +Q + +LN+++                           A++
Sbjct: 467 RIIYRCETYSVIN--STDHLQNLWKLNELENPISMENISKLQSNHIDSLAADEALMNAYK 524

Query: 495 ---LQIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKNVYKKLERHSKVSF--MDKE 549
              L++ S G A +S++ S S  S +P+      A E+  +  K+ +R SKVSF  + ++
Sbjct: 525 KLSLKVPSKG-ALKSHNTSHSSFSLTPT------APEMENSQAKRNKRLSKVSFEALPED 577

Query: 550 KN-----ESMKTD-EKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERWLDE 603
           +N      ++KT  ++     ++K +R ++LK++   E LDKICV L   RQ V   L E
Sbjct: 578 RNGFRWGSNIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHE 637

Query: 604 LGNYKIITC 612
           LG  K+I C
Sbjct: 638 LGELKLINC 646

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  485 bits (1249), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 297/666 (44%), Positives = 399/666 (59%), Gaps = 79/666 (11%)

Query: 12  FEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTFK 71
           F+GF+PIHT+FY++FHPTEG+KV ++FPP +L N  I+FDTIKNYIIPK QLCN+LLTFK
Sbjct: 5   FDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKLLTFK 64

Query: 72  YENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQSQI 131
           Y  YRIV YP+ +NA YYARN F+FNFVFVFPY+C TSPYEP+IARLGKMFK+LEEQSQI
Sbjct: 65  YGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEEQSQI 124

Query: 132 LSKAENDPIYF--KSDYVPTEPTTTIIPQISPSHRNKRNNDHND----NNDGSRFETDFF 185
           LSK+E +P+YF  KS+       +T +  I+ S       +H D     +DG ++  +  
Sbjct: 125 LSKSEQNPVYFQLKSNDSNAADQSTEMGSITIS-------EHTDIKSTGDDGEKY-LEII 176

Query: 186 GEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDV 245
            E         ++DL+M+++ DLNNYSECLIPID+GN I+IK+FP+  PP ++ IS+EDV
Sbjct: 177 KELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSN-ISVEDV 235

Query: 246 PMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVI 305
           P++++NL+++IDVNWDPTM+ IVPYING+N +++IA   ++D  LV ECIKHL+YYNCVI
Sbjct: 236 PIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVI 295

Query: 306 ITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKL--SHLPFEN-------NG 356
           ++DIFQFSN+YAPTS I +FLT+  +A  CQ +V    G  L  S LPFE         G
Sbjct: 296 LSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQ---GDSLKQSLLPFEGRPNNIYPTG 352

Query: 357 NKQPSTPK-HSRTT-SLSSSMSGSVNSHEHSYMDTIQKSETSLSLSSTDPNNPHFELAH- 413
            KQ ST   HSR   S  ++ +GS +S   ++ + +  S TS    +    N        
Sbjct: 353 RKQASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAHASENTSLATGEN 412

Query: 414 -----LPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCH 468
                LPT++CLFDLY+SLS G T++ WY+ N  II +N +DVRK I FGI R LIYR +
Sbjct: 413 QMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVN 472

Query: 469 SYPIPQRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINVDGADE 528
           SYPI +      I +     +   H     S    + ++            S  +D ADE
Sbjct: 473 SYPIVKNVGTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQSDKLDAADE 532

Query: 529 LLKNVYKKLE------------------------------------RHSKVSFMDKEKNE 552
           LLK++Y+KL                                      H KVSF      +
Sbjct: 533 LLKSLYQKLSLKQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGSHQKVSFDFGTAGQ 592

Query: 553 SMKTDE--------KGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERWLDEL 604
                E        K       KEE  +LL+S+ + E  DK+C KL KSR +VE  L +L
Sbjct: 593 QKTVTEVPDLGDGEKVEVWKKKKEEELILLESLSNAETFDKVCTKLKKSRHEVELLLKDL 652

Query: 605 GNYKII 610
           G+Y I+
Sbjct: 653 GHYNIV 658

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  483 bits (1242), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/673 (40%), Positives = 392/673 (58%), Gaps = 76/673 (11%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           N F+GF+PIH IFY++FHPTEGTKV ++FP  +L    I FDTIKNY+IPK+QLCN+L+T
Sbjct: 10  NKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKLVT 69

Query: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129
           FK+ +YR+V YP+ I APYYARN FSFN VFVFPY+  TSPYEP+IARL KM ++LEEQS
Sbjct: 70  FKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEEQS 129

Query: 130 QILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFETDFFGEEE 189
           Q+LSK E DP+Y++   + T  T     +   S    + ++ +  +      T  + E  
Sbjct: 130 QMLSKVERDPVYYQ---LKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHEIM 186

Query: 190 DGVTK----FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDV 245
             +        ++DLI ++Y+DLNNYSECLIP+D GN I+IK+FPLL  PPN  +S EDV
Sbjct: 187 KHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLT-PPNSCLSFEDV 245

Query: 246 PMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVI 305
           P++ +NL N++DVNWDPTML IVP+ING+N I+KI+K + +   LV+ECIKHLVYY+CV 
Sbjct: 246 PIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVA 305

Query: 306 ITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE---NNGNKQPST 362
           + D+FQFSN+YAPT+L+  FL D  +  +CQ YVV     ++  LPFE   N G+ +  T
Sbjct: 306 LVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRNQT 365

Query: 363 PKHSRTTSLSSSMSGSVNSHEHSYMDTIQKSE--TSLSLSSTDPNNPHFE---------- 410
              +   +L  + S +      S  +  QKS   +SL+ S T  N  ++           
Sbjct: 366 ASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRNLESNC 425

Query: 411 LAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSY 470
              LPT+  LFDLYRSL+ G TL+ WY++N + I EN +DVR+ I FG+   LIYRC+SY
Sbjct: 426 KRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRCYSY 485

Query: 471 PIPQRPSN-EGIQRIERLNDIDAHRLQIRSSGSAARSNS-------GSGSGSSASPSSIN 522
           P+ +     E ++R + ++  D       S+G+   S S       GS    +  P   +
Sbjct: 486 PVAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRVDFDGSSRSRNIPPFLNS 545

Query: 523 VDGADELLKNVYKKLE-------------------RHSKVSFMDKEKNESMKT------- 556
            D A+E+L+  Y+KL                      ++ +     + +SM T       
Sbjct: 546 SDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNTTRIT 605

Query: 557 -DEKGRPSTMTKEERS------------------VLLKSIESLENLDKICVKLGKSRQQV 597
            D + R  +   E R                   +LL+S++S+++ DKI V+L  ++ +V
Sbjct: 606 FDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEV 665

Query: 598 ERWLDELGNYKII 610
           ER L   G Y I+
Sbjct: 666 ERLLKGTGEYNIV 678

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  476 bits (1226), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 294/692 (42%), Positives = 392/692 (56%), Gaps = 97/692 (14%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
            HF+GF+P+H IFYS+FHPTEGTKV ++FP   L    I FDTIKNY+IPK QLCN+LLT
Sbjct: 3   GHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKLLT 62

Query: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129
           FKY  +R+V YP+ + APYYARN FSF+FVFVFPY+C TSPYEP+I RLGKMF +LEEQS
Sbjct: 63  FKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEEQS 122

Query: 130 QILSKAENDPIYFKSDYVPTEP---TTTIIPQISPSHRNKRNNDHNDNND-GSRFETDFF 185
           QILSKAEN  +YF+     T+    T T      PS  +       +N    S    +  
Sbjct: 123 QILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYEIL 182

Query: 186 GEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDV 245
            + E    K ++ DLI +IY+DLN+YSECLIPID GN ++IK+FPLL PP +   S+EDV
Sbjct: 183 KDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSS-CFSIEDV 241

Query: 246 PMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVI 305
           P+S +NL  +IDVNWDPTML IVP+ING+N I+K+AK + +D  LV+ECIKHL+YYNCVI
Sbjct: 242 PISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCVI 301

Query: 306 ITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE------NNGN-- 357
           +TDIFQFSN+YA T+ +  FLT+  +A +CQ YV     + L +LPFE        GN  
Sbjct: 302 LTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNIR 361

Query: 358 ------------KQPSTPKHSRTTSLSSSMSGSVNSHEH---SYMDTIQKSETSLSLSST 402
                       K   TP   R  S +S M    N H+H   S   +I    TS +    
Sbjct: 362 DRSSNGTLDILRKGKQTPL--RENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGN 419

Query: 403 DPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRG 462
                  +L    +K+CLFDLYRSL+ G T+R WY+++   I    +DVR+FI FG++ G
Sbjct: 420 SDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHG 479

Query: 463 LIYRCHSYPIPQRPSNEGI-QRIERLNDIDAHRLQ-----------IRSSGSAAR----- 505
           LIYR +SYP+ +   N G  + +E L   +  R             + +  SAA      
Sbjct: 480 LIYRSYSYPVLR---NIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGL 536

Query: 506 SNSGSGSGSSASPSSINVDGADELLKNVYKKLE---------------------RHS--- 541
            N+G  + S         D A+E+L +VY+KL                      R+S   
Sbjct: 537 ENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDS 596

Query: 542 ------------------KVSFMDKEKNESMKTDEKGRPSTM-----TKEERSVLLKSIE 578
                             KV+F  ++   +   DE+ R   +      + E  +LLKS+ 
Sbjct: 597 TDISTRESANSMGSDIKNKVAFDVRKTLATSSADERRRSEILRSIEEKRNEELILLKSVR 656

Query: 579 SLENLDKICVKLGKSRQQVERWLDELGNYKII 610
           S+ N DKIC  LGK R++VE  L ELG Y ++
Sbjct: 657 SVHNFDKICTLLGKDRERVESMLSELGPYNVL 688

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  456 bits (1172), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 253/480 (52%), Positives = 332/480 (69%), Gaps = 18/480 (3%)

Query: 9   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 68
           ++HFEGF+PIHT+FYSIFHPTEGTKV YEFPP NL  ++INFDTIKNYIIPK QLC++LL
Sbjct: 2   IDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKLL 61

Query: 69  TFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQ 128
           T KY +YR+VSYP+TIN+  YARNFFSFNFVFVFP  CETSPYEP IARLGKMF++LEEQ
Sbjct: 62  TLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEEQ 121

Query: 129 SQILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFE---TDF- 184
           +Q+LS+AEND +YF + +     +     Q S  H++K  +    +     F    TD  
Sbjct: 122 NQLLSRAENDSVYFDNSH-----SLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLS 176

Query: 185 ---FGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLIS 241
              + + E G + FSVQDLIMRI+QDLNNYSECLIPID+GN ++IK+FP +  PP+  IS
Sbjct: 177 LSEYPDNESG-SNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMV-PPSISIS 234

Query: 242 LEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYY 301
            EDVP+++++L++V+DVNWDPTML IVP+I+ +N IS+IA L+ +D   V+ECI+HLVYY
Sbjct: 235 YEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYY 294

Query: 302 NCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQPS 361
             VI++DIFQF+N+YAPTS +  FLTD  +AT CQ YV LP  S    LP E + N    
Sbjct: 295 QLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINTDLD 354

Query: 362 TPKHSRTTSLSSSMSGSVNSHEHSYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACLF 421
              +S +    ++     +      M    ++  S   S     N      +LPTK+CLF
Sbjct: 355 EYSNSGSAIYPNNEILENDDRLRWPMYYKPRNSQSSLSSGISSGNERTS-NYLPTKSCLF 413

Query: 422 DLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEGI 481
           DLYRSLS G  L  WY  + ++I  N +D+R+FI FG++RGL+YRC++ PI +   N GI
Sbjct: 414 DLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPIMK---NAGI 470

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%)

Query: 570 RSVLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKIITC 612
           R +LL+S+   +N+DKIC+KL K R++VE  L E+G+Y II C
Sbjct: 668 RRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIINC 710

>ZYRO0B10362g Chr2 complement(812053..818526) [6474 bp, 2157 aa] {ON}
            some similarities with uniprot|P08678 Saccharomyces
            cerevisiae YJL005W CYR1 Adenylate cyclase required for
            cAMP production and cAMP-dependent protein kinase
            signaling involved in cell cycle control and glucose and
            nitrogen repression of sporulation
          Length = 2157

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+ V+DV+      +++P+I+   DIS + +LTKAD +LVI   K   Y +     DI +
Sbjct: 1672 LDGVVDVSRAVGFFDLLPHIHASPDIS-MVQLTKADEMLVIATHKLWQYMDFETACDIAR 1730

Query: 312  FSNVYAPTSLICSFLTDQEMATQCQNYVVL 341
              N   P  L    + D  +A  C + + +
Sbjct: 1731 -ENSSQPM-LAAEAMKDHAIAYGCSDNLTI 1758

>Suva_12.76 Chr12 (107539..113613) [6075 bp, 2024 aa] {ON} YJL005W
            (REAL)
          Length = 2024

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 4/94 (4%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+ V+DV+      +++P+I+   DIS +  LTKAD +L++   K   Y +   + DI +
Sbjct: 1531 LDGVVDVSRAVGFFDLLPHIHASPDIS-VVTLTKADEMLIVATHKLWEYMDVDTVCDIAR 1589

Query: 312  FSNVYAPTSLICSFLTDQEMATQC-QNYVVLPIG 344
              N   P       L D  MA  C +N  +L + 
Sbjct: 1590 -ENSTDPLRAAAE-LKDHAMAYGCTENITILCLA 1621

>Skud_10.218 Chr10 (392657..398734) [6078 bp, 2025 aa] {ON} YJL005W
            (REAL)
          Length = 2025

 Score = 38.5 bits (88), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 4/94 (4%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+ V+DV+      +++P+I+   DIS +  LTKAD +L++   K   Y +   + DI +
Sbjct: 1532 LDGVVDVSRAVGFFDLLPHIHASPDIS-VVTLTKADEMLIVATHKLWEYMDVDTVCDIAR 1590

Query: 312  FSNVYAPTSLICSFLTDQEMATQC-QNYVVLPIG 344
              N   P       L D  MA  C +N  +L + 
Sbjct: 1591 -ENSTDPLRAAAE-LKDHAMAYGCTENITILCLA 1622

>YJL005W Chr10 (425157..431237) [6081 bp, 2026 aa] {ON}  CYR1Adenylate
            cyclase, required for cAMP production and cAMP-dependent
            protein kinase signaling; the cAMP pathway controls a
            variety of cellular processes, including metabolism, cell
            cycle, stress response, stationary phase, and sporulation
          Length = 2026

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 4/94 (4%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+ V+DV+      +++P+I+   DIS +  LTKAD +L++   K   Y +   + DI +
Sbjct: 1533 LDGVVDVSRAVGFFDLLPHIHASPDIS-VVTLTKADEMLIVATHKLWEYMDVDTVCDIAR 1591

Query: 312  FSNVYAPTSLICSFLTDQEMATQC-QNYVVLPIG 344
              N   P       L D  MA  C +N  +L + 
Sbjct: 1592 -ENSTDPLRAAAE-LKDHAMAYGCTENITILCLA 1623

>Smik_10.274 Chr10 (422245..428346) [6102 bp, 2033 aa] {ON} YJL005W
            (REAL)
          Length = 2033

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+ V+DV+      +++P+I+   D+S +  LTKAD +L++   K   + +   + DI +
Sbjct: 1540 LDGVVDVSRAVGFFDLLPHIHASPDVS-VVTLTKADEMLIVATHKLWEFMDVDTVCDIAR 1598

Query: 312  FSNVYAPTSLICSFLTDQEMATQC-QNYVVL 341
              N   P       L D  MA  C +N  +L
Sbjct: 1599 -ENSTDPLRAAAE-LKDHAMAYGCTENITIL 1627

>CAGL0D03168g Chr4 complement(324192..330440) [6249 bp, 2082 aa] {ON}
            similar to uniprot|P08678 Saccharomyces cerevisiae
            YJL005w CYR1 adenylate cyclase
          Length = 2082

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+ V+DV+      +++P+I+   DIS I  +TKAD +L+I   K   Y +     DI +
Sbjct: 1588 LDGVVDVSRAVGFFDLLPHIHASPDISVI-NVTKADEMLIIGTHKLWEYMDIETACDIAR 1646

Query: 312  FSNVYAPTSLICSFLTDQEMATQC-QNYVVLPIG 344
              +V  P  L    L D  +A  C +N  +L + 
Sbjct: 1647 -EHVLEPM-LAAEELKDHAIAYGCSENITILCLA 1678

>TPHA0D04030 Chr4 (850344..858032) [7689 bp, 2562 aa] {ON} Anc_3.443
            YPR117W
          Length = 2562

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 4/59 (6%)

Query: 11   HFEGFMPIHTIFYSIFHPTEGTKVCYE----FPPKNLSNFHINFDTIKNYIIPKNQLCN 65
            H+   MP+  IF+ +  P  G  V  E    F P      HI  D + NY+ PKN+  +
Sbjct: 2273 HYTKDMPMLEIFWLLSSPVGGISVLEEMIVSFQPIIFRMDHITADKLMNYLFPKNETAD 2331

>Kpol_534.51 s534 (129416..135307) [5892 bp, 1963 aa] {ON}
            (129416..135307) [5892 nt, 1964 aa]
          Length = 1963

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 309
            L+  +DV+      +++P+I+   DIS + KLTKAD +LVI   K   Y +     DI
Sbjct: 1468 LDGGVDVSRAVGFFHLLPHIHASPDIS-VVKLTKADEILVIATHKLWEYMDYETACDI 1524

>TDEL0E04230 Chr5 complement(789369..795041) [5673 bp, 1890 aa] {ON}
            Anc_5.206 YJL005W
          Length = 1890

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 309
            L+ V+DV+      +++P+I+   DIS +  LTKAD +L++   K   Y +     DI
Sbjct: 1398 LDGVVDVSRAVGFFDLLPHIHASPDIS-LVTLTKADEMLIVATHKLWEYMDFETACDI 1454

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 22/36 (61%)

Query: 58  IPKNQLCNRLLTFKYENYRIVSYPITINAPYYARNF 93
           +PK+++ N L +  +EN+R   YP+ I  P+ +  F
Sbjct: 77  VPKDKIPNDLCSICFENFREDEYPLVIELPHCSHKF 112

>TBLA0C03630 Chr3 (860550..867713) [7164 bp, 2387 aa] {ON} Anc_5.206
            YJL005W
          Length = 2387

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+  +DV+      +++P+I+   DIS +  LTK+D +LVI   K   Y N     DI +
Sbjct: 1897 LDGSVDVSRAVGFFDLLPHIHASPDISMVT-LTKSDQMLVIATHKLWEYVNYETACDIAR 1955

Query: 312  FSNVYAPTSLICSFLTDQEMATQCQNYVVL 341
              +  +   L    L D  +A  C + + +
Sbjct: 1956 EKS--SDPMLAAEELKDHAIAYGCSDNITI 1983

>Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {ON}
           complement(64627..67593) [2967 nt, 989 aa]
          Length = 988

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 181 ETDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI 240
           E  FF      VT  S+Q  + ++ Q+L+ +   L PI+K   +NI+ +P L   P  + 
Sbjct: 751 EVQFF------VTTDSIQQ-VAKVKQELDTFVGSLSPIEKNGGVNIESYPKLAQKPGVMS 803

Query: 241 SLEDVPMSL 249
           +L + P  +
Sbjct: 804 TLINFPFQV 812

>KNAG0J02400 Chr10 complement(455506..457809) [2304 bp, 767 aa] {ON}
           Anc_3.318 YBL032W
          Length = 767

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 85/210 (40%), Gaps = 31/210 (14%)

Query: 343 IGSKLSHLPFENN----GNKQPSTPKHSRTTSLSSSMSGSVNSHEHSYMDTIQKSETSLS 398
            GSK + LP + +    G +Q      S+ +  S+  S    + EHS  DT  KS+ SL 
Sbjct: 493 TGSKSNALPGQKDKASTGKEQSVNDTRSKLSRSSAQKSKVDATREHSDKDTGSKSDASLG 552

Query: 399 LSSTD-------PNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDV 451
               +        N+   +L   P + C  D  R      T     +SNA+ + +   D 
Sbjct: 553 QKDKERAGKGQSGNDSRSKLNSSPGQKCKADAMRGQPNNWTR---AKSNASQLQKGKTDA 609

Query: 452 RKFIKFGIIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSG 511
           +K      IR    + +S P+      +G   +++    +  R Q+RS  + + S  G G
Sbjct: 610 KKEQFRNHIR---SKSNSSPL-----QKGKADVKK----EQSRNQVRSKSNTSSSQRGKG 657

Query: 512 SGSSASPSS-----INVDGADELLKNVYKK 536
             +   P++      N D +D+   +V K+
Sbjct: 658 GTTKEQPANETGPESNTDLSDKGKADVTKQ 687

>KLLA0C01969g Chr3 (157410..160460) [3051 bp, 1016 aa] {ON} similar
           to Saccharomyces cerevisiae YLR187W SKG3 Protein of
           unknown function; green fluorescent protein (GFP)-fusion
           protein localizes to the cell periphery, cytoplasm, bud,
           and bud neck; potential Cdc28p substrate and to YNL278W
           uniprot|P53836 Saccharomyces cerevisiae YNL278W CAF120
           Part of the evolutionarily-conserved CCR4- NOT
           transcriptional regulatory complex involved in
           controlling mRNA initiation, elongation, and degradation
          Length = 1016

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 476 PSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKNVYK 535
           P ++G    +R    D+    I+ + SA    +GS +      S++N  G+D++L++ Y+
Sbjct: 642 PYSQGGNDFDR--SFDSQNSLIKDASSAYNEYTGSPTIKKFDISNVNATGSDDVLEDFYQ 699

Query: 536 KLERHSKVSFMDKEKNESMKTDE 558
             ++ S +S +DK +  + K+D+
Sbjct: 700 LSKQISSLSVVDKPRTANEKSDD 722

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 4/100 (4%)

Query: 512 SGSSASPSSINVDGADELLKNVYKKLERHSKVSF---MDKEKNESMKTDEKGRPSTMTKE 568
           S S    S    +  DELLK +  K E  +K+      +K  N  +K D K   S     
Sbjct: 463 STSENPKSKTETNEHDELLKKLMDKCEDVAKLQVEIEAEKNTNSKLKQDLKYSASKQHAL 522

Query: 569 ERSVLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYK 608
           E ++ LK +E L+N +K C +L  S ++++R L    N K
Sbjct: 523 E-TMNLKLLEQLQNQEKECKELLISEERLKRELASAENLK 561

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,863,332
Number of extensions: 3671065
Number of successful extensions: 27066
Number of sequences better than 10.0: 160
Number of HSP's gapped: 27826
Number of HSP's successfully gapped: 170
Length of query: 612
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 496
Effective length of database: 40,180,143
Effective search space: 19929350928
Effective search space used: 19929350928
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)