Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H008706.17ON61261226060.0
ZYRO0C07876g6.17ON68166813670.0
TDEL0G045206.17ON67968713521e-179
KNAG0M011406.17ON59462113351e-178
Skud_5.276.17ON61562913351e-177
KAFR0L003806.17ON54061013211e-176
YEL062W (NPR2)6.17ON61563212861e-170
Smik_5.256.17ON61563512851e-170
Ecym_30216.17ON67467612051e-157
CAGL0L13288g6.17ON64666111911e-155
Kwal_56.224116.17ON68970011781e-153
KLLA0D01067g6.17ON66066211721e-152
KLTH0C11308g6.17ON69069411511e-149
TBLA0G010106.17ON71047411501e-148
ACR009W6.17ON68067011171e-144
NDAI0D008606.17ON66645010401e-132
Suva_5.56.17ON6193589821e-124
Kpol_1045.726.17ON6955008661e-106
SAKL0E01100g6.17ON7105118061e-97
TPHA0J003106.17ON6754737403e-88
ZYRO0B10362g5.206ON215790880.059
Suva_12.765.206ON202491870.076
YJL005W (CYR1)5.206ON202691870.077
Skud_10.2185.206ON202591870.077
Smik_10.2745.206ON203391830.25
CAGL0D03168g5.206ON208290810.40
TDEL0E042305.206ON189058761.8
Kpol_534.515.206ON196358751.9
TPHA0D040303.443ON256259752.0
Kpol_1004.325.541ON98879752.2
TBLA0C036305.206ON238790752.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H00870
         (612 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...  1008   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   531   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   525   e-179
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   518   e-178
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   518   e-177
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   513   e-176
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   499   e-170
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   499   e-170
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   468   e-157
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   463   e-155
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   458   e-153
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   456   e-152
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   447   e-149
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   447   e-148
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   434   e-144
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   405   e-132
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    382   e-124
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   338   e-106
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   315   1e-97
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   289   3e-88
ZYRO0B10362g Chr2 complement(812053..818526) [6474 bp, 2157 aa] ...    39   0.059
Suva_12.76 Chr12 (107539..113613) [6075 bp, 2024 aa] {ON} YJL005...    38   0.076
YJL005W Chr10 (425157..431237) [6081 bp, 2026 aa] {ON}  CYR1Aden...    38   0.077
Skud_10.218 Chr10 (392657..398734) [6078 bp, 2025 aa] {ON} YJL00...    38   0.077
Smik_10.274 Chr10 (422245..428346) [6102 bp, 2033 aa] {ON} YJL00...    37   0.25 
CAGL0D03168g Chr4 complement(324192..330440) [6249 bp, 2082 aa] ...    36   0.40 
TDEL0E04230 Chr5 complement(789369..795041) [5673 bp, 1890 aa] {...    34   1.8  
Kpol_534.51 s534 (129416..135307) [5892 bp, 1963 aa] {ON} (12941...    33   1.9  
TPHA0D04030 Chr4 (850344..858032) [7689 bp, 2562 aa] {ON} Anc_3....    33   2.0  
Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {O...    33   2.2  
TBLA0C03630 Chr3 (860550..867713) [7164 bp, 2387 aa] {ON} Anc_5....    33   2.4  

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score = 1008 bits (2606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/612 (84%), Positives = 518/612 (84%)

Query: 1   MQNSNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPK 60
           MQNSNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPK
Sbjct: 1   MQNSNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPK 60

Query: 61  NQLCNRLLTFKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGK 120
           NQLCNRLLTFKYENYRIVSYPITINAPYYAR           PYECETSPYEPSIARLGK
Sbjct: 61  NQLCNRLLTFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGK 120

Query: 121 MFKILEEQSQILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRX 180
           MFKILEEQSQILSKAENDPIYFKSDYV              S              GSR 
Sbjct: 121 MFKILEEQSQILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRF 180

Query: 181 XXXXXXXXXXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI 240
                      VTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI
Sbjct: 181 ETDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI 240

Query: 241 SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY 300
           SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY
Sbjct: 241 SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY 300

Query: 301 YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQP 360
           YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQP
Sbjct: 301 YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQP 360

Query: 361 STPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACL 420
           STPK                     YMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACL
Sbjct: 361 STPKHSRTTSLSSSMSGSVNSHEHSYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACL 420

Query: 421 FDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEG 480
           FDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEG
Sbjct: 421 FDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEG 480

Query: 481 IQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINVDGADELLKNVYKKLERH 540
           IQRIERLNDIDAHRLQIR                      INVDGADELLKNVYKKLERH
Sbjct: 481 IQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKNVYKKLERH 540

Query: 541 SKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERW 600
           SKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERW
Sbjct: 541 SKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERW 600

Query: 601 LDELGNYKIITC 612
           LDELGNYKIITC
Sbjct: 601 LDELGNYKIITC 612

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/668 (44%), Positives = 381/668 (57%), Gaps = 72/668 (10%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           + FEGF+PIHT+FY++FHPT+GT+V YE+PP NL   +INFD IKNYIIPK QLC++LLT
Sbjct: 17  DQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKLLT 76

Query: 70  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 129
            KY+ YRIV YP+T+N+PYYAR           PY+CETS YEP+IARLGKMF++LEEQ+
Sbjct: 77  LKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEEQN 136

Query: 130 QILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXXX 189
           QILSKAENDPIYF                   S               +           
Sbjct: 137 QILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNEIMKDLESEK- 195

Query: 190 XXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSL 249
              + FSVQDL+MRI+QDLNNYSECLIPID+GN ++IK+FPL K PPN  IS+EDVP+S 
Sbjct: 196 ---SDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPL-KTPPNSCISIEDVPIST 251

Query: 250 INLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 309
           +NL  +IDVNWDPTML IVPYI+G+N ISKIAKL+ +D  LV+EC+KHLVYYNCVI+ DI
Sbjct: 252 VNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILADI 311

Query: 310 FQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE----------NNGNKQ 359
           FQFSN+YAPTSLI  FLTD  +A++CQ++V L   S LS +PFE          +    Q
Sbjct: 312 FQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDDMDQSKNQ 371

Query: 360 PSTPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKAC 419
            S  +                              +  S SST+ N  H    HLPTKAC
Sbjct: 372 ESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFNQRSQSSFSSTNTNVTHDLARHLPTKAC 431

Query: 420 LFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPS-- 477
           LFDLYR+LS GVT+R WY  N   I +N++DVR+FI FG+I+GLIYRC S+P+ ++ S  
Sbjct: 432 LFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPVMKKMSIF 491

Query: 478 --NEGIQRIERLNDI---DAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINVDGADELLKN 532
                +     LN +      +  +                        +VD ADE+L+N
Sbjct: 492 DLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEGSKMHQNFSVDIADEVLRN 551

Query: 533 VYKKL----------------------------------------ERHSKVSF-MDK--- 548
           VYKKL                                        ER SKV+F M+K   
Sbjct: 552 VYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKPERVSKVAFDMNKDDP 611

Query: 549 ------EKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERWLD 602
                 ++    K  E  +       ++ +LL+SI + + LDKICVKL K R +VE  L 
Sbjct: 612 VPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEELLH 671

Query: 603 ELGNYKII 610
           ELG+YKII
Sbjct: 672 ELGDYKII 679

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  525 bits (1352), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 300/687 (43%), Positives = 391/687 (56%), Gaps = 98/687 (14%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           + FEGF+PIHTIFY++FHPTEGTKV YEFPP NL + +INFD IKNYIIPK QLC++LLT
Sbjct: 3   DQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKLLT 62

Query: 70  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 129
            KY+NYRI SYP+T+N+P YAR           PY+C+TSPYEP+IARLGKMFK+LEEQ+
Sbjct: 63  LKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEEQN 122

Query: 130 QILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXXX 189
            ILSKAE DPI++    V                              S           
Sbjct: 123 LILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAY----ASEKYHKIMTDIE 178

Query: 190 XXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSL 249
              + FS++DL++R+YQDLNNYSECLIPID+GN ++IK+FP++ PP N  IS+EDVP+S 
Sbjct: 179 SADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPP-NSNISIEDVPVST 237

Query: 250 INLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 309
           +NLN VIDVNWDPTML IVPYING+N ISKIAKL+ +DP LVIECIKHL+YYNCV++ DI
Sbjct: 238 VNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADI 297

Query: 310 FQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE---------------- 353
           FQFSN+YAPTS + +FLTD  ++T+CQ+YVV    S L  LPF+                
Sbjct: 298 FQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDHELAD 357

Query: 354 ------NNGNKQPSTPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNP 407
                  +G++  S                        Y  T + S++S S ++T+P+N 
Sbjct: 358 SHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYR-TGKHSQSSFSSNNTNPSN- 415

Query: 408 HFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRC 467
                +LPTK+CLFDLYRSLS G +LR WY  +   I  N +DVR+FI FG+I GLIYRC
Sbjct: 416 -MLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRC 474

Query: 468 HSYPIPQRPSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXX---------XXXXXXX 518
           +SYPI +      + +     DI  H ++                               
Sbjct: 475 YSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYERQRNKHH 534

Query: 519 XXINVDGADELLKNVYKKL----------------------------------------- 537
             +N+D ADE+L+NVYKKL                                         
Sbjct: 535 KALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQN 594

Query: 538 -ERHSKVSFMDKEK------------NESMKTDEKGRPSTMTKEERS-VLLKSIESLENL 583
            +R SKVSF DK++            N+ +K DE+ +   + + ER  +LL+S+E+ ++L
Sbjct: 595 SDRPSKVSF-DKQQEIGHISKGMSSSNDKVKMDEEAK---LERRERDLILLESVEAADSL 650

Query: 584 DKICVKLGKSRQQVERWLDELGNYKII 610
           D ICVKL  SR  VE  +  LG YKII
Sbjct: 651 DTICVKLEMSRYDVEALIQNLGEYKII 677

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  518 bits (1335), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 281/621 (45%), Positives = 367/621 (59%), Gaps = 45/621 (7%)

Query: 9   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 68
           ++ FEGF+PIHT+FY+IFHPTEG+KVCY+FPP NL ++ INFD IKNYIIPK QLC+RLL
Sbjct: 2   MSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRLL 61

Query: 69  TFKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQ 128
           T KY NYRIVSYP+ + +  YAR           PYEC TSPYEP+I RLGKMF++LEEQ
Sbjct: 62  TMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEEQ 121

Query: 129 SQILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXX 188
           SQ+LS+AE D   FK D +              +                          
Sbjct: 122 SQVLSRAERDDSLFKGDKLPFD-----------NNSAKNQAPLTHALISKTKSFSPDKKT 170

Query: 189 XXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMS 248
              +   SVQDLIMRIYQDLNNYSECLIPID+GN I+IK+FPL+ PP +  +S+EDVPM 
Sbjct: 171 EGDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPML 230

Query: 249 LINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITD 308
           ++ L  +ID+NWDPTM++I+P+INGVN I  IA+L+ +DP LVIECIKHL+YY CVIITD
Sbjct: 231 VVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITD 290

Query: 309 IFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE-------NNGNKQPS 361
           IFQFSN+YAP+SLI  FLTD  MA  CQ YV LP  S+L H+P +       NN +K+ +
Sbjct: 291 IFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGSRNNKHKKSN 350

Query: 362 TPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSST-DPNNPHFELAHLPTKACL 420
           +                        M   ++SE+SLS   T           + PT+  L
Sbjct: 351 SLSSTGVLSWQSNSQYSNNSSEFYSMSNKKRSESSLSSEGTPGAGRSDDHTIYYPTRMVL 410

Query: 421 FDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEG 480
           FDLYRSLS G+TL  WY +N T I  N +DVRKFI+FG I+ +IYR  SYP+ ++     
Sbjct: 411 FDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLEK----- 465

Query: 481 IQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINVDGADELLKNVYKKLERH 540
                R N I A ++                         I  D  D L  ++Y    R 
Sbjct: 466 -----RRNSIIAKQMG----KSKMAEKAPHSKNAFFSTSDIKFDDGDRLFNSLY---ARF 513

Query: 541 SKVSFMDKEKN--ESMKTDEKGRPST-------MTKEERSVLLKSIESLENLDKICVKLG 591
           SKVSF  + +N  E    D  G  +        +TKEE+  LL ++++LE+ DKICV+LG
Sbjct: 514 SKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNLESFDKICVQLG 573

Query: 592 KSRQQVERWLDELGNYKIITC 612
           +SR ++   + ++G Y++I C
Sbjct: 574 RSRVEIANLIADIGEYRVINC 594

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  518 bits (1335), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 284/629 (45%), Positives = 378/629 (60%), Gaps = 46/629 (7%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           ++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL N  INF+TIKNYIIPK  LC++L+T
Sbjct: 3   SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKLIT 62

Query: 70  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 129
           FKY  YRIV YP+TIN+P YAR           PY+CETSPYEP+I RLGKMFK+LEEQ+
Sbjct: 63  FKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQN 122

Query: 130 QILSKAENDPIYF-----KSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXX 184
           Q+LSK+E D ++F     ++  +              S                R     
Sbjct: 123 QLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSRYN 182

Query: 185 XXXXXXXV--TKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISL 242
                  +  + FS+QDL+MRI+QDLNNYSECLIPID+GN ++IK+FPLL+PP    +SL
Sbjct: 183 DLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP-TTCVSL 241

Query: 243 EDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYN 302
           EDVP+S +NL  +IDVNWDPTM++IVPYI+G+N I+KI+KL+++DP LVIECI+HL+YY 
Sbjct: 242 EDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYYK 301

Query: 303 CVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENN------- 355
           CV ++DIFQFSN+YAP+SLI +FLTDQ MA+ CQ+YV  P  SK+S LP   N       
Sbjct: 302 CVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADRD 361

Query: 356 -----------GNKQPSTPKXXXXXXXXXXXXXXXXXXXXXYMDTIQ---KSETSLSLSS 401
                       +  PS P                      +    +   +S+TSLS S+
Sbjct: 362 SPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQTSLSSSN 421

Query: 402 TDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIR 461
              N+       LPT++CLFDLYRSLS G TL+SWY+S   I+ ENN+DVR+FI FG+ R
Sbjct: 422 LRANDNRNRF--LPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLER 479

Query: 462 GLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXI 521
            +IYRC+S+P+              LN     R ++                        
Sbjct: 480 RIIYRCYSFPV-------------MLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASF 526

Query: 522 NVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLE 581
           +V G+    +    K ER SKVSF + ++  S+ T E   P    +EER +L  SI S E
Sbjct: 527 SVVGSKNSGQPNNVKSERPSKVSF-EMQRAGSLATGEATIPKLSDEEER-ILENSIRSAE 584

Query: 582 NLDKICVKLGKSRQQVERWLDELGNYKII 610
           + D ICV L KS+ +VE +L+ELG +K+I
Sbjct: 585 SFDNICVLLSKSKLEVENYLNELGEFKVI 613

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  513 bits (1321), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 276/610 (45%), Positives = 376/610 (61%), Gaps = 85/610 (13%)

Query: 11  HFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTF 70
            FEGF PIHTIF+SIFHPTEG+KVCY+FPP+NL  ++INFD+IKN++IPK QLC+RLLT 
Sbjct: 4   QFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRLLTL 63

Query: 71  KYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQSQ 130
           +Y+NYR+VSYP+ +++  YAR            Y+C+T PYEP+I RLGKMFK LEEQSQ
Sbjct: 64  EYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEEQSQ 123

Query: 131 ILSKAENDPIYFKS----DYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXX 186
           ILSK++    +FK     D+V                                       
Sbjct: 124 ILSKSQRTSAFFKDGEDVDFVD-------------------------------------- 145

Query: 187 XXXXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVP 246
                 TKFS+QDL+MR+YQDLNNYSECLIPID+GN+INIK+FP+LKPP +  IS+EDVP
Sbjct: 146 ------TKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVP 199

Query: 247 MSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVII 306
           +S++NL+ ++D+NWDPTML+I+P+I+GVN I+ I+ L+ +DP LVIECIKHL+YYNCVII
Sbjct: 200 LSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVII 259

Query: 307 TDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPF----ENNGNKQPST 362
           TDIFQFSN+YAP+SLI +FL D  +A  CQ+YVVLP GSK++ LP     ++  N    T
Sbjct: 260 TDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSDMT 319

Query: 363 PKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTD--PNNPHFELAHLPTKACL 420
            K                       +T    +++ +LSS++   +NP  +   LP+K  L
Sbjct: 320 QKALSSSRSSFSSYFSHKSAYARVSETAHHHQSTSTLSSSEGQQDNPR-QGQVLPSKCTL 378

Query: 421 FDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEG 480
           FDLYRSL+YG T+ +WY+ N + I EN++DVRKFIKFG+I  +IYR H YPI +  + + 
Sbjct: 379 FDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIMEHKTFKS 438

Query: 481 IQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINVDGADELLKNVYKKLERH 540
               +R ND                               I  D  D +L ++Y KL   
Sbjct: 439 PLLSDRQND-----------------------KIVLSTSDIKFDVGDRILNSIYNKL--- 472

Query: 541 SKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERW 600
           SKV+F   +K ES    + G    + + E+++L  ++E  E+ D+IC KLGKS+ +VE  
Sbjct: 473 SKVTFDRDKKLES----KIGNSRNLGESEKNILFNALERHESFDRICSKLGKSKNEVESI 528

Query: 601 LDELGNYKII 610
           + E+G Y  I
Sbjct: 529 ISEIGEYMTI 538

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  499 bits (1286), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 281/632 (44%), Positives = 379/632 (59%), Gaps = 50/632 (7%)

Query: 9   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 68
           L++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL N  INF+T KNYIIPK  LC++L+
Sbjct: 2   LSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKLI 61

Query: 69  TFKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQ 128
           TFKY  YRIV YP+TIN+P YAR           PY+CETSPYEP+I RLGKMFK+LEEQ
Sbjct: 62  TFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQ 121

Query: 129 SQILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXX 188
           +Q+LSK+E DP++F    V              S                +         
Sbjct: 122 NQLLSKSERDPVFFDLK-VLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 189 XXXVTK--------FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI 240
              + K        FS+QDL+MRI+QDLNNYSECLIPID+GN ++IK+FPLL+PP    +
Sbjct: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP-TTCV 239

Query: 241 SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY 300
           SLEDVP+S +NL  +IDVNWDPTM++IVPYI+G+N I+KI+KL+ +DP LVIECI+HL+Y
Sbjct: 240 SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIY 299

Query: 301 YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE---NNGN 357
           Y CV ++DIFQFSN+YAP+SLI +FLTD  MA+ CQ+YV  P  SK+S+LP      +G+
Sbjct: 300 YKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGD 359

Query: 358 KQ---------------PSTPKXXXXXXXXXXXXXXXXXXXXX----YMDTIQKSETSLS 398
           +                PS P                          Y D  Q S+TS S
Sbjct: 360 QDSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQ-SQTSCS 418

Query: 399 LSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFG 458
            S+    N       LPT++CLFDLYRSLS G TL++WY+S   I+ ENN+D+R+FI FG
Sbjct: 419 SSNIHVINNRNRF--LPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFG 476

Query: 459 IIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXX 518
           + + +IYRC+S+P+     N G +  + +  I    L                       
Sbjct: 477 LEKRIIYRCYSFPVMI---NAGSREPKEMTPIITKDL----------VNNDKLLEKRNHN 523

Query: 519 XXINVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIE 578
             ++  G+    ++   K ER SKVSF + ++  S+ T +   P  ++ EE  +L +SI 
Sbjct: 524 HLLSATGSRNTAQSGNLKPERPSKVSF-EMQRVSSLATGKSTMPK-LSDEEEGILEESIR 581

Query: 579 SLENLDKICVKLGKSRQQVERWLDELGNYKII 610
           + E  DKICV L K + +VE +L+ELG +K+I
Sbjct: 582 NAETFDKICVLLSKPKLEVESYLNELGEFKVI 613

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  499 bits (1285), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 286/635 (45%), Positives = 373/635 (58%), Gaps = 56/635 (8%)

Query: 9   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 68
           L++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL N  INF+TIKNYIIPK  LC++L+
Sbjct: 2   LSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKLI 61

Query: 69  TFKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQ 128
           TFKY  YRIV YP+TIN+P YAR           PY+CETSPYEP+I RLGKMFK+LEEQ
Sbjct: 62  TFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQ 121

Query: 129 SQILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXX 188
           +Q+LSK+E DP++F    +              +                          
Sbjct: 122 NQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSRY 181

Query: 189 XXXV-------TKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLIS 241
              V       + FS+QDL+MRI+QDLNNYSECLIPID+GN ++IK+FPLL+PP    +S
Sbjct: 182 NDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP-TTCVS 240

Query: 242 LEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYY 301
           LEDVP+S +NL  +IDVNWDPTM+NIVPYI+G+N I+KI+KL+ +DP LVIECI+HL+YY
Sbjct: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300

Query: 302 NCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQ-- 359
            CV ++DIFQFSN+YAP+S I +FLTD  MA  CQ YV  P  SK+S LP   N      
Sbjct: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL 360

Query: 360 ----------------PSTP----KXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSL 399
                           PS P                          Y D  Q S+TS S 
Sbjct: 361 DSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQ-SQTSCSS 419

Query: 400 SSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGI 459
           S+   +N       LPT++CLFDLYRSLS G TL++WY+S   II +NN+D+R+FI FG+
Sbjct: 420 SNIHISNNRNRF--LPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGL 477

Query: 460 IRGLIYRCHSYP----IPQRPSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXX 515
            + +IYR +SYP    +  R + E    I + +  +++  + +                 
Sbjct: 478 EKRIIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAV-- 535

Query: 516 XXXXXINVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLK 575
                        L  N+  K  R SKVSF D +K  S+ T E   P     EER +L +
Sbjct: 536 -------------LFNNI--KSGRPSKVSF-DMQKASSLITGESTIPKLSDDEER-ILEE 578

Query: 576 SIESLENLDKICVKLGKSRQQVERWLDELGNYKII 610
           S+ S EN DKICV LGK + +VE +L+ELG +KII
Sbjct: 579 SVRSAENFDKICVLLGKPKLEVENYLNELGEFKII 613

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  468 bits (1205), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/676 (40%), Positives = 366/676 (54%), Gaps = 81/676 (11%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           NHF+GF+PIH+IFYS+FHPTEGTKV ++FPP +L N  I+FDTIKNY+IPK QLCN+LLT
Sbjct: 3   NHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKLLT 62

Query: 70  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 129
           FKY +YR+V YP+ INA YYAR           PY+  TSPYEP+I RLGKMF++LEEQS
Sbjct: 63  FKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEEQS 122

Query: 130 QILSKAENDPIYFK---SDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXX 186
           Q+LSK E DPIY+     D                                         
Sbjct: 123 QVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEIMK 182

Query: 187 XXXXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVP 246
                  + S++DLI ++Y+DLNNYSECLIP+D GN I+IK+FPLL PP N   S+EDVP
Sbjct: 183 HIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPP-NSCFSVEDVP 241

Query: 247 MSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVII 306
           ++ +NL + +DVNWDPTM+ IVPYING+N I+KI+K + +D  LV+EC+KHL+YY+CV++
Sbjct: 242 IAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVVL 301

Query: 307 TDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFEN----NGNKQPST 362
            D+FQFSN+YAPTS +  FLTD  +A +CQ YV+    S+L  LPFE     N ++ P+ 
Sbjct: 302 VDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRNPTA 361

Query: 363 PKXXXXXXXXXXXXXXXXXXXXXYMDTIQK--------SETSLSLSSTDP-----NNPHF 409
                                    +  QK        SE S++ SS +      NN   
Sbjct: 362 STITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHENNKGI 421

Query: 410 ELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHS 469
               LPT++CLFDLYRSLS G T++ WY+ N  +I +N +DVR+FI FG+ R LIYRC+S
Sbjct: 422 LNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRCYS 481

Query: 470 YPIPQRPSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXX------------XXX 517
           YP+ +      I  ++ L   D   L                                  
Sbjct: 482 YPVAK-----SIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQFRKK 536

Query: 518 XXXINVDGADELLKNVYKKLE-------------RHSKVSF------------------- 545
               N D ADE+L++ YKKL              R  K+S                    
Sbjct: 537 PLVPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKLSSSTSG 596

Query: 546 --------MDKEKNESMKTDEKGRPSTMTKEERS---VLLKSIESLENLDKICVKLGKSR 594
                    D+  N+  +  ++   ST  K +R    +LLKSI+++++ DKI +KL  ++
Sbjct: 597 TAKVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEINK 656

Query: 595 QQVERWLDELGNYKII 610
           Q+VE  L   G Y II
Sbjct: 657 QEVEELLKATGEYNII 672

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  463 bits (1191), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 268/661 (40%), Positives = 366/661 (55%), Gaps = 75/661 (11%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           + FEGF+ IH+IFYS FHPTEG+KV ++FPP++L N  INFD+IKNY+IPK  LC+RL+T
Sbjct: 3   SQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRLIT 62

Query: 70  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 129
           FKY NYRI  YP+T+N+  YAR           P+ CETSPYEP+I RLGKMF++LE Q+
Sbjct: 63  FKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEIQN 122

Query: 130 QILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXXX 189
           QILSK+END I F                                               
Sbjct: 123 QILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISNIK 182

Query: 190 XXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSL 249
              + F++ DL+MR+YQDLN YSECLIPID GN ++IK+FPLL PP  + IS+E VP+SL
Sbjct: 183 KKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPY-ISIEHVPISL 241

Query: 250 INLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 309
           +NL  ++DVNWDP ML I+PYING+N+I +I++L+  +  LVIECI+HLVYY C+++TDI
Sbjct: 242 VNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCIVLTDI 301

Query: 310 FQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQP-------ST 362
           F+FSNVYAPTS +  FL D  MAT+CQ+YV+LPI SK++ L    +  K         S 
Sbjct: 302 FEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNGDIGSR 361

Query: 363 PKXXXXXXXXXXXXXXXXXXXXXYMDTIQ------KSETSLSLSSTDPNNPHFELAHLPT 416
                                   +D  Q      K ++  S+S+ + NN      HLPT
Sbjct: 362 NNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTGNSNNGQNIHKHLPT 421

Query: 417 KACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRP 476
           ++ LFDLYRSLS G+TL+ WY  N  II +N +DVR+FI FG++R +IYRC +Y +    
Sbjct: 422 RSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYSVIN-- 479

Query: 477 SNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINVDGADELLKNVYKK 536
           S + +Q + +LN+++                             I+   ADE L N YKK
Sbjct: 480 STDHLQNLWKLNELE--------------NPISMENISKLQSNHIDSLAADEALMNAYKK 525

Query: 537 L-------------------------------------ERHSKVSF--MDKEKN-----E 552
           L                                     +R SKVSF  + +++N      
Sbjct: 526 LSLKVPSKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGS 585

Query: 553 SMKTD-EKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKIIT 611
           ++KT  ++     ++K +R ++LK++   E LDKICV L   RQ V   L ELG  K+I 
Sbjct: 586 NIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLIN 645

Query: 612 C 612
           C
Sbjct: 646 C 646

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  458 bits (1178), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 270/700 (38%), Positives = 363/700 (51%), Gaps = 110/700 (15%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
            HF+GF+P+H I Y+IFHPTEGTKV ++FPP  L    I FDTIKNY+IPK QLCN+LLT
Sbjct: 3   GHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKLLT 62

Query: 70  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 129
           FKY ++R+V YP+ + APYYAR           PY+C TSPYE +IARLGKMF +LEEQS
Sbjct: 63  FKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEEQS 122

Query: 130 QILSKAENDPIYF----KSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXX 185
           QILSKAEN  +YF    +  +               +                       
Sbjct: 123 QILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHEIL 182

Query: 186 XXXXXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDV 245
                   + SV+DLI +IY+DLNNYSECLIPID GN ++IK+FPLL PP + L S EDV
Sbjct: 183 KDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCL-SFEDV 241

Query: 246 PMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVI 305
           PM  +NL  +IDVNWDPTML IVPYING N I+K+AKL+ +D  LV+ECI+HL+YYNCVI
Sbjct: 242 PMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCVI 301

Query: 306 ITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQPSTP-- 363
           + DIFQF N+YAPTS +  FLT+  +AT+CQ YV L   + +S LPFE    ++PS    
Sbjct: 302 LADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFE----RKPSRTTY 357

Query: 364 -----KXXXXXXXXXXXXXXXXXXXXXYMDTIQK--------------------SETSLS 398
                +                     +   I +                    S+ SL 
Sbjct: 358 NNIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLG 417

Query: 399 LSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFG 458
            S    NN  F      +K+CLFD+YRSLS G T++ WY+++   I    +DVR+FI FG
Sbjct: 418 NSEGGFNNKVF----FTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFG 473

Query: 459 IIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDA------------------HRLQIRXX 500
           +I GL+YRC+S+PI +      + +   L+D D+                     +IR  
Sbjct: 474 VIHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIG 533

Query: 501 XXXXXXXXXXXXXXXXXXXXINVDGADELLKNVYKKLE-RHSKVSFMDKEKNESMKT--- 556
                                N D A+++L +VY+KL    +KV    +  N  M+    
Sbjct: 534 LESSSSKLRERRFNHFS----NADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGN 589

Query: 557 ---DEKGRPS-------------------------TMTKEERS----------------V 572
              D  G  S                         + T E+R                 +
Sbjct: 590 CSDDSSGETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKRKDELL 649

Query: 573 LLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKIITC 612
           LLKS+  +EN DKIC +LG+ R++VE+ L++LG Y ++ C
Sbjct: 650 LLKSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVHC 689

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  456 bits (1172), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 268/662 (40%), Positives = 360/662 (54%), Gaps = 71/662 (10%)

Query: 12  FEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTFK 71
           F+GF+PIHT+FY++FHPTEG+KV ++FPP +L N  I+FDTIKNYIIPK QLCN+LLTFK
Sbjct: 5   FDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKLLTFK 64

Query: 72  YENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQSQI 131
           Y  YRIV YP+ +NA YYAR           PY+C TSPYEP+IARLGKMFK+LEEQSQI
Sbjct: 65  YGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEEQSQI 124

Query: 132 LSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXXXXX 191
           LSK+E +P+YF+                  S                             
Sbjct: 125 LSKSEQNPVYFQ--LKSNDSNAADQSTEMGSITISEHTDIKSTGDDGEKYLEIIKELAKN 182

Query: 192 VTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLIN 251
                ++DL+M+++ DLNNYSECLIPID+GN I+IK+FP+  PP ++ IS+EDVP++++N
Sbjct: 183 QKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSN-ISVEDVPIAVVN 241

Query: 252 LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
           L+++IDVNWDPTM+ IVPYING+N +++IA   ++D  LV ECIKHL+YYNCVI++DIFQ
Sbjct: 242 LSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILSDIFQ 301

Query: 312 FSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKL--SHLPFEN-------NGNKQPST 362
           FSN+YAPTS I +FLT+  +A  CQ +V    G  L  S LPFE         G KQ ST
Sbjct: 302 FSNIYAPTSEIHNFLTNPAVAKACQLFVQ---GDSLKQSLLPFEGRPNNIYPTGRKQAST 358

Query: 363 P-----KXXXXXXXXXXXXXXXXXXXXXYMDTIQ-----KSETSLSLSSTDPNNPHFELA 412
                 +                     Y+ +       ++  S + S     N    + 
Sbjct: 359 STVHSRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAHASENTSLATGENQMKRI- 417

Query: 413 HLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPI 472
            LPT++CLFDLY+SLS G T++ WY+ N  II +N +DVRK I FGI R LIYR +SYPI
Sbjct: 418 -LPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYPI 476

Query: 473 PQRPSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINVDGADELLKN 532
            +      I +     +   H                             +D ADELLK+
Sbjct: 477 VKNVGTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQSDKLDAADELLKS 536

Query: 533 VYKKLE------------------------------------RHSKVSFMDKEKNESMKT 556
           +Y+KL                                      H KVSF      +    
Sbjct: 537 LYQKLSLKQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGSHQKVSFDFGTAGQQKTV 596

Query: 557 DE-----KGRPSTMTKEERS---VLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYK 608
            E      G    + K+++    +LL+S+ + E  DK+C KL KSR +VE  L +LG+Y 
Sbjct: 597 TEVPDLGDGEKVEVWKKKKEEELILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYN 656

Query: 609 II 610
           I+
Sbjct: 657 IV 658

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  447 bits (1151), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 271/694 (39%), Positives = 363/694 (52%), Gaps = 101/694 (14%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
            HF+GF+P+H IFYS+FHPTEGTKV ++FP   L    I FDTIKNY+IPK QLCN+LLT
Sbjct: 3   GHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKLLT 62

Query: 70  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 129
           FKY  +R+V YP+ + APYYAR           PY+C TSPYEP+I RLGKMF +LEEQS
Sbjct: 63  FKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEEQS 122

Query: 130 QILSKAENDPIYF----KSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXX 185
           QILSKAEN  +YF    ++                 S               S       
Sbjct: 123 QILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYEIL 182

Query: 186 XXXXXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDV 245
                   K ++ DLI +IY+DLN+YSECLIPID GN ++IK+FPLL PP +   S+EDV
Sbjct: 183 KDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSS-CFSIEDV 241

Query: 246 PMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVI 305
           P+S +NL  +IDVNWDPTML IVP+ING+N I+K+AK + +D  LV+ECIKHL+YYNCVI
Sbjct: 242 PISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCVI 301

Query: 306 ITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE------NNGNKQ 359
           +TDIFQFSN+YA T+ +  FLT+  +A +CQ YV     + L +LPFE        GN +
Sbjct: 302 LTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNIR 361

Query: 360 PSTPKXXXXXXXXXXXXXXXXXXXXXYMDTI--QKSETSLSLSSTDP----NNPHF---- 409
             +                        MD +  +   T  S SS+ P    ++  F    
Sbjct: 362 DRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGNSD 421

Query: 410 -----ELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLI 464
                +L    +K+CLFDLYRSL+ G T+R WY+++   I    +DVR+FI FG++ GLI
Sbjct: 422 AGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGLI 481

Query: 465 YRCHSYPIPQRPSNEGI-QRIERLNDIDAHR--------------------LQIRXXXXX 503
           YR +SYP+ +   N G  + +E L   +  R                      IR     
Sbjct: 482 YRSYSYPVLR---NIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLEN 538

Query: 504 XXXXXXXXXXXXXXXXXINVDGADELLKNVYKKLE---------------------RHSK 542
                               D A+E+L +VY+KL                      R+S+
Sbjct: 539 AGFKARSEKLKQHS----TADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSE 594

Query: 543 VS--FMDKEKNESMKTDEKGRP--------STMTKEERS----------------VLLKS 576
            S     +E   SM +D K +         +T + +ER                 +LLKS
Sbjct: 595 DSTDISTRESANSMGSDIKNKVAFDVRKTLATSSADERRRSEILRSIEEKRNEELILLKS 654

Query: 577 IESLENLDKICVKLGKSRQQVERWLDELGNYKII 610
           + S+ N DKIC  LGK R++VE  L ELG Y ++
Sbjct: 655 VRSVHNFDKICTLLGKDRERVESMLSELGPYNVL 688

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  447 bits (1150), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 232/474 (48%), Positives = 301/474 (63%), Gaps = 6/474 (1%)

Query: 9   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 68
           ++HFEGF+PIHT+FYSIFHPTEGTKV YEFPP NL  ++INFDTIKNYIIPK QLC++LL
Sbjct: 2   IDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKLL 61

Query: 69  TFKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQ 128
           T KY +YR+VSYP+TIN+  YAR           P  CETSPYEP IARLGKMF++LEEQ
Sbjct: 62  TLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEEQ 121

Query: 129 SQILSKAENDPIYFKSDY-VXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXX 187
           +Q+LS+AEND +YF + + +              +                         
Sbjct: 122 NQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLSLSEYP 181

Query: 188 XXXXVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPM 247
                + FSVQDLIMRI+QDLNNYSECLIPID+GN ++IK+FP + PP +  IS EDVP+
Sbjct: 182 DNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPP-SISISYEDVPV 240

Query: 248 SLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIIT 307
           ++++L++V+DVNWDPTML IVP+I+ +N IS+IA L+ +D   V+ECI+HLVYY  VI++
Sbjct: 241 AMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVILS 300

Query: 308 DIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQPSTPKXXX 367
           DIFQF+N+YAPTS +  FLTD  +AT CQ YV LP  S    LP E + N          
Sbjct: 301 DIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINTDLDEYSNSG 360

Query: 368 XXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACLFDLYRSL 427
                              M    ++  S   S     N      +LPTK+CLFDLYRSL
Sbjct: 361 SAIYPNNEILENDDRLRWPMYYKPRNSQSSLSSGISSGNERTS-NYLPTKSCLFDLYRSL 419

Query: 428 SYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEGI 481
           S G  L  WY  + ++I  N +D+R+FI FG++RGL+YRC++ PI +   N GI
Sbjct: 420 SQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPIMK---NAGI 470

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%)

Query: 570 RSVLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKIITC 612
           R +LL+S+   +N+DKIC+KL K R++VE  L E+G+Y II C
Sbjct: 668 RRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIINC 710

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  434 bits (1117), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 252/670 (37%), Positives = 355/670 (52%), Gaps = 70/670 (10%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           N F+GF+PIH IFY++FHPTEGTKV ++FP  +L    I FDTIKNY+IPK+QLCN+L+T
Sbjct: 10  NKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKLVT 69

Query: 70  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 129
           FK+ +YR+V YP+ I APYYAR           PY+  TSPYEP+IARL KM ++LEEQS
Sbjct: 70  FKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEEQS 129

Query: 130 QILSKAENDPIYFKSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXXXXXXX 189
           Q+LSK E DP+Y++                                  +           
Sbjct: 130 QMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHEIMKHI 189

Query: 190 XXVTK-FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMS 248
               K   ++DLI ++Y+DLNNYSECLIP+D GN I+IK+FPLL PP N  +S EDVP++
Sbjct: 190 NSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPP-NSCLSFEDVPIA 248

Query: 249 LINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITD 308
            +NL N++DVNWDPTML IVP+ING+N I+KI+K + +   LV+ECIKHLVYY+CV + D
Sbjct: 249 KVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVALVD 308

Query: 309 IFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE---NNGNKQPSTPKX 365
           +FQFSN+YAPT+L+  FL D  +  +CQ YVV     ++  LPFE   N G+ +  T   
Sbjct: 309 MFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRNQTAST 368

Query: 366 XXXXXXXXXXXXXXXXXXXXYMDTIQKSE--TSLSLSSTDPNNPHFE----------LAH 413
                                 +  QKS   +SL+ S T  N  ++              
Sbjct: 369 NTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRNLESNCKRT 428

Query: 414 LPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIP 473
           LPT+  LFDLYRSL+ G TL+ WY++N + I EN +DVR+ I FG+   LIYRC+SYP+ 
Sbjct: 429 LPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRCYSYPVA 488

Query: 474 QRPSN-EGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINV-------DG 525
           +     E ++R + ++  D                              N+       D 
Sbjct: 489 KSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRVDFDGSSRSRNIPPFLNSSDV 548

Query: 526 ADELLKNVYKKLE-------------------RHSKVSFMDKEKNESMKT--------DE 558
           A+E+L+  Y+KL                      ++ +     + +SM T        D 
Sbjct: 549 AEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNTTRITFDI 608

Query: 559 KGRPSTMTKEERS------------------VLLKSIESLENLDKICVKLGKSRQQVERW 600
           + R  +   E R                   +LL+S++S+++ DKI V+L  ++ +VER 
Sbjct: 609 RNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVERL 668

Query: 601 LDELGNYKII 610
           L   G Y I+
Sbjct: 669 LKGTGEYNIV 678

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  405 bits (1040), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 220/450 (48%), Positives = 289/450 (64%), Gaps = 38/450 (8%)

Query: 193 TKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLINL 252
           ++ SVQDLIMRIYQDLNNYSECLIPID GN+++IK+FPLLKPPP + +S+EDVPMSL++L
Sbjct: 225 SRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDL 284

Query: 253 NNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQF 312
             + DVNWDPTML ++P+ING+NDISKI+KL+ + P+LVIECIKHL+YYNCVIITDIFQF
Sbjct: 285 TKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQF 344

Query: 313 SNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPF--------------ENNGNK 358
           SN Y+ TSLI +FLTD  MAT CQNYVVLP+GSKL+ LPF               ++ N+
Sbjct: 345 SNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNR 404

Query: 359 QPSTPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKA 418
              TP                        D  ++SETSL+ S+   N+     AHLPTK 
Sbjct: 405 HEKTPSFGSSITSNNGRSSFS-------ADDRKQSETSLNSSNDPSNSNLISTAHLPTKM 457

Query: 419 CLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSN 478
            LF+LYRSL+    L++WY+ N T I ENN+D+RKFIKFGII+GLIYRCHSYPI   P  
Sbjct: 458 SLFELYRSLNQRTDLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIVITPVV 517

Query: 479 EGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXXXXINVDGA----DELLKNVY 534
              +  +  +   +                            +   G     D+L+K+ Y
Sbjct: 518 SAPESAKSTSPFVSSSGISSSVDSKQHTQKGPISRFPGLGSHVPSSGVRDTRDKLMKSFY 577

Query: 535 KKLER---HSKVSFMDK-----EKNESMKT----DEKGRPSTMTKEERSVLLKSIESLEN 582
           +KLE+   HSKVSF DK     ++N+   T    D+K + S +T ++R++LL SI +++N
Sbjct: 578 EKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSK-SQLTLKQRNILLDSISNMDN 636

Query: 583 LDKICVKLGKSRQQVERWLDELGNYKIITC 612
           +DKICVKLG+ R Q+E WL E G+YK+I C
Sbjct: 637 MDKICVKLGRPRSQIEEWLSEFGDYKVINC 666

 Score =  239 bits (609), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 112/144 (77%), Positives = 123/144 (85%)

Query: 4   SNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQL 63
           SNLN++NHFEGFMPIHTIFYSIFHPTEGTKV YEFPP NL+   I+FD IKNYIIPK QL
Sbjct: 5   SNLNSINHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQL 64

Query: 64  CNRLLTFKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFK 123
           CN+LLTFKY NYRIVSYPITIN+ +YAR           PY+CETSPYEP+IARLGKMFK
Sbjct: 65  CNKLLTFKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFK 124

Query: 124 ILEEQSQILSKAENDPIYFKSDYV 147
           +LEEQ+QILSKAENDPIYFKSDY 
Sbjct: 125 VLEEQNQILSKAENDPIYFKSDYT 148

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  382 bits (982), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 189/358 (52%), Positives = 242/358 (67%), Gaps = 13/358 (3%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           ++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL +  INF+TIKNYIIPK  LC++L+T
Sbjct: 3   SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKLIT 62

Query: 70  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 129
           FKY  YRIV YP+TIN+P YAR           PY+CETSPYEP+I RLGKMFK+LEEQ+
Sbjct: 63  FKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQN 122

Query: 130 QILSKAENDPIYF-----KSDYVXXXXXXXXXXXXXXSXXXXXXXXXXXXXXGSRXXXXX 184
           Q+LSK+E DP++F     ++  +              S                R     
Sbjct: 123 QLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNRFN 182

Query: 185 XXXXXXXVTKFSVQDLIMRI-------YQDLNNYSECLIPIDKGNDINIKVFPLLKPPPN 237
                  +    + +    I       +QDLNNYSECLIPID GN ++IK+FPLL+ PP 
Sbjct: 183 GEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLR-PPT 241

Query: 238 HLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKH 297
             +SLEDVP+S +NL  +IDVNWDPTM+ IVPYI+G+N I+KI+K + +DP LVIECI+H
Sbjct: 242 TCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIRH 301

Query: 298 LVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENN 355
           L+YY CV ++DIFQFSN+YAP+SLI +FLTD  MAT CQ+YV  P  SKLS+LP   N
Sbjct: 302 LIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKN 359

 Score =  136 bits (342), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 124/221 (56%), Gaps = 24/221 (10%)

Query: 394 ETSLSLSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRK 453
           ++  S SST+ +        LPT++CLFDLYRSLS G TL+SWY+   T + ENN+D+R+
Sbjct: 417 QSQTSCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRR 476

Query: 454 FIKFGIIRGLIYRCHSYP----IPQRPSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXX 509
           FI FG+ R +IYRC+S+P    +  R + E      +    + + L+ R           
Sbjct: 477 FITFGLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKR----------- 525

Query: 510 XXXXXXXXXXXINVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEE 569
                      ++V G+    +   K  ER SKVSF + ++  S+ T +   P  ++ EE
Sbjct: 526 ------DYNHSLSVTGSKSTTQTNVKS-ERPSKVSF-EMQRANSLATGKNKIPK-LSDEE 576

Query: 570 RSVLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKII 610
           + +L KSI S EN DKICV LGKS+Q+VE +L ELG +K+I
Sbjct: 577 KKILEKSIRSAENFDKICVLLGKSKQEVENYLSELGEFKVI 617

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  338 bits (866), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 204/500 (40%), Positives = 272/500 (54%), Gaps = 91/500 (18%)

Query: 193 TKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLINL 252
           + FS+QD IMR+YQDLNNYSECLIPID GN ++IK+FPLL+PPP   IS+EDVP+S +NL
Sbjct: 203 SDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLRPPP-ATISIEDVPISRVNL 261

Query: 253 NNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQF 312
             +IDVNWDPTML IVP+I+GVN I+KIAKL+ +D +LVIECIKH +YY CV+I+DIFQF
Sbjct: 262 KEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIECIKHFIYYGCVVISDIFQF 321

Query: 313 SNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE--------NNGNKQPSTPK 364
           SN+YAPTSL+ +FLTD  MAT+CQ YV +P  S L  LP E        ++G+   +  K
Sbjct: 322 SNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLESLSKLKLDSDGSDSQNLRK 381

Query: 365 XXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSL---------SLSSTDPNNPHFELAHLP 415
                                  ++   S + L         S+SS + N+ +  +  LP
Sbjct: 382 SKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHRSESSISSQNTNDLNGNVKQLP 441

Query: 416 TKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQR 475
           T++ LFDLYRSLS GVTL+ WY+ N   I  N +D+RKFI FGII GL+YRC S+P+   
Sbjct: 442 TRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDIRKFIIFGIINGLLYRCQSFPVT-- 499

Query: 476 PSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXXXX------------XXINV 523
            + E I ++++  DI  +R + R                                  +++
Sbjct: 500 ANFEEINKVKKFKDI-QNRKETRKDKLQKQLSQDIFSTSDIKVGEDLISGRNRRIQTLDL 558

Query: 524 DGADELLKNVYKKLERH-----------------------------------------SK 542
           D AD +LKNVYKKL                                            SK
Sbjct: 559 DIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSLFESSNPYSKVPKRPGTLSK 618

Query: 543 VSFM------------DKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKL 590
           VSF             D  +NE +   EK R     K+   +LL+++ES ENLDKICV L
Sbjct: 619 VSFQQNSNMQYSASSGDVTENEDINNLEKLR-----KQNEQILLEALESTENLDKICVLL 673

Query: 591 GKSRQQVERWLDELGNYKII 610
            K R +VE  L  L ++K+I
Sbjct: 674 EKPRSEVEEMLKHLVDFKVI 693

 Score =  193 bits (491), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 101/131 (77%)

Query: 12  FEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTFK 71
           F+GF PIHTIFYS+FHPTEG KVCY+FPP NL N+ INFD+I++Y+IPK QLCN+LLT K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 72  YENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQSQI 131
           Y NYRI+ YPITIN   YAR           PYEC+TSPYE  I +LGKMF++LEEQSQ 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 132 LSKAENDPIYF 142
           LSKAE D  YF
Sbjct: 124 LSKAEKDLAYF 134

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  315 bits (806), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 195/511 (38%), Positives = 266/511 (52%), Gaps = 99/511 (19%)

Query: 194 KFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLINLN 253
           + S++DLI ++YQDLNNYSEC IPID GN ++IK+FPLL  PPN  +S EDVP+S +NL 
Sbjct: 203 RLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPLL-APPNSCLSFEDVPISTVNLA 261

Query: 254 NVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQFS 313
            +IDVNWDPTML IVP+INGVN I+KIAK + +D  LVIEC+KHL+YYNCV++ DIFQFS
Sbjct: 262 KLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVIECVKHLIYYNCVVLADIFQFS 321

Query: 314 NVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGN--------KQPS---- 361
           N+YA TSLI  FLTD  +A++CQ YV      +L  LPFE+  N        KQ S    
Sbjct: 322 NIYASTSLISEFLTDPTLASECQTYVT-SSDLELYRLPFESRPNLLSMHSSRKQNSSSTI 380

Query: 362 -----------TPKXXXXXXXXXXXXXXXXXXXXXYMDTIQKSETSLSLSSTDPNNPHFE 410
                      T                        M    +S  S + S+ D       
Sbjct: 381 HTVGVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLMRVRDRSGQSTTGSAVDEQESRL- 439

Query: 411 LAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSY 470
              LPTK+CLFDLYRSL  G T++ WY+ N  II +N++DVR+FI FGI+RGLIYRC++Y
Sbjct: 440 --LLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDVRRFITFGIVRGLIYRCYAY 497

Query: 471 PIPQR-PSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXXXXXXX------------- 516
           P+ +   + E ++ ++  +D  + R +++                               
Sbjct: 498 PVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNVFSTADIKVDLEHSPGGAPAE 557

Query: 517 ---XXXXINVDGADELLKNVYKKL-----------ERHSKVSFM------DKEKNESMKT 556
                   NVD A+E+LK+ YKKL             H+ +S +      +     S K 
Sbjct: 558 IFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLYHVHNPMSRLYGHDSGESSTKGSRKG 617

Query: 557 DEKGRPSTMTKEERS-------------------------------------VLLKSIES 579
             KG  STM  E RS                                     +LLKS++S
Sbjct: 618 SRKGSSSTMESETRSKVAFEKGRSPWQVEEDEKKERTEEVSNLLKEKRHEEFLLLKSVKS 677

Query: 580 LENLDKICVKLGKSRQQVERWLDELGNYKII 610
           ++  DKIC++L K R++VE+ L E+G+Y II
Sbjct: 678 VDTFDKICMRLEKDREEVEQLLKEMGHYNII 708

 Score =  209 bits (533), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 108/133 (81%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           +HF+GF+PIHT+FYS+FHPTEGTKV Y+FPP NL N  INFDTIKNY+IPK QLCN+LLT
Sbjct: 3   SHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKLLT 62

Query: 70  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 129
           FKY  YR+  YP+ +NA YYAR           PY C TSPYEP++ARLGKMF++LEEQS
Sbjct: 63  FKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEEQS 122

Query: 130 QILSKAENDPIYF 142
           QILSKAENDP+YF
Sbjct: 123 QILSKAENDPVYF 135

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  289 bits (740), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 193/473 (40%), Positives = 259/473 (54%), Gaps = 61/473 (12%)

Query: 194 KFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLINLN 253
           + S+ D++MR++QDLN+YSEC IPID GN I+IK+FP L PP +  IS+EDVP+  +NLN
Sbjct: 210 QLSMNDILMRVFQDLNSYSECYIPIDDGNAIDIKLFPTLMPPIDS-ISVEDVPIPTVNLN 268

Query: 254 NVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQFS 313
            +IDVNWDPTML IVPYI+G+N I KIA L+ +D +LVIECI+H VYY CVI++DIFQFS
Sbjct: 269 KIIDVNWDPTMLKIVPYIDGLNSIFKIANLSNSDAMLVIECIRHFVYYGCVILSDIFQFS 328

Query: 314 NVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGN--KQPSTPKXXXXXXX 371
           N+YAPTS I  FLTD  +AT+CQ YV  P  S LS LPF+      K   +         
Sbjct: 329 NIYAPTSSITDFLTDPTLATECQIYVTSPEDSLLSALPFKKGRKMVKNRRSASIASHFTS 388

Query: 372 XXXXXXXXXXXXXXYM---------------DTIQKSETSLSLSSTDPNNP--HFELAHL 414
                         ++               D+I ++      S +  NN   H    +L
Sbjct: 389 SSSLRQNLNSKASSFISDEGHHNDDTAYPNHDSIYENRRRSESSFSSGNNDEMHQNRNYL 448

Query: 415 PTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQ 474
           PTK+ LFDLYRSLS GV L  WYQ N   I +N +D+R+FI FGII+ +IYRCHSYP+P+
Sbjct: 449 PTKSTLFDLYRSLSQGVKLEEWYQINFNSIRDNFIDIRRFIIFGIIKRIIYRCHSYPLPK 508

Query: 475 RPSNEGIQRIERLNDIDAHRLQIRXXXXXXXXXXXXX----------XXXXXXXXXINVD 524
             + E   ++  L ++      ++                                ++VD
Sbjct: 509 --NYEAFSKLNDLKNLQNGPKIVKNKSQSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDVD 566

Query: 525 GADELLKNVYKKLERH--------------SKVSFMDKEKNESMKTDEKGRPSTM----T 566
            AD +L NVYKKL  +              SKV+F    KN+S   D  G  + +    T
Sbjct: 567 VADRVLNNVYKKLSTNGRPTTSINGQGQHPSKVAF----KNQSYDNDLPGLMNNLGIEAT 622

Query: 567 KEERSV-------LLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKIITC 612
           K  R +       LL +++S ENLD IC  L  SR++VE  L+EL  Y+II C
Sbjct: 623 KFSREININDKIYLLDALQSAENLDNICSNLELSREEVETLLNELTEYRIINC 675

 Score =  182 bits (461), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 95/133 (71%)

Query: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69
           N F+GF+PIH IFYS+FHPTEGTKV YEFPP NL    INFD IKNY+IPK QLC++LLT
Sbjct: 3   NSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKLLT 62

Query: 70  FKYENYRIVSYPITINAPYYARXXXXXXXXXXXPYECETSPYEPSIARLGKMFKILEEQS 129
            KY NYRIV YPI IN+  YAR           PYECETSPYEP + RLGKMF  LE Q 
Sbjct: 63  LKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEGQC 122

Query: 130 QILSKAENDPIYF 142
           Q LSK E D  YF
Sbjct: 123 QFLSKCEKDMAYF 135

>ZYRO0B10362g Chr2 complement(812053..818526) [6474 bp, 2157 aa] {ON}
            some similarities with uniprot|P08678 Saccharomyces
            cerevisiae YJL005W CYR1 Adenylate cyclase required for
            cAMP production and cAMP-dependent protein kinase
            signaling involved in cell cycle control and glucose and
            nitrogen repression of sporulation
          Length = 2157

 Score = 38.5 bits (88), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+ V+DV+      +++P+I+   DIS + +LTKAD +LVI   K   Y +     DI +
Sbjct: 1672 LDGVVDVSRAVGFFDLLPHIHASPDIS-MVQLTKADEMLVIATHKLWQYMDFETACDIAR 1730

Query: 312  FSNVYAPTSLICSFLTDQEMATQCQNYVVL 341
              N   P  L    + D  +A  C + + +
Sbjct: 1731 -ENSSQPM-LAAEAMKDHAIAYGCSDNLTI 1758

>Suva_12.76 Chr12 (107539..113613) [6075 bp, 2024 aa] {ON} YJL005W
            (REAL)
          Length = 2024

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+ V+DV+      +++P+I+   DIS +  LTKAD +L++   K   Y +   + DI +
Sbjct: 1531 LDGVVDVSRAVGFFDLLPHIHASPDIS-VVTLTKADEMLIVATHKLWEYMDVDTVCDIAR 1589

Query: 312  FSNVYAPTSLICSFLTDQEMATQC-QNYVVL 341
              N   P       L D  MA  C +N  +L
Sbjct: 1590 -ENSTDPLRAAAE-LKDHAMAYGCTENITIL 1618

>YJL005W Chr10 (425157..431237) [6081 bp, 2026 aa] {ON}  CYR1Adenylate
            cyclase, required for cAMP production and cAMP-dependent
            protein kinase signaling; the cAMP pathway controls a
            variety of cellular processes, including metabolism, cell
            cycle, stress response, stationary phase, and sporulation
          Length = 2026

 Score = 38.1 bits (87), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+ V+DV+      +++P+I+   DIS +  LTKAD +L++   K   Y +   + DI +
Sbjct: 1533 LDGVVDVSRAVGFFDLLPHIHASPDIS-VVTLTKADEMLIVATHKLWEYMDVDTVCDIAR 1591

Query: 312  FSNVYAPTSLICSFLTDQEMATQC-QNYVVL 341
              N   P       L D  MA  C +N  +L
Sbjct: 1592 -ENSTDPLRAAAE-LKDHAMAYGCTENITIL 1620

>Skud_10.218 Chr10 (392657..398734) [6078 bp, 2025 aa] {ON} YJL005W
            (REAL)
          Length = 2025

 Score = 38.1 bits (87), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+ V+DV+      +++P+I+   DIS +  LTKAD +L++   K   Y +   + DI +
Sbjct: 1532 LDGVVDVSRAVGFFDLLPHIHASPDIS-VVTLTKADEMLIVATHKLWEYMDVDTVCDIAR 1590

Query: 312  FSNVYAPTSLICSFLTDQEMATQC-QNYVVL 341
              N   P       L D  MA  C +N  +L
Sbjct: 1591 -ENSTDPLRAAAE-LKDHAMAYGCTENITIL 1619

>Smik_10.274 Chr10 (422245..428346) [6102 bp, 2033 aa] {ON} YJL005W
            (REAL)
          Length = 2033

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+ V+DV+      +++P+I+   D+S +  LTKAD +L++   K   + +   + DI +
Sbjct: 1540 LDGVVDVSRAVGFFDLLPHIHASPDVS-VVTLTKADEMLIVATHKLWEFMDVDTVCDIAR 1598

Query: 312  FSNVYAPTSLICSFLTDQEMATQC-QNYVVL 341
              N   P       L D  MA  C +N  +L
Sbjct: 1599 -ENSTDPLRAAAE-LKDHAMAYGCTENITIL 1627

>CAGL0D03168g Chr4 complement(324192..330440) [6249 bp, 2082 aa] {ON}
            similar to uniprot|P08678 Saccharomyces cerevisiae
            YJL005w CYR1 adenylate cyclase
          Length = 2082

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 3/90 (3%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+ V+DV+      +++P+I+   DIS I  +TKAD +L+I   K   Y +     DI +
Sbjct: 1588 LDGVVDVSRAVGFFDLLPHIHASPDISVI-NVTKADEMLIIGTHKLWEYMDIETACDIAR 1646

Query: 312  FSNVYAPTSLICSFLTDQEMATQCQNYVVL 341
              +V  P  L    L D  +A  C   + +
Sbjct: 1647 -EHVLEPM-LAAEELKDHAIAYGCSENITI 1674

>TDEL0E04230 Chr5 complement(789369..795041) [5673 bp, 1890 aa] {ON}
            Anc_5.206 YJL005W
          Length = 1890

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 309
            L+ V+DV+      +++P+I+   DIS +  LTKAD +L++   K   Y +     DI
Sbjct: 1398 LDGVVDVSRAVGFFDLLPHIHASPDIS-LVTLTKADEMLIVATHKLWEYMDFETACDI 1454

>Kpol_534.51 s534 (129416..135307) [5892 bp, 1963 aa] {ON}
            (129416..135307) [5892 nt, 1964 aa]
          Length = 1963

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 309
            L+  +DV+      +++P+I+   DIS + KLTKAD +LVI   K   Y +     DI
Sbjct: 1468 LDGGVDVSRAVGFFHLLPHIHASPDIS-VVKLTKADEILVIATHKLWEYMDYETACDI 1524

>TPHA0D04030 Chr4 (850344..858032) [7689 bp, 2562 aa] {ON} Anc_3.443
            YPR117W
          Length = 2562

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 4/59 (6%)

Query: 11   HFEGFMPIHTIFYSIFHPTEGTKVCYE----FPPKNLSNFHINFDTIKNYIIPKNQLCN 65
            H+   MP+  IF+ +  P  G  V  E    F P      HI  D + NY+ PKN+  +
Sbjct: 2273 HYTKDMPMLEIFWLLSSPVGGISVLEEMIVSFQPIIFRMDHITADKLMNYLFPKNETAD 2331

>Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {ON}
           complement(64627..67593) [2967 nt, 989 aa]
          Length = 988

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 10/79 (12%)

Query: 192 VTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLIN 251
           VT  S+Q  + ++ Q+L+ +   L PI+K   +NI+ +P L   P  + +L + P     
Sbjct: 756 VTTDSIQQ-VAKVKQELDTFVGSLSPIEKNGGVNIESYPKLAQKPGVMSTLINFPFQ--- 811

Query: 252 LNNVIDVNWDPTMLNIVPY 270
                 V++  + L  VPY
Sbjct: 812 ------VHYSGSSLPGVPY 824

>TBLA0C03630 Chr3 (860550..867713) [7164 bp, 2387 aa] {ON} Anc_5.206
            YJL005W
          Length = 2387

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 252  LNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQ 311
            L+  +DV+      +++P+I+   DIS +  LTK+D +LVI   K   Y N     DI +
Sbjct: 1897 LDGSVDVSRAVGFFDLLPHIHASPDISMVT-LTKSDQMLVIATHKLWEYVNYETACDIAR 1955

Query: 312  FSNVYAPTSLICSFLTDQEMATQCQNYVVL 341
              +  +   L    L D  +A  C + + +
Sbjct: 1956 EKS--SDPMLAAEELKDHAIAYGCSDNITI 1983

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,029,606
Number of extensions: 2508842
Number of successful extensions: 8073
Number of sequences better than 10.0: 43
Number of HSP's gapped: 8306
Number of HSP's successfully gapped: 95
Length of query: 612
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 496
Effective length of database: 40,180,143
Effective search space: 19929350928
Effective search space used: 19929350928
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)