Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H008606.25ON75575538520.0
NDAI0D008506.25ON79077622610.0
KNAG0M012306.25ON73875820510.0
Suva_15.1766.25ON74575820360.0
KAFR0G026606.25ON73575520270.0
SAKL0E01452g6.25ON73776120260.0
YOR001W (RRP6)6.25ON73376319850.0
Kpol_1037.296.25ON74676719730.0
ZYRO0C07678g6.25ON74176119600.0
TDEL0G044406.25ON73575319500.0
Smik_15.1706.25ON77374919410.0
CAGL0E02585g6.25ON73775419210.0
Skud_15.1626.25ON73476319090.0
TPHA0J003706.25ON74375518830.0
KLLA0D01309g6.25ON74475918470.0
ACL001C6.25ON74557617540.0
TBLA0A071706.25ON77176417490.0
Ecym_30306.25ON74776117180.0
Kwal_56.224476.25ON73576016880.0
KLTH0C11066g6.25ON73578216430.0
NCAS0B011608.707ON217155714.1
KAFR0G004208.860ON37473716.5
ZYRO0D06842g8.276ON23853697.2
KNAG0B036005.543ON634135708.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H00860
         (755 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...  1488   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   875   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   794   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   788   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   785   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   785   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   769   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   764   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   759   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   755   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   752   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   744   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   739   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   729   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   716   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   680   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   678   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   666   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   654   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   637   0.0  
NCAS0B01160 Chr2 complement(193743..194396) [654 bp, 217 aa] {ON...    32   4.1  
KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860     32   6.5  
ZYRO0D06842g Chr4 (591212..591928) [717 bp, 238 aa] {ON} similar...    31   7.2  
KNAG0B03600 Chr2 (695025..696929) [1905 bp, 634 aa] {ON} Anc_5.5...    32   8.4  

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score = 1488 bits (3852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 723/755 (95%), Positives = 723/755 (95%)

Query: 1   MSEQSQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVL 60
           MSEQSQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVL
Sbjct: 1   MSEQSQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVL 60

Query: 61  LSIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDE 120
           LSIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDE
Sbjct: 61  LSIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDE 120

Query: 121 FSGRDLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPM 180
           FSGRDLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPM
Sbjct: 121 FSGRDLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPM 180

Query: 181 HYPQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAV 240
           HYPQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAV
Sbjct: 181 HYPQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAV 240

Query: 241 DLEHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDI 300
           DLEHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDI
Sbjct: 241 DLEHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDI 300

Query: 301 IWLQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKA 360
           IWLQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKA
Sbjct: 301 IWLQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKA 360

Query: 361 MHAYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLV 420
           MHAYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLV
Sbjct: 361 MHAYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLV 420

Query: 421 YSPIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAY 480
           YSPIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAY
Sbjct: 421 YSPIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAY 480

Query: 481 TPIDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGH 540
           TPIDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGH
Sbjct: 481 TPIDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGH 540

Query: 541 DLSQKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGK 600
           DLSQKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGK
Sbjct: 541 DLSQKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGK 600

Query: 601 IQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEM 660
           IQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEM
Sbjct: 601 IQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEM 660

Query: 661 IEKPEDLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXXXXXXXXXX 720
           IEKPEDLDEVIVLR              REEPELEIIDYFKTAKVLT             
Sbjct: 661 IEKPEDLDEVIVLRKTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKNSRGGRNNNG 720

Query: 721 XXXXXFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755
                FDPYSAANEGPAAPKKRKNVTRGKNVSFKR
Sbjct: 721 NKRKRFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  875 bits (2261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/776 (60%), Positives = 551/776 (71%), Gaps = 25/776 (3%)

Query: 2   SEQSQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLL 61
           + + Q  +  LLP+VV TVRA+ ALAAQDVDFYRS+DK  A +L+++++Q+ADMINSVLL
Sbjct: 18  ANEKQSPKDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLL 77

Query: 62  SIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEF 121
           ++DENSE +DGTKENLED WKDF NLMDNL EKSDRS+D++ R    +   S MQY+DE+
Sbjct: 78  AVDENSETLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEY 137

Query: 122 SGRDLTPGKQ--ILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSP 179
           SGRD T  K+  I KPQL+F  P+DNTE+HPFIPLLK KP ALK L+ES+Q++P DE  P
Sbjct: 138 SGRDDTSSKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVP 197

Query: 180 MHYPQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIA 239
            HY QPYEYEID+Q YND ILQ  DPIPS  W +   IWVDT   LQS++ DL   TE A
Sbjct: 198 EHYAQPYEYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFA 257

Query: 240 VDLEHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMD 299
           VDLEHHDYRTYYGI CLMQISTR  DY++DTL LR  LQ LN  F NP ITKV HGAFMD
Sbjct: 258 VDLEHHDYRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMD 317

Query: 300 IIWLQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSK 359
           IIWLQRDLGLY+V LFDTFHASRA+G PK+SLAYLLEKF+ FKTSKKYQ+ADWRIRPLSK
Sbjct: 318 IIWLQRDLGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSK 377

Query: 360 AMHAYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGL 419
           AM++YAR+DTHFLLNIFDQMRN L++  KLAGVLKESRNVAKRRFEY  +RP  L T+  
Sbjct: 378 AMNSYARSDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRP--LITSSA 435

Query: 420 VYSPIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVA 479
           VYSPIEK DPWKT+M+QYNIP  KE LLKELYQWRDKIARRDDESPR++MPNQLLVSLVA
Sbjct: 436 VYSPIEKIDPWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVA 495

Query: 480 YTPIDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEE-----GISV 534
           Y P++  GVVSVSN VTD+VRSNSKILANLIKNCL K+KD    D+ + ++     G S 
Sbjct: 496 YAPVEPAGVVSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTST 555

Query: 535 VPETGHDLSQKLTIHQLQNLKSKFQLLSDKFN------NSVKTRLSNHDQLYLFDGISFA 588
              T  DLS++L+IHQL  LKS+F  L  K N      N+ +     +  L   D +SF 
Sbjct: 556 T-TTNVDLSEQLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFN 614

Query: 589 DDVT---IKYFA--DGKIQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDN 643
           D+     IKY    D K + T E+  +R E FD AM+QL++VEY IP+ E      + + 
Sbjct: 615 DEDGKNFIKYSVSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQ 674

Query: 644 IPPITVATNAEGQVNEMIEKPEDLDEVIVLRXXXXXXXXXXXXXXR---EEPELEIIDYF 700
             P   A NAE        K EDLDE+IVL+                  +E E+E+IDY 
Sbjct: 675 QEPSIPAANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYS 734

Query: 701 KTAKVL-TXXXXXXXXXXXXXXXXXXFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755
           K  KVL                    FDPY+  NEGP APKKRK +TRGKNVSFKR
Sbjct: 735 KMEKVLDNSNTKRNQNKNNNGNKRKRFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/758 (53%), Positives = 530/758 (69%), Gaps = 32/758 (4%)

Query: 7   EQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDEN 66
           E++K LL K V TVRA+S+L  QDV F+ ++D ++A S+++  N++ +MIN +L SIDEN
Sbjct: 4   EEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDEN 63

Query: 67  SEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSG--MQYIDEFSGR 124
           S+    + E + + W+DF NL DNLFEKSDRS+DII +G    NGQ+G  +QY+D+  G 
Sbjct: 64  SKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQG-TRKNGQAGSEVQYLDDLVGN 122

Query: 125 DLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQ 184
           D + GK+I KPQL F+ P+DN+ES PF PLL EKP ALKPL+ES+QM+P  E  P HYP 
Sbjct: 123 DSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPN 182

Query: 185 PYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEH 244
           PY+YEI +QEYN+ IL+ + PIPST W ++EP+WVD+   LQS++ DL+   E+A+DLEH
Sbjct: 183 PYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEH 242

Query: 245 HDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQ 304
           HDYR+YYGI CLMQISTR  DYL+DT+ALR++L ILN VF +PM+TKVFHGAFMDIIWLQ
Sbjct: 243 HDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQ 302

Query: 305 RDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAY 364
           RDLGLY+V LFDTFHAS+A+G PKHSLAYLLE  A FKTSKKYQLADWRIRPLSK M  Y
Sbjct: 303 RDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVY 362

Query: 365 ARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPI 424
           ARADTHFLLNIFDQMRN LI+ NKLAGVL ESR VAKRRFEYS FRPK+ Q +  V++PI
Sbjct: 363 ARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPD--VFTPI 420

Query: 425 EKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPID 484
           EK+ PW+T+MFQYN+ P+KE L+K LY+WRD IARRDDESPR++MPNQLL+SL AYTP D
Sbjct: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480

Query: 485 APGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQ 544
              +VSV++ VTD VRSNSK+LANLIK+         F++++      S  P T +  + 
Sbjct: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKS---------FVESSKLGPQSSYTPNTENTSTP 531

Query: 545 -KLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGKIQT 603
             LT+ Q++++  +F  L++ F +S   ++S   +   F  +S    VT+ Y  D K   
Sbjct: 532 FVLTLSQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGDLS-KGKVTVSY-NDAKTTP 589

Query: 604 TAEQYKE-RSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEMIE 662
            ++   E RS+QF++ MK   ++EY IP I E        ++P  +  T+ E   ++ +E
Sbjct: 590 VSQSVLESRSKQFNEYMKAFGDIEYKIPSIVEPVM-----DLPIPSGTTSTESADSKTVE 644

Query: 663 KP-----EDLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXXXXXXX 717
           KP     ED+DE++VL+               E+ E EI+DY K  KVL           
Sbjct: 645 KPPKNIKEDMDEIVVLKKVKRELPKPKGND--EDAEREIVDYSKEDKVLV--QRQFDKKK 700

Query: 718 XXXXXXXXFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755
                   FDP+SA +EGP APKKRK VT+GKN SFKR
Sbjct: 701 KNNNNKKRFDPFSAISEGPKAPKKRKAVTKGKNASFKR 738

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/758 (53%), Positives = 522/758 (68%), Gaps = 39/758 (5%)

Query: 5   SQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSID 64
           + E    LL KVVN +RAAS+LAAQDVDFYR++D+D +  L+  S+++ +M+N ++LSID
Sbjct: 20  ASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSID 79

Query: 65  ENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGR 124
           E+ + ++  +E + D+WKDFGN+MDNL EKSD S+D + R    +N  + +QY+ +FSG+
Sbjct: 80  EHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSGK 139

Query: 125 DLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQ 184
           D  P K++ KPQLKF TPIDN+ESHPFIPLLKEKP ALKPL +S++MI  +E SP HYP 
Sbjct: 140 DSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYPH 199

Query: 185 PYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEH 244
           PYEYEIDHQEYN  ILQ K  IPS  W  +EPIW+++ + L+S++ DL+ + EIAVDLEH
Sbjct: 200 PYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLEH 259

Query: 245 HDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQ 304
           HDYR+YYG+ CLMQ+STR+ DYL+DTL LREDL ILN VF NP I KVFHGAFMDIIWLQ
Sbjct: 260 HDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWLQ 319

Query: 305 RDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAY 364
           RDLGLYVVGLFDT+HAS+A+GLP+HSLAYLLE FA FKTSKKYQLADWRIRPLSK M AY
Sbjct: 320 RDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAY 379

Query: 365 ARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPI 424
           ARADTHFLLNI+DQ+RN LIE NKLAGVL ESRNVAKRRFEYS +RP  +  +  VYSP 
Sbjct: 380 ARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRP--ITPSSKVYSPT 437

Query: 425 EKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPID 484
           EK++PW+ +M+QYNI P++E L+K+LY+WRD IARRDDESPRF+MPNQLL +LVAYTPID
Sbjct: 438 EKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPID 497

Query: 485 APGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLS- 543
             GVVS+SN VTD+VR N+KILANLIK+ L  MKD         +E   +V       S 
Sbjct: 498 VIGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTH-------KESAEIVSSKFKSASL 550

Query: 544 QKLTIHQLQNLKSKFQLLSDKFNNSVK--TRLSNHDQLYLFDGISFADDVTIKYFADG-K 600
           + +T+ Q++++  +F + S   +NSV     + +     LF  I   ++  I Y   G  
Sbjct: 551 EAITVSQIRDIMDRFSVFS---SNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLP 607

Query: 601 IQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEM 660
            +   E  ++R+++F+ A+  LE++++ +                P+ V  +   ++   
Sbjct: 608 HKVKVEDMRDRAQRFNSALVGLEDIKFEVE--------------KPVNVEKSEMVKIETT 653

Query: 661 IEKP---EDLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXXXXXXX 717
            E P   ED DEV+VL+               +    E +DY K   VL+          
Sbjct: 654 PEPPTKIEDPDEVVVLKKKRIHKKQVAKRS--DVAAEEAVDYSKIPNVLS----SKPGQN 707

Query: 718 XXXXXXXXFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755
                   FDP    +EGP APKK++  TRGKNVSFKR
Sbjct: 708 NKQQRKRRFDPSFNDSEGPRAPKKKRPTTRGKNVSFKR 745

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/755 (53%), Positives = 522/755 (69%), Gaps = 30/755 (3%)

Query: 7   EQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDEN 66
           E++K LL  VVNTVRA+S LAAQDVDFYRS+D +++HS+ + ++++ DM+NS++LSIDEN
Sbjct: 4   EEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDEN 63

Query: 67  SEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGRDL 126
            E +D  KE L + WK   N++DNLFEKSDRS+DI+  G          +Y +  +  + 
Sbjct: 64  YETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTEN 123

Query: 127 TPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPY 186
            P K+I KPQLKF  PIDN+ESHPFIPLLKEKP ALK ++ES ++I  DE  P HY  PY
Sbjct: 124 IPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPY 183

Query: 187 EYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHD 246
           EYEID+Q YND ILQ ++PIPS SW++ E +WVD V  L  ++ D++  TEIA+DLEHHD
Sbjct: 184 EYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHD 243

Query: 247 YRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRD 306
           YRTYYGI CLMQISTR+ DYL+DT+ALR DL++LN VF +P + KV HGAFMDIIWLQRD
Sbjct: 244 YRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRD 303

Query: 307 LGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYAR 366
           LGLY+V LFDTFHASRA+G P+HSLAYLLE+FA FKTSKKYQLADWR+RPLSKAM AYAR
Sbjct: 304 LGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYAR 363

Query: 367 ADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEK 426
           ADTHFLLNI+DQ+RN L+E NKL GVL ESRNVAKRRFEYS FRP+V   N  VYS +EK
Sbjct: 364 ADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPN--VYSALEK 421

Query: 427 DDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAP 486
           +DPW+T+MFQYNIP ++E LLK L++WRD IARRDDESPR++MPNQL+V+LVAYTP D  
Sbjct: 422 EDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPA 481

Query: 487 GVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDN----KFLDNNVAEEGISVVPETGHDL 542
           GV+S S  VTDYVRSNSKI+ANLIKN L + KD     +F+ +N   E         +  
Sbjct: 482 GVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRE--------SYRS 533

Query: 543 SQKLTIHQLQNLKSKFQLLSDKFN--NSVKTRLSNHDQLYLFDGISFADDVTIKYFADGK 600
           + K+T+ Q++   S F  +++K    N+ + +  +  +   F  +S   D+ I+Y    K
Sbjct: 534 TDKMTVSQIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDI-IEYKNGEK 592

Query: 601 IQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEM 660
                +Q   R   +   + +L  V Y +PV +E  Q Q +D++  +     A+     +
Sbjct: 593 HSVKQQQLVSRFNTYTKQVNELTNVRYELPVHKEPPQLQ-KDDVEEVKKTIIADS----I 647

Query: 661 IEKPE-DLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXXXXXXXXX 719
             KPE DLDEV+VL+               E  +++ IDY K+ K+L             
Sbjct: 648 PAKPEIDLDEVVVLK---KVNRQPNKTKLEENEKIDFIDYSKSEKIL----KGDKQRKKR 700

Query: 720 XXXXXXFDPYSAANEGPAAPKKRKNVTRGKNVSFK 754
                 FDP++A+NEGP A +KRK+ TRG+N+S+K
Sbjct: 701 ESKKRQFDPFAASNEGPKAARKRKSGTRGRNLSYK 735

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/761 (52%), Positives = 527/761 (69%), Gaps = 37/761 (4%)

Query: 5   SQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSID 64
           S ++   LL  +V TVRAASAL+AQD+DF++S+D  I+ S+E SS+++ ++IN VLLSID
Sbjct: 2   SSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSID 61

Query: 65  ENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGR 124
           EN++ ++  K+N ++ WKD G++MDNLFEKSD + D + R +  + G S +QY+D+ S  
Sbjct: 62  ENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKR-NSINQGNSNVQYLDDSSRS 120

Query: 125 DLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQ 184
           +L P K+I KPQL F TPIDNTESHPF PLL+ KP AL+PL E ++  PE E  P HYP 
Sbjct: 121 NLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPH 180

Query: 185 PYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEH 244
           PY YEID QEYN+ ILQ +DPIPS  W D +P+WVDT   LQ ++ +L ++ EIAVDLEH
Sbjct: 181 PYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEH 240

Query: 245 HDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQ 304
           HDYR+YYGI CLMQISTR+ D+L+DT+ALRE+L +LN +F +P + KVFHGAFMDIIWLQ
Sbjct: 241 HDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQ 300

Query: 305 RDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAY 364
           RDLG+YVV LFDT+HASR++GLP+HSLAYLLEKFAQFKTSKKYQLADWRIRPL+K M AY
Sbjct: 301 RDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAY 360

Query: 365 ARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPI 424
           ARADTHFLLNI+DQ+RNSLIEQNKLA VL +SRNVAKRRFEY+SFRPK++  +  V+SPI
Sbjct: 361 ARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSAD--VFSPI 418

Query: 425 EKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPID 484
           EKD+PW+ +M+QYNIP  +EPL+++LY+WRD IARRDDESPR+VMPNQLLVSLVA  P D
Sbjct: 419 EKDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTD 478

Query: 485 APGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQ 544
             GV+SVSN +TDYVRSNSK+L+NLIK  L  +K+     NN    G S + E   DLSQ
Sbjct: 479 PAGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNA---GSSQLEEK--DLSQ 533

Query: 545 KLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGIS-FADDVTIKYFADGKIQT 603
            L+I Q+QN+  +F  L+ K   +     S      LFDG   F++D  + Y  + KI  
Sbjct: 534 VLSISQIQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVI 593

Query: 604 TAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEMIEK 663
              Q +ER  +  + +K+++E ++ + V   N  T++ D +       +   + +E    
Sbjct: 594 DENQLQERKLEVSEKLKEVQEPDFRLHV---NVTTKETDEVSKDVSEKDDVNRASETDPL 650

Query: 664 PEDLDEVIVLRXXXXXXXXXXXXXXREEPE----------LEIIDYFKTAKVLTXXXXXX 713
             + DE+IVL+              R EP+          +E +DY    K+L       
Sbjct: 651 ETNKDEIIVLK-----------KKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLG----NS 695

Query: 714 XXXXXXXXXXXXFDPYSAANEGPAAPKKRKNVTRGKNVSFK 754
                       FDPY++ N GP + KKRK  T GKN+SFK
Sbjct: 696 KKSSKQKTTKRRFDPYTSENVGPQSAKKRKKPTPGKNMSFK 736

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/763 (51%), Positives = 527/763 (69%), Gaps = 43/763 (5%)

Query: 5   SQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSID 64
           + E    LL +V+N VRAAS+LA+QDVDFY+++D+  +  L+  ++++ADM N ++LSID
Sbjct: 2   TSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSID 61

Query: 65  ENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGR 124
           E+ E  +  +E++ D+W +FGN+MDNL E SD S+D +       +  S +QY+ EFSG+
Sbjct: 62  EHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSGK 121

Query: 125 DLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQ 184
           + +P K++ KPQLKF +PIDN+ESHPFIPLLKEKP ALKPL ES++++ +DE +P HYP 
Sbjct: 122 NFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPH 181

Query: 185 PYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEH 244
           PYEYEIDHQEY+  ILQ ++ IPS SW D+ PIWVDT ++L+S++ DL+ + EIAVDLEH
Sbjct: 182 PYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEH 241

Query: 245 HDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQ 304
           HDYR+YYGI CLMQISTR+ DYL+DTL LRE+L ILN VF NP I KVFHGAFMDIIWLQ
Sbjct: 242 HDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQ 301

Query: 305 RDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAY 364
           RDLGLYVVGLFDT+HAS+A+GLP+HSLAYLLE FA FKTSKKYQLADWRIRPLSK M AY
Sbjct: 302 RDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAY 361

Query: 365 ARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPI 424
           ARADTHFLLNI+DQ+RN LIE NKLAGVL ESRNVAKRRFEYS +RP  L  +  VYSPI
Sbjct: 362 ARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRP--LTPSSEVYSPI 419

Query: 425 EKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPID 484
           EK+ PWK +M+QYNIPP++E L++ELYQWRD IARRDDESPRFVMPNQLL +LVAYTP D
Sbjct: 420 EKESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTD 479

Query: 485 APGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISV-VPETGHD-- 541
             GVVS++N VT++VR N+K+LANLI++ L  +K       N  EE   +   ET  D  
Sbjct: 480 VIGVVSLTNGVTEHVRQNAKLLANLIRDALRNIK-------NTNEEATPIPSSETKADGI 532

Query: 542 LSQKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADG-- 599
           L + +++ Q++++  +F +L +   +  + +   +  + L   I   ++  I Y  DG  
Sbjct: 533 LLETISVPQIRDVMERFSVLCNSNISKSRAKPVTNSSI-LLGKILPREEHDIAYSKDGLP 591

Query: 600 -KIQTTAEQYKERSEQFDDAMKQLEEVEY------CIPVIEENKQTQDQDNIPPITVATN 652
            K++T  E  + R++ F  A+  LE++ +       +PV  E  +T D  + P      N
Sbjct: 592 NKVKT--EDIRIRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAP------N 643

Query: 653 AEGQVNEMIEKPEDLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXX 712
              ++       ++LD+++VL+              +   E + +DY K   +L+     
Sbjct: 644 HSPEI-------DNLDDLVVLK--KKNIQKKQPAKEKGVTEKDAVDYSKIPNILS----N 690

Query: 713 XXXXXXXXXXXXXFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755
                        FDP S+ + GP A KKR+   +GKN+SFKR
Sbjct: 691 KPGQNNRQQKKRRFDPSSSDSNGPRAAKKRRPAAKGKNLSFKR 733

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/767 (51%), Positives = 521/767 (67%), Gaps = 38/767 (4%)

Query: 5   SQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSID 64
           S++  K LL  VV+TVRAAS+LAAQDVDFYR++DK+I+ SL +SS +I +MIN++LLSI+
Sbjct: 2   SEDINKELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSIN 61

Query: 65  ENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGR 124
           EN+E+++  KE LE  WKDF N+MDNLFEKSDRS+DIITR    ++ +S  QY+ + +  
Sbjct: 62  ENNEELESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQS 121

Query: 125 DLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQ 184
           D  P K++ KPQL+F+ P+DN+ES PF+PLL +KP ++K   +S+ +IPE E  P HY  
Sbjct: 122 DSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAH 181

Query: 185 PYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEH 244
           PYE EID QEYN  +LQ  +P+ S  W ++E  WVDT   LQS++  L+  TEIAVDLEH
Sbjct: 182 PYEVEIDKQEYNASVLQVAEPLKSQPW-NSESTWVDTSEALQSMLDKLKECTEIAVDLEH 240

Query: 245 HDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQ 304
           HDYR+YYGI CLMQISTRK D+L+DTLALR++L ILN VFA+P I KV HGAFMDIIWLQ
Sbjct: 241 HDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQ 300

Query: 305 RDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAY 364
           RDLGLYVV LFDT+HASRA+G P+HSLAYLLEK+A FKTSKKYQLADWR+RPLSK MHAY
Sbjct: 301 RDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAY 360

Query: 365 ARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPI 424
           ARADTHFLLNI+DQ+RN LI +NKLA VL ESRNVAKRRFEYS FRPKV   +  V++PI
Sbjct: 361 ARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKV--PSPAVFTPI 418

Query: 425 EKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPID 484
           EK++PW+T+++QYN+P  K  LLK +++WRD IARRDDESPR++MPNQL++SLV YTPID
Sbjct: 419 EKEEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPID 478

Query: 485 APGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQ 544
             GV+SVSN +TD+VRSNSK++ANLIK  L  MK       +V    ++      + + Q
Sbjct: 479 PAGVISVSNVMTDHVRSNSKVIANLIKKSLEDMK-------SVPAGALTAFQNIDYKIGQ 531

Query: 545 -----KLTIHQLQNLKSKFQLLSDKFNNSVKTR-LSNHDQLYLFDGISFADDVTIKYFAD 598
                KLTI Q+QN+ + F+ ++   N S+  + +S      LF  I  + +  + Y  D
Sbjct: 532 KFASDKLTISQIQNMTALFKEIAS--NPSIIEKDVSKKIDPILFSNIFLSKNEIVLYDHD 589

Query: 599 GKIQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIE------ENKQTQDQDNI--PPITVA 650
            +   T EQ   R+E+ +  M +       I +        E  + ++++ +  PPI+  
Sbjct: 590 KRHVVTNEQLAGRAEEVEGFMNEANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNV 649

Query: 651 TNAEGQVNEMIEKPEDLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXX 710
            NA     +     ED++++IVL+              +  P  E+IDY K   +L+   
Sbjct: 650 ENASSSNTDGF---EDMNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILSKEK 706

Query: 711 XXXXXXXXXXXXXXXFDPYSAAN--EGPAAPKKRKNVTRGKNVSFKR 755
                           DP+   N  EGP A KKRK + RGKNVSFKR
Sbjct: 707 RENSKKRKG-------DPFGEENGLEGPKAAKKRKQINRGKNVSFKR 746

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/761 (54%), Positives = 528/761 (69%), Gaps = 26/761 (3%)

Query: 1   MSEQSQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVL 60
           M+E+S EQ   LLPKVV TVRAA+ALAAQDVDFYRS+DK +A SL+++SN++  MINS L
Sbjct: 1   MAEESNEQ---LLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTL 57

Query: 61  LSIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDE 120
           L ID+NS  ++G KE LED  KDF NLMDNLFEKSDRS+DI+ RG       + + Y+D+
Sbjct: 58  LCIDQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDIL-RGRAPDRKGAALMYLDD 116

Query: 121 FSGRDLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPM 180
            +  D+ P K+ILKPQ++F  PIDNTE+HPF PLL+ KP AL+PL + ++++  DE  P 
Sbjct: 117 AARSDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPE 176

Query: 181 HYPQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAV 240
           HYPQPYEYEI++QEYN+ IL+  +PIPS  W  +EP+WVD    L S++ DL+ STEIAV
Sbjct: 177 HYPQPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAV 236

Query: 241 DLEHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDI 300
           DLEHHDYR+YYGI CLMQ+STR+ DYL+DTLALR+DL +LN VFANP+I KVFHGAFMDI
Sbjct: 237 DLEHHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDI 296

Query: 301 IWLQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKA 360
           IWLQRDLGLY+V LFDT+HASRA+G P+HSLAYLLE FA FKTSKKYQLADWR+RPLSKA
Sbjct: 297 IWLQRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKA 356

Query: 361 MHAYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLV 420
           M AYARADTHFLLNI+DQ+RN LI +NKLAGVL ESRNVAKR F+YS +RPKV   N  V
Sbjct: 357 MSAYARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKV--PNSSV 414

Query: 421 YSPIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAY 480
           YSP+++ D WK +M QYNIP +KE L+K LY+WRD IARRDDESPR+VMPNQLL  LV Y
Sbjct: 415 YSPVDRADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDY 474

Query: 481 TPIDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGH 540
           TP+D  GV+SVS +VTD+VR+N+K LANLI   L ++ D     +++  E  SV  +  H
Sbjct: 475 TPLDPTGVISVSPTVTDHVRTNAKALANLIVKSLQQIAD---AGSDIKVE--SVQHKDQH 529

Query: 541 DLSQKLTIHQLQNLKSKFQLLSDKFNN-SVKTRLSNHDQLYLFDGISFADDVTIKYFADG 599
           DLSQ LT+ Q+++  S+F  LS  F   S  T  SN     +F  I  A    + Y    
Sbjct: 530 DLSQVLTVGQIESQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNILHAPCGFVGYGRSL 589

Query: 600 KIQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQ---TQDQDNIPPITVATNAEGQ 656
           K   T +Q ++R  +  +A+ +  + E    + EE++    T +  +   ++    ++ +
Sbjct: 590 KKPVTDKQIEKRKLELSEAL-EFIDAETATTIQEEDRGSELTHEPADDKKVSENDESKKE 648

Query: 657 VNEMIEKPEDLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXXXXXX 716
             +  E  ED +E+I L+                EPE E IDY K+ K+L          
Sbjct: 649 EAKETEPEEDKNEIITLK-KVKDRGKKSKRSNESEPE-EPIDYKKSKKILE------TEK 700

Query: 717 XXXXXXXXXFDPYSAANEGPAA--PKKRKNVTRGKNVSFKR 755
                    FDPY+A+N+   A  PKK++ + RGK+ SFKR
Sbjct: 701 KSKSTKKRAFDPYAASNDAGNAPKPKKKRRMARGKSASFKR 741

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/753 (52%), Positives = 507/753 (67%), Gaps = 27/753 (3%)

Query: 8   QEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDENS 67
           +E  LL KVV+T+RA+SALAAQDVDF+RS+ + I  SL+++S ++  +INS+L SID+NS
Sbjct: 5   EEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNS 64

Query: 68  EQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGRDLT 127
           E +   KE L + WKDF N+MDNLFE SD S DI+TR  G       ++++D  S  D  
Sbjct: 65  EPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSI 124

Query: 128 PGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPYE 187
           P K+I KPQL F  P++NTE  PF+PLLKEKPFAL+PL     ++P ++  P HY QPYE
Sbjct: 125 PSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLIS--DIVPGNDAVPEHYAQPYE 182

Query: 188 YEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHDY 247
           YEI+HQEY + ++ K +PIPS  W   E +WVD +  L++++ DL++ TEIAVDLEHHDY
Sbjct: 183 YEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDY 242

Query: 248 RTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRDL 307
           R+YYGI CLMQISTR+ DYLIDT+ALR+DLQILN VFANP I KVFHGAFMDIIWLQRDL
Sbjct: 243 RSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDL 302

Query: 308 GLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYARA 367
           GLYVV LFDTFHASRA+GLP+HSLAYLLEKFA FKTSKKYQLADWR+RPLSKAM+AYARA
Sbjct: 303 GLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARA 362

Query: 368 DTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEKD 427
           DTHFLLNI+DQ+RN+LIEQNKLAGVL ESRNVAKRRFEYS FRP  +  +  VY PI+K 
Sbjct: 363 DTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRP--IAPSPTVYCPIDKP 420

Query: 428 DPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAPG 487
           DPWK +MFQY+I P +E L+K+LY WRD IARRDDESPR+VMPNQLLV L    P +   
Sbjct: 421 DPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPIN 480

Query: 488 VVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQKLT 547
           V+SV++ VTD+VRSNS +LA+LIKN LA         +  +++G         D +  LT
Sbjct: 481 VISVNSIVTDHVRSNSLVLAHLIKNTLAS-------SDKESDKGTFEADNNSTDAASLLT 533

Query: 548 IHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGKIQTTAEQ 607
           + Q+Q L + F  +S  F   ++    +     +F  I  ++D  + Y  +     T ++
Sbjct: 534 VPQIQKLAACFAGVSRAF-TILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKE 592

Query: 608 YKERSEQFDDAMKQLEEV-EYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEMIEKP-E 665
             +R+ +   +M+Q +E   Y +P+ E  K++   + I P      A  +V E    P E
Sbjct: 593 LGKRAAKALQSMEQFDEATSYYMPIPEIAKESNTMEEIRP-----PAPEEVKESPSPPKE 647

Query: 666 DLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXXXXXXXXXXXXXXX 725
           D+DE+I L+                E E+  +DY KT KVL                   
Sbjct: 648 DMDEIITLKKIKKQKSQSPKELGISEREIPAVDYTKTKKVLATNQDKNKDKKKRKFD--- 704

Query: 726 FDPYSAAN---EGPAAPKKRKNVTRGKNVSFKR 755
             PY+A+N   + P APKKRK V R +NVSFKR
Sbjct: 705 --PYAASNHSSDAPRAPKKRKPVNRERNVSFKR 735

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/749 (52%), Positives = 513/749 (68%), Gaps = 27/749 (3%)

Query: 11  TLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDENSEQV 70
            LL KVVN +RAAS+LA QDVDFY+++D++    L+  S+++ADM N ++LSIDE+ E  
Sbjct: 48  VLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESF 107

Query: 71  DGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGRDLTPGK 130
           +   E++  +W DFGN+MDNL E SD S+D + R        + +QY+ +FS ++L+P K
Sbjct: 108 ELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSEKNLSPAK 167

Query: 131 QILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPYEYEI 190
           ++ KPQLKF TPIDN+ESHPFIPLLKEKP ALKPL +S+++I ED+ +P HYP PYEYEI
Sbjct: 168 RVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEI 227

Query: 191 DHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHDYRTY 250
           DHQEY   ILQ +  IPS SW D+EPIW+DT+ +L+S++ +L+   EIAVDLEHHDYR+Y
Sbjct: 228 DHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSY 287

Query: 251 YGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRDLGLY 310
           YGI CLMQISTR+ DYL+DTL LRE L ILN VF +P I KVFHGAFMDIIWLQRDLGLY
Sbjct: 288 YGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLY 347

Query: 311 VVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYARADTH 370
           VVGLFDT+HAS+A+GLP+HSLAYLLE FA FKTSKKYQLADWRIRPLSK M AYARADTH
Sbjct: 348 VVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTH 407

Query: 371 FLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEKDDPW 430
           FLLNI+DQ+RN LIE NKLAGVL ESRNVAKRRFEYS +RP++  +   VYSPIEK+ PW
Sbjct: 408 FLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSE--VYSPIEKEAPW 465

Query: 431 KTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAPGVVS 490
           + +M+QYNI  +KE L+K+LYQWRD IARRDDESPRFVMPNQLL +LVAYTPID  GV+S
Sbjct: 466 RVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVIS 525

Query: 491 VSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVA-EEGISVVPETGHDLSQKLTIH 549
           ++N +T++VR N+K+L NLIKN L  +KD    D+ V   E +     T     + +TI 
Sbjct: 526 LTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESM-----TNEVSLEAITIP 580

Query: 550 QLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDG-ISFADDVTIKYFADG-KIQTTAEQ 607
           Q++++  +F +LS+  +N    R  N     +  G I   ++  I Y  +G   +   E 
Sbjct: 581 QIRDIMERFSVLSN--SNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFED 638

Query: 608 YKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPI-TVATNAEGQVNEMIEKPED 666
            + R++ F+ A+  LE+   C+  +E  K      N+  I  + T    + +  IE P  
Sbjct: 639 IRARAQSFNSALSNLED---CM--LEVEKPHILPTNVKKIERINTEDVPKHSATIENP-- 691

Query: 667 LDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXXXXXXXXXXXXXXXF 726
            D+++VL+              ++    + IDY K   VL+                   
Sbjct: 692 -DDIVVLK--KKNIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKSDQNRRQQKKRRS---- 744

Query: 727 DPYSAANEGPAAPKKRKNVTRGKNVSFKR 755
           DP    ++GP A KK++  TRG+NVSFKR
Sbjct: 745 DPLFNDSDGPRAAKKKRPATRGRNVSFKR 773

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/754 (51%), Positives = 519/754 (68%), Gaps = 21/754 (2%)

Query: 5   SQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSID 64
           S +    +L KV+ TVRA++ALA+QDV+F++SID  +A+SLE+S   +A ++N++LLSID
Sbjct: 2   SSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSID 61

Query: 65  ENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGR 124
            N+E++DGT ENLE++ K+F N+MD LFEK+DRS+DI+ R    ++ +  MQ++D+ +  
Sbjct: 62  NNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVA 121

Query: 125 DLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQ 184
           +  P ++I KPQL F TP+DN+ESHPF PLL EKP ALK +EES Q++   E  P H+ Q
Sbjct: 122 ENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQ 181

Query: 185 PYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEH 244
           PYEYEI +QEYN+ IL+KK+PIPSTSW D   IWVD ++ LQ +M +L+ S+EIAVDLEH
Sbjct: 182 PYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEH 241

Query: 245 HDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQ 304
           HD+R+YYG+ CLMQISTR  DY++DT+ALR+DL++LN VF NP+ITKVFHGAFMDIIWLQ
Sbjct: 242 HDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQ 301

Query: 305 RDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAY 364
           RDLGLY+V LFDTFHAS+A+GLPKHSLAYLLEK+A FKTSKKYQLADWR RPLSKAM AY
Sbjct: 302 RDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAY 361

Query: 365 ARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPI 424
           ARADTHFLLNIFDQMRN LI   KLAGVL+ESRNVA RRFEYS ++PK+   N  +++P+
Sbjct: 362 ARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVAN--IFTPV 419

Query: 425 EKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPID 484
           EK+ PW+T+M+QYNIP  KEPL++ELY+WRD +ARRDDESPR+VMPNQLLVSLVAY P+D
Sbjct: 420 EKESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVD 479

Query: 485 APGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLD-NNVAEEGISVVPETGHDLS 543
              VVSVS+ VTD+VR NSK LANLIK  L ++K  +    NN     + V      D  
Sbjct: 480 PISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDV----SQDEL 535

Query: 544 QKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGKIQT 603
           Q L  H+++ +   F+ + ++   + K++ +    + L + I    +  +KY        
Sbjct: 536 QFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSE-ILLHPEHAVKYHNGSACSV 594

Query: 604 TAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEG--QVNEMI 661
              + K+R   +  A   L      I ++ E   +    N P  T  T+ +   Q+  + 
Sbjct: 595 EESELKDRYLSYIKAT--LLAASKNINMVLETSNS----NAPLETEETHNKKSDQIQVIP 648

Query: 662 EKPEDLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXXXXXXXXXXX 721
           EK ED+DE++VL+                +   E +DY K A +L               
Sbjct: 649 EKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSK-ANILA----SDNREVKKKD 703

Query: 722 XXXXFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755
               FDPYS+  EGP A KKR+ VT+GK +SFK+
Sbjct: 704 KKRVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 737

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/763 (50%), Positives = 509/763 (66%), Gaps = 46/763 (6%)

Query: 7   EQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDEN 66
           E    L  K+V  VRAAS+LA+QDVDFY++++++ ++ L+  S+++ DM+N ++LSIDE+
Sbjct: 4   ENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEH 63

Query: 67  SEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGRDL 126
            E  +  ++ +  +WKDFGN+MDNL E SD S+D +          + +QY+ +FSG+D 
Sbjct: 64  HESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKDS 123

Query: 127 TPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPY 186
              K++ KPQLKF   IDN+ESHPFIPLLKEKP ALKPL ES+++   +E +P HY  PY
Sbjct: 124 LSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYLHPY 183

Query: 187 EYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHD 246
            YEIDHQEY+  +LQ K  IPS SW D+EPIW+DT ++L  ++ DL+ ++EIAVDLEHHD
Sbjct: 184 AYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHD 243

Query: 247 YRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRD 306
           YR+YYGI CLMQ+STR+ DYL+DT+ LR+ L ILN VF +P+I KVFHGAFMDIIWLQRD
Sbjct: 244 YRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRD 303

Query: 307 LGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYAR 366
           LGLYVVGLFDT+HAS+A+GLP+HSLAYLLE FA FKTSKKYQLADWR RPLSK M AYAR
Sbjct: 304 LGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYAR 363

Query: 367 ADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEK 426
           ADTHFLLNI+DQ+RN LIE NKLAGVL ESRNVAKRRFEYS  RP+   +   VYSPIEK
Sbjct: 364 ADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSE--VYSPIEK 421

Query: 427 DDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAP 486
           ++PW+ +M+QYNI  +KE L+K+LY WRD IARRDDESPRFVMPNQLL +LVAY PID  
Sbjct: 422 ENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVI 481

Query: 487 GVVSVSNSVTDYVRSNSKILANLIKNCLAKMKD-NKFLDNNVAEE----GISVVPETGHD 541
           GVVS++N VT++VR N+K+LANLI+N L  +KD NK   +  + E    GIS+       
Sbjct: 482 GVVSLTNGVTEHVRQNAKVLANLIENALGNIKDTNKKTTSITSSESKPDGISL------- 534

Query: 542 LSQKLTIHQLQNLKSKFQLLSDK--FNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADG 599
             + +TI Q++++  +F LLS+    NN  KT  S    + L   + F ++  I Y   G
Sbjct: 535 --EVITISQIRDIMERFSLLSNSGVINNRTKTGDST-SSILLGKTLPF-EECGISYGKKG 590

Query: 600 KI-QTTAEQYKERSEQFDDAMKQLEEVEY------CIPVIEENKQTQDQDNIPPITVATN 652
              +   E  K R+++F+ A+  LE + +       +P   E  +  + ++ P       
Sbjct: 591 TPNKVKVEDIKARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEIESAP------- 643

Query: 653 AEGQVNEMIEKPEDLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXX 712
                 E+  K E  D++IVL               ++    E +DY K   VL+     
Sbjct: 644 ------ELPSKAESFDDIIVL--KKKKMHKKQPAKGKDMTVKEAVDYSKMPSVLS----S 691

Query: 713 XXXXXXXXXXXXXFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755
                        FDP S  +EGP A KK++   RGKN+SFKR
Sbjct: 692 KPGQNRKQQRKRRFDPSSNDSEGPRAAKKKRPAPRGKNMSFKR 734

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/755 (50%), Positives = 514/755 (68%), Gaps = 28/755 (3%)

Query: 12  LLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDENSEQVD 71
           LLP VV++VRAASALAAQDVDFYRS+DK+IA SL  +S ++ DMINS++ S+DENSE + 
Sbjct: 6   LLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLV 65

Query: 72  GTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDE---FSGRDLTP 128
             KENL++ WKD GNL+D+LFE +D SID +++    S+    M+Y+++   F   ++T 
Sbjct: 66  EGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVT- 124

Query: 129 GKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPYEY 188
             ++ KPQL F+ P+DN+E+HPF PLL +KP A+ PL+E ++++   E +P HYPQPYE 
Sbjct: 125 --RLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYET 182

Query: 189 EIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHDYR 248
           EID QEYN+ +LQ  DPIPS  W + E IWVD    L +++ +L+ +TE+AVDLEHHD+R
Sbjct: 183 EIDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFR 242

Query: 249 TYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRDLG 308
           +YYGITCLMQISTR  DYL+DT+ALR+ LQ+LN VF +P ITK+ HGAFMDIIWLQRDLG
Sbjct: 243 SYYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLG 302

Query: 309 LYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYARAD 368
           LY+V LFDT+HASRA+G P+HSLAYLLE+FA FKTSK+YQLADWR RPLSKAM+AYARAD
Sbjct: 303 LYIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARAD 362

Query: 369 THFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEKDD 428
           THFLLNIFDQ+RN LI+++KLA +L ESR VAKRRFEYS ++P +   +  V+SP E D 
Sbjct: 363 THFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTL--PSSAVFSPTESDM 420

Query: 429 PWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAPGV 488
           PW+++++QYNIP QK  L+K L++WRD IARRDDESPR++MPNQL+ SLV Y P +  GV
Sbjct: 421 PWRSMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGV 480

Query: 489 VSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQKLTI 548
           +SV+  +TD VRSN+K +ANLIK+ L  MK     +NN++   +S   +     S  L+ 
Sbjct: 481 ISVNRMMTDPVRSNAKAIANLIKSTLEDMK-----NNNISTTVVSTTAKDKETSSNDLST 535

Query: 549 HQLQNLKSKFQLLSDKF--NNSV---KTRLSNHDQLYLFDGISFADDVTIKYFADGKIQT 603
            Q++ + S+F+ + +K+  NNS     T     D L +F  I  + D  I Y    K   
Sbjct: 536 SQIKFIVSQFENILEKYSSNNSNLNDVTSKEGKDSL-VFSKIFNSRDDIITYDKGTKHLI 594

Query: 604 TAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEMIEK 663
           T +Q  +R ++ D AMKQ EE+ + + V + +K++  Q    P  V + +     E  E+
Sbjct: 595 TEQQLSDRQKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEE 654

Query: 664 PEDLDEVIVLRXXXXXXXXXXXXXXRE-EPELEIIDYFKTAKVLTXXXXXXXXXXXXXXX 722
            EDLDE+IVL+              R  + +  +IDY K  K+L+               
Sbjct: 655 QEDLDEIIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKILS------QDNRRRTPN 708

Query: 723 XXXFDPYSAANEGPA--APKKRKNVTRGKNVSFKR 755
              +DP+SA N   A    K+R+   + +NVSFKR
Sbjct: 709 KRKYDPFSADNNENALQGAKRRRPTAKNRNVSFKR 743

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/759 (50%), Positives = 507/759 (66%), Gaps = 24/759 (3%)

Query: 5   SQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSID 64
           S E + TLL  +V TVR++SALAAQD+DFY+S+D +I  SLE +S  I  +IN +LLSID
Sbjct: 2   SSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSID 61

Query: 65  ENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGR 124
            N++ +   K++  D WK   N+MDNLFEKSD ++D I  G+GG+ G   ++Y+++    
Sbjct: 62  PNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDRS 121

Query: 125 DLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQ 184
           +  P K+I KPQL F TP+DNTE HPF PLL+ KP +L+P E S++M+PE+E+ P HYP 
Sbjct: 122 NNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYPH 181

Query: 185 PYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEH 244
           PYEYEIDHQ+YND IL   +PIPS  W + E IWVDTV  L  +  +L  +TE+A+DLEH
Sbjct: 182 PYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLEH 241

Query: 245 HDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQ 304
           HDYR+YYGI CLMQIS R++D+++DT+ALRE+L ILN++F +P +TKV HGAFMDIIWLQ
Sbjct: 242 HDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWLQ 301

Query: 305 RDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAY 364
           RDLGLY+VGLFDT+HASR +G PKHSLAYLLE+FA FKTSKKYQLADWRIRPL+K M AY
Sbjct: 302 RDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLAY 361

Query: 365 ARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPI 424
           ARADTHFLLNIFD++RNSL+EQNK++ VL ESR VAKRRFEYSSFRPKV   +  V+SPI
Sbjct: 362 ARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKV--PSSAVFSPI 419

Query: 425 EKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPID 484
           EKD+PWK IMFQYNIP  KE LL+ LY+WRD IARRDDESPR+VMPNQLLVSLVA  P +
Sbjct: 420 EKDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTE 479

Query: 485 APGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQ 544
              V+SVS+ V++++R+NSK++ANLIK  L  +K N    N+ A   +      G DL+ 
Sbjct: 480 PINVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNS---NSSAIPLLESAESNGTDLAN 536

Query: 545 KLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFAD-DVTIKYFADGKIQT 603
            +T  Q++++++ F  L+ + N+       N ++  LF+GIS  D +  ++Y    +   
Sbjct: 537 IITTSQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLI 596

Query: 604 TAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEMI-- 661
              +  +R  +    ++Q    EY     +      ++D  P  T  +N E + NE+I  
Sbjct: 597 PQHELLKRQHEITRTLEQ----EYTDRQAQSIVLPSNEDEAP--TQVSNDENR-NEVITS 649

Query: 662 -----EKPEDLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXXXXXX 716
                E  E+ DEVI LR                    EI+DY   + +L          
Sbjct: 650 DPSQEEIEENKDEVITLRKRQSQSNNKRKTISPPASH-EIMDYAAGSDLLN---STKNNT 705

Query: 717 XXXXXXXXXFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755
                    FDPYS  + GP   KK+    +GKNVSFKR
Sbjct: 706 NSQKHKKRRFDPYSVEHVGPQPIKKKSKPAKGKNVSFKR 744

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/576 (56%), Positives = 416/576 (72%), Gaps = 7/576 (1%)

Query: 9   EKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDENSE 68
           E  L  ++V+T+RAA+AL+AQD+DFYRS+   +   L+ +S  +  +IN +LLS+DEN+ 
Sbjct: 6   EDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSVDENNN 65

Query: 69  QVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGRDLTP 128
           ++   ++N ED WK+  N+MDN+FEKSD + D I  G    N    MQY+ + S  D TP
Sbjct: 66  ELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSHDDSTP 125

Query: 129 GKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPYEY 188
            K+I KPQL F TP+DNTE HPF PLLKEKP ALKPLEES+ + PE+E  P HYP PYEY
Sbjct: 126 SKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYPHPYEY 185

Query: 189 EIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHDYR 248
           EID Q YND +L+ ++ I    W   EPIWVD V  L  ++ +L+   E+AVDLEHHDYR
Sbjct: 186 EIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLEHHDYR 245

Query: 249 TYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRDLG 308
           +YYGI CLMQIS+R  D+L+DT+ALR+DL +LN +  +P + KVFHGAFMD+IWLQRDLG
Sbjct: 246 SYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWLQRDLG 305

Query: 309 LYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYARAD 368
           LYVV LFDT+HASRA+G PKHSLAYLLE FA+FKTSKKYQLADWR+RPL K +  YAR+D
Sbjct: 306 LYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRDYARSD 365

Query: 369 THFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEKDD 428
           THFLL+I+D +RN+L++  KLA VL  SRNVAKRRFEY+SFRP++  +N  VYSPIE  +
Sbjct: 366 THFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSN--VYSPIESTE 423

Query: 429 PWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAPGV 488
           PW+ +M+QYN+PP KEPLLK+LY+WRD +ARRDDES R+VMPNQLLVSLV+ +P +  GV
Sbjct: 424 PWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSETAGV 483

Query: 489 VSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQKLTI 548
           +SVS  VTDYVRSN++ LANLIK  L  +K       +VAE   S       + +  L++
Sbjct: 484 LSVSTYVTDYVRSNARTLANLIKRTLETIKAGT---ASVAE--FSSSERALSNPAATLSL 538

Query: 549 HQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDG 584
           H +QNL   F+ L  +      +  S H    LF+ 
Sbjct: 539 HMIQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFNS 574

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/764 (47%), Positives = 489/764 (64%), Gaps = 27/764 (3%)

Query: 1   MSEQSQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVL 60
           MSE + E+   LL  +V  VRA++ALAAQDVDFY+S+DK ++ SL +++N   D+ NS+L
Sbjct: 26  MSEDNCEE---LLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLL 82

Query: 61  LSIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDE 120
           LSIDEN   ++  K+ + D W  F N+MDNL EKSD  ID +++ +  +   +   ++D 
Sbjct: 83  LSIDENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDN 142

Query: 121 FSGRDLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPM 180
            S  +  P K+I KPQL F+ P+DNT+S PF PLL EKP ALKPL++S+ ++PE    P 
Sbjct: 143 NSRTNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPT 202

Query: 181 HYPQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAV 240
           HY QPYEYEID+QEYN+ +++ +DP P   W     IW+DT   L  ++ DL   +EIAV
Sbjct: 203 HYLQPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAV 262

Query: 241 DLEHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDI 300
           DLEHHD R+YYGITCLMQISTR+ DY++DT++LR+DL +LN +F NP ITKVFHGA MDI
Sbjct: 263 DLEHHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDI 322

Query: 301 IWLQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKA 360
           IWLQRDLGLY+V LFDTFHAS+A+GL +HSLAYLLE +A FKTSKKYQLADWR RPL+  
Sbjct: 323 IWLQRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNN 382

Query: 361 MHAYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLV 420
           M AYAR+DTHFLLNIFDQ+RN+LI+QNKLAGVL ESRNVAKRRFEY  FRP V   N  +
Sbjct: 383 MLAYARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPN--L 440

Query: 421 YSPIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAY 480
           Y+ IEK+ PWK+++ QYNI  +KE L+++L++WRD IARRDDESPR++MP Q+L+SL++Y
Sbjct: 441 YTLIEKEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISY 500

Query: 481 TPIDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGH 540
           TP D+ GV+SVSN VT++VRSNS  LANLIK  L   K    + N+        +  T  
Sbjct: 501 TPTDSSGVISVSNMVTEHVRSNSTTLANLIKKALESTKS---IPNSSDSSSTFNMSRTDT 557

Query: 541 DLSQKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGK 600
           +++  ++I ++ N+  KF  LS  +N S            LF  I  +      Y  D  
Sbjct: 558 NVASLISITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKT 617

Query: 601 IQTTAEQYKERSEQFDDAMKQLEEVEYCI--PVIEENKQTQ--DQDNIPPITVATNAEGQ 656
               +E    R  +  + +K L      I  P +E+ K  +   ++ IP +   +  +  
Sbjct: 618 TSFKSEDMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKT 677

Query: 657 VNEMIEKPEDLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXXXXXX 716
             E+    ED +E+IVL+              ++     ++DY K  K+           
Sbjct: 678 TKEI---NEDNEEIIVLKKVNRKYQKGKKDADKDST--VVVDYSKAKKIF---QKKDETI 729

Query: 717 XXXXXXXXXFDPYSAANEG-----PAAPKKRKNVTRGKNVSFKR 755
                    FDPY+  N+G     P A KKR+  TRGKN+S+KR
Sbjct: 730 NGNSKKRKSFDPYN--NDGDTDKVPRALKKRQTNTRGKNISYKR 771

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/761 (45%), Positives = 486/761 (63%), Gaps = 25/761 (3%)

Query: 5   SQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSID 64
           S + +  LL K++ TVRAAS+LAAQD+DF R +D  +   L+++S  I  ++N V+LS  
Sbjct: 2   SSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTS 61

Query: 65  ENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQ--SGMQYIDEFS 122
           + +  ++  K+NLE  WKD  N++DNLFEKSD S+D++ +    S+ Q  + MQY++  S
Sbjct: 62  KANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVDS 121

Query: 123 GRDLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHY 182
            RD    ++I+KPQL+F  P+DN+E HPF PLLK KP ALKPLEE   +  E E  P HY
Sbjct: 122 QRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHY 181

Query: 183 PQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDL 242
           P PYEYEID+Q Y+D +L  K+PI  ++W +NEPIWVD ++ L  ++  L+   EIAVDL
Sbjct: 182 PHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDL 241

Query: 243 EHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIW 302
           EHHDYR+YYG+ CLMQISTR++D+L+DT+ALR+DLQ+LN +F +P I KVFHGAFMDIIW
Sbjct: 242 EHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIW 301

Query: 303 LQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMH 362
           LQRDLGLYVV LFDT+HASRA+G PKHSLAYLLE FA FKTSKKYQLADWRIRPLSK M 
Sbjct: 302 LQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMK 361

Query: 363 AYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYS 422
            YARADTHFLLNI+D++RNSLI+++KL+GVL  SRNVAKRRFEY+SFRPKVL     V+S
Sbjct: 362 TYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPT--VFS 419

Query: 423 PIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTP 482
           PIEKDDPW+T+M QYN+P  KEPL+++LY+WRD +AR+DDES R+VMPNQLLVSLV   P
Sbjct: 420 PIEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAP 479

Query: 483 IDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDL 542
            D  G+++V + + D+VR+N+++L N+I   + ++K       ++  E ++    +  D 
Sbjct: 480 SDPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSI--ENVTTTYVSAQD- 536

Query: 543 SQKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGKIQ 602
             ++++  ++ +   F+ L D+  +      S  +   LF G  F     + Y + GK  
Sbjct: 537 -PEMSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRL 595

Query: 603 TTAEQYKER----SEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVAT----NAE 654
               +  +R    S++F    K        I +    ++      +P  T +     + E
Sbjct: 596 VNDRELLDRKSDLSQKFSKVFKAA-----GIAIGSHIEKLSSNSELPADTTSNVESPSKE 650

Query: 655 GQVNEMIEKPEDLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXXXX 714
              N   +  ED  E+IVL+               ++P+ E +DY     +L        
Sbjct: 651 ESKNNSDDLKEDKHEIIVLKRKRDYGSNTKSTS--KQPKKEHVDYNNVNSILDNTSQQDK 708

Query: 715 XXXXXXXXXXXFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755
                      F      + G AA KK +  ++GK VS+K+
Sbjct: 709 PNSGRHVDKRKFHSDLQGSIGAAAIKKPR--SKGKTVSYKK 747

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/760 (45%), Positives = 480/760 (63%), Gaps = 31/760 (4%)

Query: 1   MSEQSQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVL 60
           M++  +++  ++L +VV T+RA+SA++AQDVDFY+S+D  I+ SL+++S ++  +IN V+
Sbjct: 1   MAKTQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVV 60

Query: 61  LSIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDE 120
           +SID+N++ ++  +  LE+ W + G +MD LFEKS+ ++  + +      G + +QY+D+
Sbjct: 61  ISIDDNNDLIEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIG-NNLQYLDD 119

Query: 121 FSGRDLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPM 180
                 T   +I KPQ  F+ P+DNTESHPF PLL +KP AL+PL++ +Q+  E+E  P 
Sbjct: 120 SQPLTDTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPA 179

Query: 181 HYPQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAV 240
           HYP PYEYEIDHQEY++ +L+ + PIPS  W + +  WVD +  L  ++ +L  + E+A+
Sbjct: 180 HYPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAI 239

Query: 241 DLEHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDI 300
           DLEHHDYRTYYGITCLMQISTR+ND+L+DT+ALR+ L +LN +F NP + KVFHGAFMD+
Sbjct: 240 DLEHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDV 299

Query: 301 IWLQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKA 360
           IWLQRDLGLY+V LFDTFHASR +G PKHSLAYLLE++A FKTSKKYQLADWRIRPLSK 
Sbjct: 300 IWLQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKP 359

Query: 361 MHAYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLV 420
           + AYARADTHFLLNI+DQMRNSLIEQ KLA  L  SR VAKRRFEY+ FRP V+ +   V
Sbjct: 360 LKAYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSE--V 417

Query: 421 YSPIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAY 480
           YSP+E++DPW++++F YNIP  K  LLK LY+WRD IARRDDESPR+VMPNQLLV+LV  
Sbjct: 418 YSPVEREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMN 477

Query: 481 TPIDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDN-NVAEEGISVVPETG 539
            P D  G++SV++ VT++VRSN+K L+ LIK  LA  +D  F D  N  +   S+V    
Sbjct: 478 APTDTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQD-LFTDQINHMDSNKSMV---- 532

Query: 540 HDLSQKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADG 599
                KL+   ++     F   + K    V    +      LF G    ++  + Y    
Sbjct: 533 ---DSKLSPGDVKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSY---- 585

Query: 600 KIQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNE 659
             Q T   + E +   DD  + + +       + E  Q   +    P       EG+  E
Sbjct: 586 --QGTQVHHIEPT-VLDDRRELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKE 642

Query: 660 MIEKP-----EDLDEVIVLRXXXXXXXXXXXXXXREEPELEIIDYFKTAKVLTXXXXXXX 714
           + +       ED DE++VL+               E    EI+D+    K++T       
Sbjct: 643 LSDDTVSQLKEDKDEIVVLKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMT------A 696

Query: 715 XXXXXXXXXXXFDPYSAANEGPAAPKKRKNVTRGKNVSFK 754
                      FDPY+    GP   K+RK  TRG   SFK
Sbjct: 697 TASVPRKSTKRFDPYAIQASGPDGVKRRKK-TRGIQKSFK 735

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/782 (45%), Positives = 488/782 (62%), Gaps = 76/782 (9%)

Query: 1   MSEQSQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVL 60
           M++    ++ ++L +V+ T+RA+SA+ AQDV FY+++D  IA S+   S ++  +IN +L
Sbjct: 1   MAQAHGSEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDIL 60

Query: 61  LSIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQ--SGMQYI 118
           LS+DEN++ ++   E LE  W + G +MD LFEKS+ ++     G    NG+    +QY+
Sbjct: 61  LSVDENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL---AAGEKRDNGELSKTVQYL 117

Query: 119 DEFSGRDLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETS 178
           D+         K+ILKPQL F  PIDN+ESHPF PLLK+KP AL+ L+ES+++  E E  
Sbjct: 118 DDSPSLHDGAPKKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDV 177

Query: 179 PMHYPQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEI 238
           P HYPQPYEYEIDHQEYN+ +LQ  +P+PS  W + E  WVD    L+ ++ +L  + EI
Sbjct: 178 PAHYPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEI 237

Query: 239 AVDLEHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFM 298
           A+DLEHHDYRTYYGITCLMQISTR+ D+LIDT+ALR+DL ILN VF +P ITKV HGAFM
Sbjct: 238 AIDLEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFM 297

Query: 299 DIIWLQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLS 358
           DIIWLQRDLGLY+V LFDT+HASR +G PKHSLAYLLE++A FKTSKKYQL+DWR+RPL 
Sbjct: 298 DIIWLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLP 357

Query: 359 KAMHAYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNG 418
           KA+ AYARADTHFLLNI+D MRNSLIEQNKL+ VL +SRNVAKRRFE+++FRPK++ ++ 
Sbjct: 358 KALKAYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSH- 416

Query: 419 LVYSPIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLV 478
            V+SPIE++DPW+T+MFQYNIP  K  L++ LY+WRD +ARRDDESPR+V+PNQLLVSL 
Sbjct: 417 -VFSPIEREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLA 475

Query: 479 AYTPIDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPET 538
              P     +++ S  VT+++R N+K LA LIK         K L+++  E G       
Sbjct: 476 VNAPTTPALIMATSTFVTEHIRQNAKSLALLIK---------KSLESSSNEFG------- 519

Query: 539 GHDLSQKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHD---QLYLFDGISFADDVTIKY 595
                      QL N  +  Q       NS  T++S+ D      +F+   F +D + + 
Sbjct: 520 -----------QLLNSANTVQ-------NSSPTKMSSEDIEKNSRMFE--KFLEDFSYEK 559

Query: 596 FADGKIQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIE-ENKQTQ-------DQDNIPP- 646
            AD  I   +  ++++    ++ +   E     +     EN++ Q       ++D   P 
Sbjct: 560 AADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLENRRHQVSKKYEAERDIARPQ 619

Query: 647 --ITVATN-------AEGQVNEMIE-----KPEDLDEVIVLRXXXXXXXXXXXXXXREEP 692
             I  A++       A  + NE  E     + E++DEVIVL+              +  P
Sbjct: 620 VHIRAASSHAVCDKEAGAEDNESAEEENKARKEEMDEVIVLKQRKTLADKEQRAVDKATP 679

Query: 693 ELEIIDYFKTAKVLTXXXXXXXXXXXXXXXXXXFDPYSAANEGPAAPKKRKNVTRGKNVS 752
            +E +D     K+L                   FDPY+    GP + KKRK  T+G   S
Sbjct: 680 SIEPLDLQSARKIL------EAPSNNVRRPKKRFDPYATLAAGPPSVKKRKK-TKGLQKS 732

Query: 753 FK 754
           F+
Sbjct: 733 FR 734

>NCAS0B01160 Chr2 complement(193743..194396) [654 bp, 217 aa] {ON}
           Anc_8.707 YOR258W
          Length = 217

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 62/155 (40%), Gaps = 27/155 (17%)

Query: 429 PWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPR-----FVMP-------NQLLVS 476
           PW+  + QY + P++ P  + +Y + DK++  +D  P+      VMP           VS
Sbjct: 3   PWRFALKQYIVHPERTPASQLIY-YNDKVSIINDGFPKSICHLLVMPRDSNLTKKHPTVS 61

Query: 477 LVAYTPIDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKM---KDNKFLDNNVAEEGIS 533
           L      +    V ++ +      +N   L   I NC   +   +D +   NN  + G+ 
Sbjct: 62  LTEDIKAELWPYVEMAQNHIFETFTNEYELVEPIPNCFETIEDFRDKETFINNFIQVGVH 121

Query: 534 VVPETGHDLSQKLTIHQLQ------NLKSKFQLLS 562
            VP  G      L IH +       NLK K   +S
Sbjct: 122 SVPSMG-----NLHIHVITKDFHSDNLKRKNHYIS 151

>KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860
          Length = 374

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 6/73 (8%)

Query: 304 QRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHA 363
           +RD  +Y+  L           L K  L  L  +   F  + +YQ+A W+ R  ++    
Sbjct: 96  RRDSNIYLYWLLQN------SPLVKGDLMNLFSEDTNFIENSRYQVALWKYRKRNRQSSC 149

Query: 364 YARADTHFLLNIF 376
           +   D HF  NIF
Sbjct: 150 FGLNDIHFCRNIF 162

>ZYRO0D06842g Chr4 (591212..591928) [717 bp, 238 aa] {ON} similar to
           uniprot|Q12255 Saccharomyces cerevisiae YLR093C NYV1
           v-SNARE component of the vacuolar SNARE complex involved
           in vesicle fusion inhibits ATP-dependent Ca(2 )
           transport activity of Pmc1p in the vacuolar membrane
          Length = 238

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 29/53 (54%)

Query: 45  LEQSSNQIADMINSVLLSIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDR 97
           L Q    + D  +  LLS  ++ E  DGT+ +L+DI++   + +D   ++ +R
Sbjct: 128 LNQRICNVLDRFHGELLSYRDSGEHGDGTEADLQDIFQVMNDNIDKFLQRQER 180

>KNAG0B03600 Chr2 (695025..696929) [1905 bp, 634 aa] {ON} Anc_5.543
           YML013W
          Length = 634

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 55/135 (40%), Gaps = 15/135 (11%)

Query: 522 FLDNNVAEEGISVVPETGHDLSQKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYL 581
           FL  NV     SV   T   +  KL +   +  ++  +L  DKFN  +    + H +L  
Sbjct: 336 FLIGNVLNSNGSVNGATKLSVLSKLRVTSARRFQNSLKLTLDKFNPEMTVNRTEHHELRT 395

Query: 582 FDGI-SFADDVTIKYFADGKIQTTAEQYKERSEQFD--------------DAMKQLEEVE 626
              I    ++       + K++    + KE+ E  +              + ++QL+ +E
Sbjct: 396 ARKIRQMQEEAYQNSLMEDKMKAERRKIKEQEEALEQQLLAKRESEAKMAETLRQLQWLE 455

Query: 627 YCIPVIEENKQTQDQ 641
            CI V+E + + Q +
Sbjct: 456 KCIDVMETHGEGQQK 470

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 81,135,076
Number of extensions: 3788476
Number of successful extensions: 14216
Number of sequences better than 10.0: 79
Number of HSP's gapped: 14725
Number of HSP's successfully gapped: 81
Length of query: 755
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 638
Effective length of database: 40,065,477
Effective search space: 25561774326
Effective search space used: 25561774326
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)