Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H008506.24ON20820810151e-142
NDAI0D008406.24ON2082089441e-131
SAKL0E01386g6.24ON2082089231e-128
TDEL0G044506.24ON2082089221e-127
ZYRO0C07700g6.24ON2072089191e-127
Kpol_1037.286.24ON2082089191e-127
Smik_13.1586.24ON2082089171e-127
KLTH0C11132g6.24ON2082089161e-126
Ecym_30286.24ON2082089141e-126
Suva_13.1616.24ON2082089131e-126
Skud_13.1536.24ON2082089131e-126
YML001W (YPT7)6.24ON2082089121e-126
ACR003C6.24ON2082089101e-126
KNAG0M012206.24ON2072089051e-125
Kwal_56.224406.24ON2082089041e-125
KLLA0D01265g6.24ON2072069031e-125
CAGL0E02607g6.24ON2082088981e-124
KAFR0G026706.24ON2082088951e-123
TBLA0A071806.24ON2082088811e-121
TPHA0J003606.24ON2092098691e-119
Kwal_23.50588.70ON2131683533e-41
ABR220W8.25ON2041743523e-41
KLTH0A02662g8.70ON2131683508e-41
Suva_6.548.70ON2151683508e-41
AGL021W8.70ON2121763509e-41
KAFR0B016608.70ON2061773509e-41
KAFR0C033308.70ON2101673472e-40
Ecym_15188.25ON2041743472e-40
SAKL0B01012g8.25ON2041743463e-40
Ecym_73058.70ON2131683463e-40
Smik_6.738.70ON2151683473e-40
Kpol_1011.38.70ON2141673455e-40
KLLA0E12079g8.70ON2141683456e-40
KNAG0D026508.70ON2111733447e-40
CAGL0F02123g8.70ON2151673448e-40
YFL005W (SEC4)8.70ON2151683421e-39
NDAI0G033408.70ON2071683393e-39
NCAS0C040208.70ON2101673386e-39
KNAG0E031008.25ON2121743386e-39
KAFR0C035808.25ON2121743377e-39
KLLA0D05313g8.25ON2041853368e-39
TBLA0D026508.70ON2171623361e-38
Skud_6.668.70ON2151683361e-38
TBLA0C004508.25ON2101843361e-38
Kwal_14.11168.25ON2041853342e-38
KLTH0G18788g8.25ON2041853342e-38
CAGL0K12672g8.25ON2061843342e-38
SAKL0B02332g8.70ON2131673343e-38
NCAS0J006308.70ON2181673333e-38
TDEL0C009808.70ON2151673333e-38
Skud_6.328.25ON2061843324e-38
Smik_6.408.25ON2061843324e-38
YFL038C (YPT1)8.25ON2061843324e-38
Suva_6.198.25ON2061843324e-38
Kpol_1023.218.25ON2071853324e-38
KNAG0G009308.70ON2131623324e-38
ZYRO0F03872g8.70ON2171673325e-38
NDAI0G030508.25ON2101743317e-38
TDEL0C004908.25ON2081743308e-38
TPHA0D002708.25ON2071743291e-37
TPHA0P003608.70ON2141683292e-37
ZYRO0F02816g8.25ON2091743273e-37
CAGL0K06017g6.49ON2191783256e-37
KAFR0A052606.49ON2351663266e-37
Suva_10.3596.49ON2151663249e-37
TPHA0F025006.49ON2151663222e-36
NCAS0C037108.25ON2111743212e-36
ZYRO0C07062g6.49ON2141663212e-36
TBLA0E031906.49ON2071753194e-36
KNAG0E027206.49ON2311663196e-36
Skud_12.3416.49ON2161663178e-36
Smik_12.3366.49ON2161663178e-36
TDEL0G042106.49ON2221663171e-35
SAKL0E02090g6.49ON2141753161e-35
YLR262C (YPT6)6.49ON2151663151e-35
KLLA0F20471g6.49ON2121663142e-35
Kpol_1042.26.49ON2141663142e-35
Kwal_56.225556.49ON2121663133e-35
KLTH0C10384g6.49ON2341663144e-35
NCAS0D025006.49ON2221663126e-35
AGR257C6.49ON2201653091e-34
Ecym_31376.49ON2211663082e-34
KAFR0A035601.289ON2071733021e-33
NDAI0I023806.49ON2221663013e-33
Smik_5.1543.521ON2231762995e-33
Kpol_423.123.521ON2201722978e-33
AER434C3.521ON2191722971e-32
Suva_7.513.521ON2211722961e-32
YER031C (YPT31)3.521ON2231762952e-32
Suva_5.1283.521ON2231762952e-32
Skud_5.1403.521ON2231762952e-32
TBLA0C049103.521ON2311752962e-32
KLTH0G01760g3.521ON2181752942e-32
TBLA0C027801.289ON2201682943e-32
Kpol_1016.241.289ON2111712933e-32
YGL210W (YPT32)3.521ON2221722934e-32
Skud_7.583.521ON2221722934e-32
Smik_7.533.521ON2221722935e-32
SAKL0F01914g3.521ON2211752925e-32
TPHA0D034303.521ON2231752926e-32
Ecym_12073.521ON2171752917e-32
CAGL0C02453g3.521ON2181732901e-31
CAGL0G07689g1.289ON2151722891e-31
ZYRO0E08492g3.521ON2181752882e-31
TPHA0I027801.289ON2081692872e-31
KLLA0D02376g1.289ON2071792872e-31
Skud_15.2532.196ON2091632863e-31
KLLA0B00671g3.521ON2191722864e-31
NCAS0E006003.521ON2191722864e-31
NDAI0I029103.521ON2191722865e-31
KNAG0B005803.521ON2251752857e-31
KNAG0C018401.338ON2121762848e-31
TPHA0P009502.196ON2131652821e-30
CAGL0K09394g3.521ON2211672821e-30
Kpol_1029.162.196ON2111672812e-30
Suva_8.1422.196ON2091632812e-30
KAFR0F041603.521ON2451722832e-30
KLTH0H09768g1.289ON2291762822e-30
CAGL0J08635g2.196ON2081672785e-30
TDEL0D058903.521ON2291762796e-30
NCAS0B067202.196ON2121682777e-30
Suva_14.2472.196ON2181682779e-30
AAL176C1.289ON2051782769e-30
YOR089C (VPS21)2.196ON2101812761e-29
Smik_14.2342.196ON2201712761e-29
KNAG0I010802.196ON2531682781e-29
KNAG0C016001.289ON2141762761e-29
KLTH0G08206g2.196ON2121682751e-29
Smik_15.2692.196ON2101632752e-29
Ecym_53622.196ON2091672742e-29
SAKL0D05940g1.289ON2071792732e-29
YNL093W (YPT53)2.196ON2201702743e-29
Kwal_14.23941.289ON2071772724e-29
KAFR0J018502.196ON2091682716e-29
Kwal_23.29782.196ON2111802716e-29
KAFR0C043101.338ON1991222706e-29
NCAS0B073601.338ON2251712718e-29
KLLA0C13728g2.196ON2082072691e-28
Ecym_63281.289ON2051802691e-28
Skud_14.2382.196ON2201702691e-28
Skud_11.2471.289ON2341922701e-28
Smik_11.2711.289ON2341922692e-28
YKR014C (YPT52)1.289ON2341922683e-28
TDEL0C046602.196ON2111682655e-28
TPHA0I025901.338ON2251712631e-27
TBLA0B018202.196ON2121762621e-27
NCAS0B076301.289ON2161732621e-27
Suva_11.2461.289ON2361942641e-27
ZYRO0B09152g1.338ON2232172631e-27
TDEL0D015701.289ON2171802612e-27
SAKL0E09922g2.196ON2131922603e-27
NDAI0B049801.289ON2271852603e-27
AEL187C1.338ON2081762575e-27
ACL084C2.196ON2072052569e-27
ZYRO0C15554g2.196ON2111672542e-26
TDEL0D020601.338ON2021682472e-25
ZYRO0G21384g1.289ON2181782472e-25
Suva_4.5261.338ON1981782453e-25
Ecym_63091.338ON2081672454e-25
CAGL0I09306g1.338ON2061712444e-25
Smik_2.4081.338ON1991642428e-25
SAKL0D06490g1.338ON2181782421e-24
NDAI0B046801.338ON2231822361e-23
YBR264C (YPT10)1.338ON1991642297e-23
KLTH0G14850g6.90ON2141662291e-22
Kwal_56.233616.90ON2141662281e-22
Kpol_1066.111.338ON2421832301e-22
YOR185C (GSP2)6.90ON2201662281e-22
Skud_15.3526.90ON2201662281e-22
Suva_8.2416.90ON2201662281e-22
Smik_15.3706.90ON2201662282e-22
Suva_10.3896.90ON2191662272e-22
Skud_12.3756.90ON2191662272e-22
Smik_12.3716.90ON2191662272e-22
YLR293C (GSP1)6.90ON2191662272e-22
KAFR0D020402.182ON2741642302e-22
ZYRO0D14784g6.90ON2141662262e-22
CAGL0I00594g6.90ON2141662253e-22
TDEL0G038106.90ON2221662263e-22
KLLA0A04499gsingletonON2141662254e-22
KLLA0C05126g6.90ON2141662254e-22
Ecym_30976.90ON2141662254e-22
AGR294C6.90ON2141662254e-22
SAKL0A07744g6.90ON2141662254e-22
CAGL0J05632g2.200ON1881772225e-22
KLTH0H10274g1.338ON2011702235e-22
NCAS0F004406.90ON2191712247e-22
Kwal_47.190553.521ON1791452209e-22
NDAI0D026706.90ON2201662221e-21
Kpol_1009.96.90ON2131712211e-21
TPHA0K010606.90ON2131712211e-21
KNAG0F031806.90ON2941662251e-21
TBLA0E009806.90ON2211662211e-21
KAFR0A048006.90ON2191662211e-21
Kwal_14.24841.338ON2031702192e-21
KLTH0G08294g2.200ON1871762164e-21
Skud_2.3971.338ON1991802165e-21
Ecym_53652.200ON1891772156e-21
KLLA0F01232g1.338ON2101652142e-20
KAFR0J012402.200ON1871712122e-20
NDAI0F025602.200ON1901792112e-20
NDAI0B041802.182ON3291762173e-20
ZYRO0C15466g2.200ON1891782103e-20
Kpol_1029.82.182ON3051542154e-20
TDEL0F027704.73ON2381692125e-20
KLLA0C13816g2.200ON1871762086e-20
NCAS0G027302.200ON1871762078e-20
CAGL0B04521g2.182ON3391542141e-19
ZYRO0G07018g4.73ON2501692101e-19
YOR101W (RAS1)2.182ON3091542121e-19
Suva_14.2502.200ON1921772061e-19
Suva_7.4434.73ON2711692092e-19
SAKL0E09834g2.200ON1901772052e-19
TDEL0C046302.200ON1911802042e-19
KNAG0M018302.200ON1861712033e-19
Skud_15.2662.182ON3131542094e-19
NDAI0D038204.73ON2681692074e-19
Kwal_14.22444.73ON2441692064e-19
YNL090W (RHO2)2.200ON1921772025e-19
KAFR0F036704.73ON2631692066e-19
ACL087C2.200ON1871752016e-19
Smik_15.2812.182ON3121542077e-19
Smik_6.2574.73ON2711692057e-19
NCAS0A018904.73ON2711692058e-19
Smik_14.2372.200ON1921772009e-19
YGR152C (RSR1)4.73ON2721692059e-19
Skud_7.4764.73ON2721692041e-18
Suva_8.1552.182ON3161542051e-18
TPHA0P009202.200ON1881741991e-18
KLTH0H09042g4.73ON2421692022e-18
NCAS0B068502.182ON3241762052e-18
YKR055W (RHO4)1.215ON2911722032e-18
TPHA0B030002.182ON3051542032e-18
ZYRO0E03608g1.443ON2001791982e-18
TBLA0B01750singletonON3731542043e-18
SAKL0H20746g4.73ON2511651994e-18
KAFR0J019702.182ON3181762024e-18
Skud_14.2412.200ON1921811955e-18
TBLA0B018002.200ON1961731956e-18
Kpol_1026.124.73ON3291692007e-18
AFR464W4.73ON2641691971e-17
YNL098C (RAS2)2.182ON3221541972e-17
Skud_11.2911.215ON2911721962e-17
Skud_14.2322.182ON3231541972e-17
Ecym_14074.73ON2681691952e-17
KLLA0C13387g2.182ON2841761952e-17
NDAI0B054001.215ON2951651962e-17
Kpol_520.364.326ON2251621922e-17
Suva_14.2412.182ON3221541963e-17
ZYRO0D03146g1.215ON2771731943e-17
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H00850
         (208 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H00850 Chr8 (155266..155892) [627 bp, 208 aa] {ON} Anc_6.24      395   e-142
NDAI0D00840 Chr4 (189925..190551) [627 bp, 208 aa] {ON} Anc_6.24      368   e-131
SAKL0E01386g Chr5 (105246..105872) [627 bp, 208 aa] {ON} highly ...   360   e-128
TDEL0G04450 Chr7 complement(808210..808836) [627 bp, 208 aa] {ON...   359   e-127
ZYRO0C07700g Chr3 complement(584547..585170) [624 bp, 207 aa] {O...   358   e-127
Kpol_1037.28 s1037 (68071..68697) [627 bp, 208 aa] {ON} (68071.....   358   e-127
Smik_13.158 Chr13 (258333..258959) [627 bp, 208 aa] {ON} YML001W...   357   e-127
KLTH0C11132g Chr3 complement(915337..915963) [627 bp, 208 aa] {O...   357   e-126
Ecym_3028 Chr3 (54759..55385) [627 bp, 208 aa] {ON} similar to A...   356   e-126
Suva_13.161 Chr13 (257150..257776) [627 bp, 208 aa] {ON} YML001W...   356   e-126
Skud_13.153 Chr13 (253075..253701) [627 bp, 208 aa] {ON} YML001W...   356   e-126
YML001W Chr13 (267174..267800) [627 bp, 208 aa] {ON}  YPT7Rab fa...   355   e-126
ACR003C Chr3 complement(359762..360388) [627 bp, 208 aa] {ON} Sy...   355   e-126
KNAG0M01220 Chr13 (222591..223214) [624 bp, 207 aa] {ON} Anc_6.2...   353   e-125
Kwal_56.22440 s56 (130574..131200) [627 bp, 208 aa] {ON} YML001W...   352   e-125
KLLA0D01265g Chr4 (110784..111407) [624 bp, 207 aa] {ON} highly ...   352   e-125
CAGL0E02607g Chr5 complement(248998..249624) [627 bp, 208 aa] {O...   350   e-124
KAFR0G02670 Chr7 complement(552130..552756) [627 bp, 208 aa] {ON...   349   e-123
TBLA0A07180 Chr1 complement(1787774..1788400) [627 bp, 208 aa] {...   343   e-121
TPHA0J00360 Chr10 (80553..81182) [630 bp, 209 aa] {ON} Anc_6.24 ...   339   e-119
Kwal_23.5058 s23 (989533..990174) [642 bp, 213 aa] {ON} YFL005W ...   140   3e-41
ABR220W Chr2 (817292..817906) [615 bp, 204 aa] {ON} Syntenic hom...   140   3e-41
KLTH0A02662g Chr1 complement(226313..226954) [642 bp, 213 aa] {O...   139   8e-41
Suva_6.54 Chr6 (102191..102838) [648 bp, 215 aa] {ON} YFL005W (R...   139   8e-41
AGL021W Chr7 (681754..682392) [639 bp, 212 aa] {ON} Syntenic hom...   139   9e-41
KAFR0B01660 Chr2 complement(318959..319579) [621 bp, 206 aa] {ON...   139   9e-41
KAFR0C03330 Chr3 (679443..680075) [633 bp, 210 aa] {ON} Anc_8.70...   138   2e-40
Ecym_1518 Chr1 (1069582..1070196) [615 bp, 204 aa] {ON} similar ...   138   2e-40
SAKL0B01012g Chr2 complement(92466..93080) [615 bp, 204 aa] {ON}...   137   3e-40
Ecym_7305 Chr7 (650045..650686) [642 bp, 213 aa] {ON} similar to...   137   3e-40
Smik_6.73 Chr6 (143556..144203) [648 bp, 215 aa] {ON} YFL005W (R...   138   3e-40
Kpol_1011.3 s1011 complement(4828..5472) [645 bp, 214 aa] {ON} c...   137   5e-40
KLLA0E12079g Chr5 (1075299..1075943) [645 bp, 214 aa] {ON} highl...   137   6e-40
KNAG0D02650 Chr4 (474662..475297) [636 bp, 211 aa] {ON} Anc_8.70...   137   7e-40
CAGL0F02123g Chr6 (212117..212764) [648 bp, 215 aa] {ON} highly ...   137   8e-40
YFL005W Chr6 (130334..130981) [648 bp, 215 aa] {ON}  SEC4Rab fam...   136   1e-39
NDAI0G03340 Chr7 (792718..793341) [624 bp, 207 aa] {ON} Anc_8.70      135   3e-39
NCAS0C04020 Chr3 (817944..818576) [633 bp, 210 aa] {ON} Anc_1.21...   134   6e-39
KNAG0E03100 Chr5 complement(618438..619076) [639 bp, 212 aa] {ON...   134   6e-39
KAFR0C03580 Chr3 (733658..734296) [639 bp, 212 aa] {ON} Anc_8.25...   134   7e-39
KLLA0D05313g Chr4 (459496..460110) [615 bp, 204 aa] {ON} highly ...   134   8e-39
TBLA0D02650 Chr4 (655924..656577) [654 bp, 217 aa] {ON} Anc_8.70...   134   1e-38
Skud_6.66 Chr6 (132521..133168) [648 bp, 215 aa] {ON} YFL005W (R...   134   1e-38
TBLA0C00450 Chr3 complement(84352..84984) [633 bp, 210 aa] {ON} ...   134   1e-38
Kwal_14.1116 s14 complement(202534..203148) [615 bp, 204 aa] {ON...   133   2e-38
KLTH0G18788g Chr7 (1624218..1624832) [615 bp, 204 aa] {ON} highl...   133   2e-38
CAGL0K12672g Chr11 (1256370..1256990) [621 bp, 206 aa] {ON} high...   133   2e-38
SAKL0B02332g Chr2 (227078..227719) [642 bp, 213 aa] {ON} highly ...   133   3e-38
NCAS0J00630 Chr10 complement(95335..95991) [657 bp, 218 aa] {ON}...   132   3e-38
TDEL0C00980 Chr3 (164219..164866) [648 bp, 215 aa] {ON} Anc_8.70...   132   3e-38
Skud_6.32 Chr6 complement(58531..59151) [621 bp, 206 aa] {ON} YF...   132   4e-38
Smik_6.40 Chr6 complement(70749..71369) [621 bp, 206 aa] {ON} YF...   132   4e-38
YFL038C Chr6 complement(55366..55986) [621 bp, 206 aa] {ON}  YPT...   132   4e-38
Suva_6.19 Chr6 complement(28872..29492) [621 bp, 206 aa] {ON} YF...   132   4e-38
Kpol_1023.21 s1023 complement(39597..40220) [624 bp, 207 aa] {ON...   132   4e-38
KNAG0G00930 Chr7 (183672..184313) [642 bp, 213 aa] {ON} Anc_8.70...   132   4e-38
ZYRO0F03872g Chr6 (329213..329866) [654 bp, 217 aa] {ON} highly ...   132   5e-38
NDAI0G03050 Chr7 complement(711396..712028) [633 bp, 210 aa] {ON...   132   7e-38
TDEL0C00490 Chr3 complement(75792..76418) [627 bp, 208 aa] {ON} ...   131   8e-38
TPHA0D00270 Chr4 complement(37369..37992) [624 bp, 207 aa] {ON} ...   131   1e-37
TPHA0P00360 Chr16 (76379..77023) [645 bp, 214 aa] {ON} Anc_8.70 ...   131   2e-37
ZYRO0F02816g Chr6 complement(237904..238533) [630 bp, 209 aa] {O...   130   3e-37
CAGL0K06017g Chr11 complement(586922..587581) [660 bp, 219 aa] {...   129   6e-37
KAFR0A05260 Chr1 complement(1040753..1041460) [708 bp, 235 aa] {...   130   6e-37
Suva_10.359 Chr10 complement(629445..630092) [648 bp, 215 aa] {O...   129   9e-37
TPHA0F02500 Chr6 complement(551815..552462) [648 bp, 215 aa] {ON...   128   2e-36
NCAS0C03710 Chr3 complement(747168..747803) [636 bp, 211 aa] {ON...   128   2e-36
ZYRO0C07062g Chr3 (532175..532819) [645 bp, 214 aa] {ON} highly ...   128   2e-36
TBLA0E03190 Chr5 complement(803935..804558) [624 bp, 207 aa] {ON...   127   4e-36
KNAG0E02720 Chr5 (541478..542173) [696 bp, 231 aa] {ON}               127   6e-36
Skud_12.341 Chr12 complement(609187..609837) [651 bp, 216 aa] {O...   126   8e-36
Smik_12.336 Chr12 complement(606255..606905) [651 bp, 216 aa] {O...   126   8e-36
TDEL0G04210 Chr7 (764766..765434) [669 bp, 222 aa] {ON} Anc_6.49...   126   1e-35
SAKL0E02090g Chr5 complement(160194..160838) [645 bp, 214 aa] {O...   126   1e-35
YLR262C Chr12 complement(668244..668891) [648 bp, 215 aa] {ON}  ...   125   1e-35
KLLA0F20471g Chr6 (1901749..1902387) [639 bp, 212 aa] {ON} highl...   125   2e-35
Kpol_1042.2 s1042 complement(4659..5303) [645 bp, 214 aa] {ON} c...   125   2e-35
Kwal_56.22555 s56 complement(178575..179213) [639 bp, 212 aa] {O...   125   3e-35
KLTH0C10384g Chr3 (861122..861826) [705 bp, 234 aa] {ON} highly ...   125   4e-35
NCAS0D02500 Chr4 (474037..474705) [669 bp, 222 aa] {ON} Anc_6.49      124   6e-35
AGR257C Chr7 complement(1225880..1226542) [663 bp, 220 aa] {ON} ...   123   1e-34
Ecym_3137 Chr3 (254058..254723) [666 bp, 221 aa] {ON} similar to...   123   2e-34
KAFR0A03560 Chr1 (729254..729877) [624 bp, 207 aa] {ON} Anc_1.28...   120   1e-33
NDAI0I02380 Chr9 complement(542975..543643) [669 bp, 222 aa] {ON}     120   3e-33
Smik_5.154 Chr5 complement(218975..219646) [672 bp, 223 aa] {ON}...   119   5e-33
Kpol_423.12 s423 (26761..27423) [663 bp, 220 aa] {ON} (26761..27...   119   8e-33
AER434C Chr5 complement(1466442..1467052,1467106..1467154) [660 ...   119   1e-32
Suva_7.51 Chr7 (90232..90897) [666 bp, 221 aa] {ON} YGL210W (REAL)    118   1e-32
YER031C Chr5 complement(214076..214747) [672 bp, 223 aa] {ON}  Y...   118   2e-32
Suva_5.128 Chr5 complement(190103..190774) [672 bp, 223 aa] {ON}...   118   2e-32
Skud_5.140 Chr5 complement(211975..212646) [672 bp, 223 aa] {ON}...   118   2e-32
TBLA0C04910 Chr3 complement(1193590..1194285) [696 bp, 231 aa] {...   118   2e-32
KLTH0G01760g Chr7 (132121..132166,132307..132917) [657 bp, 218 a...   117   2e-32
TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON...   117   3e-32
Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON} (61782.....   117   3e-32
YGL210W Chr7 (93792..94460) [669 bp, 222 aa] {ON}  YPT32Rab fami...   117   4e-32
Skud_7.58 Chr7 (99129..99797) [669 bp, 222 aa] {ON} YGL210W (REAL)    117   4e-32
Smik_7.53 Chr7 (88592..89260) [669 bp, 222 aa] {ON} YGL210W (REAL)    117   5e-32
SAKL0F01914g Chr6 (162387..162432,162627..163246) [666 bp, 221 a...   117   5e-32
TPHA0D03430 Chr4 complement(719751..720422) [672 bp, 223 aa] {ON...   117   6e-32
Ecym_1207 Chr1 (420728..420773,421159..421766) [654 bp, 217 aa] ...   116   7e-32
CAGL0C02453g Chr3 (247493..248149) [657 bp, 218 aa] {ON} highly ...   116   1e-31
CAGL0G07689g Chr7 complement(729919..730566) [648 bp, 215 aa] {O...   115   1e-31
ZYRO0E08492g Chr5 complement(676074..676684,676766..676811) [657...   115   2e-31
TPHA0I02780 Chr9 complement(614605..615231) [627 bp, 208 aa] {ON...   115   2e-31
KLLA0D02376g Chr4 (201512..202135) [624 bp, 207 aa] {ON} similar...   115   2e-31
Skud_15.253 Chr15 complement(446672..447301) [630 bp, 209 aa] {O...   114   3e-31
KLLA0B00671g Chr2 complement(50393..51006,51417..51462) [660 bp,...   114   4e-31
NCAS0E00600 Chr5 (102956..103615) [660 bp, 219 aa] {ON} Anc_3.521     114   4e-31
NDAI0I02910 Chr9 complement(688721..689380) [660 bp, 219 aa] {ON...   114   5e-31
KNAG0B00580 Chr2 (94797..95474) [678 bp, 225 aa] {ON} Anc_3.521 ...   114   7e-31
KNAG0C01840 Chr3 (363258..363896) [639 bp, 212 aa] {ON} Anc_1.33...   114   8e-31
TPHA0P00950 Chr16 complement(193256..193897) [642 bp, 213 aa] {O...   113   1e-30
CAGL0K09394g Chr11 complement(930063..930728) [666 bp, 221 aa] {...   113   1e-30
Kpol_1029.16 s1029 (30724..31359) [636 bp, 211 aa] {ON} (30724.....   112   2e-30
Suva_8.142 Chr8 complement(247554..248183) [630 bp, 209 aa] {ON}...   112   2e-30
KAFR0F04160 Chr6 complement(819022..819759) [738 bp, 245 aa] {ON...   113   2e-30
KLTH0H09768g Chr8 (840625..841314) [690 bp, 229 aa] {ON} similar...   113   2e-30
CAGL0J08635g Chr10 complement(856102..856728) [627 bp, 208 aa] {...   111   5e-30
TDEL0D05890 Chr4 complement(1067167..1067856) [690 bp, 229 aa] {...   112   6e-30
NCAS0B06720 Chr2 complement(1278798..1279436) [639 bp, 212 aa] {...   111   7e-30
Suva_14.247 Chr14 (448490..449146) [657 bp, 218 aa] {ON} YNL093W...   111   9e-30
AAL176C Chr1 complement(31588..32205) [618 bp, 205 aa] {ON} Synt...   110   9e-30
YOR089C Chr15 complement(490196..490828) [633 bp, 210 aa] {ON}  ...   110   1e-29
Smik_14.234 Chr14 (430086..430748) [663 bp, 220 aa] {ON} YNL093W...   110   1e-29
KNAG0I01080 Chr9 (207327..208088) [762 bp, 253 aa] {ON} Anc_2.19...   111   1e-29
KNAG0C01600 Chr3 (317298..317942) [645 bp, 214 aa] {ON} Anc_1.28...   110   1e-29
KLTH0G08206g Chr7 (666127..666765) [639 bp, 212 aa] {ON} highly ...   110   1e-29
Smik_15.269 Chr15 complement(451402..452034) [633 bp, 210 aa] {O...   110   2e-29
Ecym_5362 Chr5 (735204..735833) [630 bp, 209 aa] {ON} similar to...   110   2e-29
SAKL0D05940g Chr4 (485575..486198) [624 bp, 207 aa] {ON} highly ...   109   2e-29
YNL093W Chr14 (449868..450530) [663 bp, 220 aa] {ON}  YPT53Rab f...   110   3e-29
Kwal_14.2394 s14 (738645..739268) [624 bp, 207 aa] {ON} YKR014C ...   109   4e-29
KAFR0J01850 Chr10 complement(356911..357540) [630 bp, 209 aa] {O...   108   6e-29
Kwal_23.2978 s23 (97956..98591) [636 bp, 211 aa] {ON} YOR089C (V...   108   6e-29
KAFR0C04310 Chr3 (855871..856470) [600 bp, 199 aa] {ON} Anc_1.33...   108   6e-29
NCAS0B07360 Chr2 complement(1389230..1389907) [678 bp, 225 aa] {...   108   8e-29
KLLA0C13728g Chr3 (1173329..1173955) [627 bp, 208 aa] {ON} highl...   108   1e-28
Ecym_6328 Chr6 complement(629586..630203) [618 bp, 205 aa] {ON} ...   108   1e-28
Skud_14.238 Chr14 (440139..440801) [663 bp, 220 aa] {ON} YNL093W...   108   1e-28
Skud_11.247 Chr11 complement(445982..446686) [705 bp, 234 aa] {O...   108   1e-28
Smik_11.271 Chr11 complement(452840..453544) [705 bp, 234 aa] {O...   108   2e-28
YKR014C Chr11 complement(465367..466071) [705 bp, 234 aa] {ON}  ...   107   3e-28
TDEL0C04660 Chr3 complement(845203..845838) [636 bp, 211 aa] {ON...   106   5e-28
TPHA0I02590 Chr9 complement(571327..572004) [678 bp, 225 aa] {ON...   105   1e-27
TBLA0B01820 Chr2 complement(415800..416438) [639 bp, 212 aa] {ON...   105   1e-27
NCAS0B07630 Chr2 complement(1443664..1444314) [651 bp, 216 aa] {...   105   1e-27
Suva_11.246 Chr11 complement(449412..450122) [711 bp, 236 aa] {O...   106   1e-27
ZYRO0B09152g Chr2 complement(714608..715279) [672 bp, 223 aa] {O...   105   1e-27
TDEL0D01570 Chr4 (310454..311107) [654 bp, 217 aa] {ON} Anc_1.28...   105   2e-27
SAKL0E09922g Chr5 complement(829249..829890) [642 bp, 213 aa] {O...   104   3e-27
NDAI0B04980 Chr2 complement(1216833..1217516) [684 bp, 227 aa] {...   104   3e-27
AEL187C Chr5 complement(284984..285610) [627 bp, 208 aa] {ON} Sy...   103   5e-27
ACL084C Chr3 complement(199020..199643) [624 bp, 207 aa] {ON} Sy...   103   9e-27
ZYRO0C15554g Chr3 complement(1218190..1218825) [636 bp, 211 aa] ...   102   2e-26
TDEL0D02060 Chr4 (403098..403706) [609 bp, 202 aa] {ON} Anc_1.33...   100   2e-25
ZYRO0G21384g Chr7 complement(1763055..1763711) [657 bp, 218 aa] ...   100   2e-25
Suva_4.526 Chr4 complement(909423..910019) [597 bp, 198 aa] {ON}...    99   3e-25
Ecym_6309 Chr6 (585998..586624) [627 bp, 208 aa] {ON} similar to...    99   4e-25
CAGL0I09306g Chr9 complement(897357..897977) [621 bp, 206 aa] {O...    99   4e-25
Smik_2.408 Chr2 complement(723817..724416) [600 bp, 199 aa] {ON}...    98   8e-25
SAKL0D06490g Chr4 complement(531028..531684) [657 bp, 218 aa] {O...    98   1e-24
NDAI0B04680 Chr2 complement(1157279..1157950) [672 bp, 223 aa] {...    96   1e-23
YBR264C Chr2 complement(737770..738369) [600 bp, 199 aa] {ON}  Y...    93   7e-23
KLTH0G14850g Chr7 (1304240..1304884) [645 bp, 214 aa] {ON} highl...    93   1e-22
Kwal_56.23361 s56 complement(508046..508690) [645 bp, 214 aa] {O...    92   1e-22
Kpol_1066.11 s1066 complement(18137..18865) [729 bp, 242 aa] {ON...    93   1e-22
YOR185C Chr15 complement(681444..682106) [663 bp, 220 aa] {ON}  ...    92   1e-22
Skud_15.352 Chr15 complement(632241..632903) [663 bp, 220 aa] {O...    92   1e-22
Suva_8.241 Chr8 complement(432445..433107) [663 bp, 220 aa] {ON}...    92   1e-22
Smik_15.370 Chr15 complement(637457..638119) [663 bp, 220 aa] {O...    92   2e-22
Suva_10.389 Chr10 complement(681930..682589) [660 bp, 219 aa] {O...    92   2e-22
Skud_12.375 Chr12 complement(661797..662456) [660 bp, 219 aa] {O...    92   2e-22
Smik_12.371 Chr12 complement(658971..659630) [660 bp, 219 aa] {O...    92   2e-22
YLR293C Chr12 complement(720771..721430) [660 bp, 219 aa] {ON}  ...    92   2e-22
KAFR0D02040 Chr4 complement(412576..413382,413464..413481) [825 ...    93   2e-22
ZYRO0D14784g Chr4 complement(1247520..1248164) [645 bp, 214 aa] ...    92   2e-22
CAGL0I00594g Chr9 (44835..45479) [645 bp, 214 aa] {ON} highly si...    91   3e-22
TDEL0G03810 Chr7 (699414..700082) [669 bp, 222 aa] {ON} Anc_6.90...    92   3e-22
KLLA0A04499g Chr1 complement(404732..405376) [645 bp, 214 aa] {O...    91   4e-22
KLLA0C05126g Chr3 complement(463657..464301) [645 bp, 214 aa] {O...    91   4e-22
Ecym_3097 Chr3 (181482..182126) [645 bp, 214 aa] {ON} similar to...    91   4e-22
AGR294C Chr7 complement(1287036..1287680) [645 bp, 214 aa] {ON} ...    91   4e-22
SAKL0A07744g Chr1 (688406..689050) [645 bp, 214 aa] {ON} highly ...    91   4e-22
CAGL0J05632g Chr10 complement(539466..540032) [567 bp, 188 aa] {...    90   5e-22
KLTH0H10274g Chr8 complement(882443..883048) [606 bp, 201 aa] {O...    91   5e-22
NCAS0F00440 Chr6 complement(79004..79663) [660 bp, 219 aa] {ON} ...    91   7e-22
Kwal_47.19055 s47 complement(1078494..1079033) [540 bp, 179 aa] ...    89   9e-22
NDAI0D02670 Chr4 (618909..619571) [663 bp, 220 aa] {ON} Anc_6.90       90   1e-21
Kpol_1009.9 s1009 complement(23990..24631) [642 bp, 213 aa] {ON}...    90   1e-21
TPHA0K01060 Chr11 (219078..219719) [642 bp, 213 aa] {ON} Anc_6.9...    90   1e-21
KNAG0F03180 Chr6 complement(598089..598973) [885 bp, 294 aa] {ON...    91   1e-21
TBLA0E00980 Chr5 (224289..224954) [666 bp, 221 aa] {ON} Anc_6.90...    90   1e-21
KAFR0A04800 Chr1 (954630..955289) [660 bp, 219 aa] {ON} Anc_6.90...    90   1e-21
Kwal_14.2484 s14 complement(777938..778549) [612 bp, 203 aa] {ON...    89   2e-21
KLTH0G08294g Chr7 (678358..678921) [564 bp, 187 aa] {ON} highly ...    88   4e-21
Skud_2.397 Chr2 complement(706771..707370) [600 bp, 199 aa] {ON}...    88   5e-21
Ecym_5365 Chr5 (743477..744046) [570 bp, 189 aa] {ON} similar to...    87   6e-21
KLLA0F01232g Chr6 complement(114430..115062) [633 bp, 210 aa] {O...    87   2e-20
KAFR0J01240 Chr10 complement(229638..230201) [564 bp, 187 aa] {O...    86   2e-20
NDAI0F02560 Chr6 complement(629428..630000) [573 bp, 190 aa] {ON}      86   2e-20
NDAI0B04180 Chr2 (1055285..1056274) [990 bp, 329 aa] {ON} Anc_2....    88   3e-20
ZYRO0C15466g Chr3 complement(1208350..1208919) [570 bp, 189 aa] ...    86   3e-20
Kpol_1029.8 s1029 complement(15899..16816) [918 bp, 305 aa] {ON}...    87   4e-20
TDEL0F02770 Chr6 complement(507090..507806) [717 bp, 238 aa] {ON...    86   5e-20
KLLA0C13816g Chr3 (1183412..1183975) [564 bp, 187 aa] {ON} highl...    85   6e-20
NCAS0G02730 Chr7 (491357..491920) [564 bp, 187 aa] {ON}                84   8e-20
CAGL0B04521g Chr2 complement(439732..440751) [1020 bp, 339 aa] {...    87   1e-19
ZYRO0G07018g Chr7 complement(559273..560025) [753 bp, 250 aa] {O...    86   1e-19
YOR101W Chr15 (515244..516173) [930 bp, 309 aa] {ON}  RAS1GTPase...    86   1e-19
Suva_14.250 Chr14 (455251..455829) [579 bp, 192 aa] {ON} YNL090W...    84   1e-19
Suva_7.443 Chr7 complement(764401..765216) [816 bp, 271 aa] {ON}...    85   2e-19
SAKL0E09834g Chr5 complement(819736..820308) [573 bp, 190 aa] {O...    84   2e-19
TDEL0C04630 Chr3 complement(837302..837877) [576 bp, 191 aa] {ON...    83   2e-19
KNAG0M01830 Chr13 complement(339904..340464) [561 bp, 186 aa] {O...    83   3e-19
Skud_15.266 Chr15 (471563..472504) [942 bp, 313 aa] {ON} YOR101W...    85   4e-19
NDAI0D03820 Chr4 complement(908209..909015) [807 bp, 268 aa] {ON...    84   4e-19
Kwal_14.2244 s14 (671441..672175) [735 bp, 244 aa] {ON} YGR152C ...    84   4e-19
YNL090W Chr14 (456565..457143) [579 bp, 192 aa] {ON}  RHO2Non-es...    82   5e-19
KAFR0F03670 Chr6 complement(726736..727527) [792 bp, 263 aa] {ON...    84   6e-19
ACL087C Chr3 complement(191573..192136) [564 bp, 187 aa] {ON} Sy...    82   6e-19
Smik_15.281 Chr15 (476294..477232) [939 bp, 312 aa] {ON} YOR101W...    84   7e-19
Smik_6.257 Chr6 complement(414005..414820) [816 bp, 271 aa] {ON}...    84   7e-19
NCAS0A01890 Chr1 complement(364746..365561) [816 bp, 271 aa] {ON...    84   8e-19
Smik_14.237 Chr14 (436872..437450) [579 bp, 192 aa] {ON} YNL090W...    82   9e-19
YGR152C Chr7 complement(794674..795492) [819 bp, 272 aa] {ON}  R...    84   9e-19
Skud_7.476 Chr7 complement(778308..779126) [819 bp, 272 aa] {ON}...    83   1e-18
Suva_8.155 Chr8 (272370..273320) [951 bp, 316 aa] {ON} YOR101W (...    84   1e-18
TPHA0P00920 Chr16 complement(185904..186470) [567 bp, 188 aa] {O...    81   1e-18
KLTH0H09042g Chr8 (776732..777460) [729 bp, 242 aa] {ON} similar...    82   2e-18
NCAS0B06850 Chr2 (1305199..1306173) [975 bp, 324 aa] {ON} Anc_2....    84   2e-18
YKR055W Chr11 (548216..549091) [876 bp, 291 aa] {ON}  RHO4Non-es...    83   2e-18
TPHA0B03000 Chr2 complement(683258..684175) [918 bp, 305 aa] {ON...    83   2e-18
ZYRO0E03608g Chr5 complement(279670..280272) [603 bp, 200 aa] {O...    81   2e-18
TBLA0B01750 Chr2 complement(392769..393890) [1122 bp, 373 aa] {O...    83   3e-18
SAKL0H20746g Chr8 (1817259..1818014) [756 bp, 251 aa] {ON} simil...    81   4e-18
KAFR0J01970 Chr10 (379033..379989) [957 bp, 318 aa] {ON} Anc_2.1...    82   4e-18
Skud_14.241 Chr14 (446886..447464) [579 bp, 192 aa] {ON} YNL090W...    80   5e-18
TBLA0B01800 Chr2 complement(408546..409136) [591 bp, 196 aa] {ON...    80   6e-18
Kpol_1026.12 s1026 complement(27073..28062) [990 bp, 329 aa] {ON...    82   7e-18
AFR464W Chr6 (1274600..1275394) [795 bp, 264 aa] {ON} Syntenic h...    80   1e-17
YNL098C Chr14 complement(439602..440570) [969 bp, 322 aa] {ON}  ...    80   2e-17
Skud_11.291 Chr11 (529726..530601) [876 bp, 291 aa] {ON} YKR055W...    80   2e-17
Skud_14.232 Chr14 complement(429739..430710) [972 bp, 323 aa] {O...    80   2e-17
Ecym_1407 Chr1 (846135..846941) [807 bp, 268 aa] {ON} similar to...    80   2e-17
KLLA0C13387g Chr3 complement(1142002..1142841,1143162..1143176) ...    80   2e-17
NDAI0B05400 Chr2 (1326549..1327436) [888 bp, 295 aa] {ON} Anc_1....    80   2e-17
Kpol_520.36 s520 complement(90395..91072) [678 bp, 225 aa] {ON} ...    79   2e-17
Suva_14.241 Chr14 complement(437053..438021) [969 bp, 322 aa] {O...    80   3e-17
ZYRO0D03146g Chr4 complement(244206..245039) [834 bp, 277 aa] {O...    79   3e-17
Smik_14.227 Chr14 complement(419257..420225) [969 bp, 322 aa] {O...    80   3e-17
SAKL0E10252g Chr5 (855721..855735,855900..856691) [807 bp, 268 a...    79   3e-17
Kpol_1029.18 s1029 (37197..37763) [567 bp, 188 aa] {ON} (37197.....    78   3e-17
KAFR0G00680 Chr7 complement(170317..171210) [894 bp, 297 aa] {ON...    80   3e-17
SAKL0C06424g Chr3 complement(591532..592395) [864 bp, 287 aa] {O...    79   3e-17
NCAS0B08090 Chr2 (1545134..1546003) [870 bp, 289 aa] {ON} Anc_1....    79   4e-17
KLLA0A05643g Chr1 (528976..529632) [657 bp, 218 aa] {ON} similar...    78   4e-17
KLTH0F18612g Chr6 (1513182..1513811) [630 bp, 209 aa] {ON} simil...    78   4e-17
Kwal_55.21941 s55 (1048693..1049322) [630 bp, 209 aa] {ON} YPR16...    78   5e-17
Suva_11.289 Chr11 (531935..532810) [876 bp, 291 aa] {ON} YKR055W...    79   5e-17
KNAG0D03780 Chr4 complement(688854..689768) [915 bp, 304 aa] {ON...    79   5e-17
KLLA0C12001g Chr3 complement(1029092..1029871) [780 bp, 259 aa] ...    79   6e-17
TBLA0B00370 Chr2 (68828..69868) [1041 bp, 346 aa] {ON}                 79   6e-17
Smik_11.317 Chr11 (538087..539016) [930 bp, 309 aa] {ON} YKR055W...    79   7e-17
ADL262W Chr4 (243996..244010,244072..244869) [813 bp, 270 aa] {O...    78   7e-17
Kwal_26.8387 s26 (763564..764442) [879 bp, 292 aa] {ON} YNL098C ...    79   8e-17
ZYRO0B09438g Chr2 (738659..739555) [897 bp, 298 aa] {ON} similar...    78   1e-16
TDEL0B05600 Chr2 complement(991741..992346) [606 bp, 201 aa] {ON...    76   1e-16
KNAG0H03380 Chr8 (632140..633114) [975 bp, 324 aa] {ON} Anc_2.18...    78   2e-16
TBLA0B01410 Chr2 complement(304771..306687) [1917 bp, 638 aa] {O...    79   2e-16
KLTH0D08932g Chr4 (742772..742786,742899..743762) [879 bp, 292 a...    77   2e-16
SAKL0F15642g Chr6 (1273987..1274616) [630 bp, 209 aa] {ON} highl...    75   3e-16
KNAG0C01260 Chr3 complement(243934..244833) [900 bp, 299 aa] {ON...    77   3e-16
ABR183W Chr2 (755915..756538) [624 bp, 207 aa] {ON} Rho1b; Synte...    75   3e-16
TPHA0K01820 Chr11 complement(385771..386733) [963 bp, 320 aa] {O...    77   3e-16
Ecym_7212 Chr7 (444427..445050) [624 bp, 207 aa] {ON} similar to...    75   5e-16
CAGL0L11242g Chr12 (1199371..1200135) [765 bp, 254 aa] {ON} high...    75   6e-16
KLLA0A11330g Chr1 (982552..983124) [573 bp, 190 aa] {ON} similar...    74   6e-16
KLTH0F05698g Chr6 complement(489561..490376) [816 bp, 271 aa] {O...    75   7e-16
KNAG0K02400 Chr11 complement(482842..483861) [1020 bp, 339 aa] {...    76   1e-15
Ecym_5349 Chr5 complement(708225..709076,709277..709288) [864 bp...    75   1e-15
ZYRO0D01452g Chr4 complement(104471..105133) [663 bp, 220 aa] {O...    74   1e-15
Kwal_23.3135 s23 complement(172095..172670) [576 bp, 191 aa] {ON...    73   1e-15
KLTH0F07920g Chr6 complement(687410..687985) [576 bp, 191 aa] {O...    73   1e-15
ZYRO0B14256g Chr2 (1160536..1161219) [684 bp, 227 aa] {ON} simil...    74   1e-15
Ecym_4146 Chr4 complement(312161..312736) [576 bp, 191 aa] {ON} ...    73   2e-15
AGL093W Chr7 (532002..532577) [576 bp, 191 aa] {ON} Syntenic hom...    73   2e-15
KNAG0E01840 Chr5 (380757..381419) [663 bp, 220 aa] {ON} Anc_2.24...    74   2e-15
CAGL0K08316g Chr11 (839222..840193) [972 bp, 323 aa] {ON} some s...    75   2e-15
TDEL0F05450 Chr6 (1014759..1015334) [576 bp, 191 aa] {ON} Anc_8....    73   2e-15
Kwal_47.16983 s47 complement(197253..197924) [672 bp, 223 aa] {O...    74   2e-15
CAGL0E03113g Chr5 complement(289401..290372) [972 bp, 323 aa] {O...    75   2e-15
KLTH0F18590g Chr6 (1511729..1512355) [627 bp, 208 aa] {ON} highl...    73   2e-15
ZYRO0C09680g Chr3 (735760..736698) [939 bp, 312 aa] {ON} similar...    75   2e-15
Kwal_33.14452 s33 complement(679084..679866) [783 bp, 260 aa] {O...    74   2e-15
KLLA0B10626g Chr2 (936497..937123) [627 bp, 208 aa] {ON} uniprot...    73   2e-15
NDAI0D03040 Chr4 (717810..718454) [645 bp, 214 aa] {ON} Anc_4.326      73   3e-15
Kwal_34.16142 s34 complement(220030..220608) [579 bp, 192 aa] {O...    73   3e-15
TPHA0B01720 Chr2 complement(384530..385420) [891 bp, 296 aa] {ON...    74   3e-15
SAKL0H13068g Chr8 complement(1125095..1125670) [576 bp, 191 aa] ...    72   3e-15
KLTH0D16236g Chr4 (1344371..1345048) [678 bp, 225 aa] {ON} simil...    73   3e-15
Skud_13.80 Chr13 complement(143292..144029) [738 bp, 245 aa] {ON...    73   3e-15
CAGL0F05269g Chr6 complement(533759..534334) [576 bp, 191 aa] {O...    72   3e-15
KAFR0J01600 Chr10 complement(290538..291206) [669 bp, 222 aa] {O...    73   4e-15
Suva_13.93 Chr13 complement(147850..148587) [738 bp, 245 aa] {ON...    73   4e-15
YML064C Chr13 complement(145139..145876) [738 bp, 245 aa] {ON}  ...    73   4e-15
Smik_9.51 Chr9 (117526..118221) [696 bp, 231 aa] {ON} YIL118W (R...    72   5e-15
KLLA0A04213g Chr1 complement(382243..382818) [576 bp, 191 aa] {O...    72   6e-15
KAFR0B06320 Chr2 (1307235..1307810) [576 bp, 191 aa] {ON} Anc_8....    72   6e-15
TBLA0H00690 Chr8 complement(148963..149622) [660 bp, 219 aa] {ON...    72   7e-15
Smik_13.80 Chr13 complement(142681..143418) [738 bp, 245 aa] {ON...    72   8e-15
KAFR0I00390 Chr9 complement(84398..85093) [696 bp, 231 aa] {ON} ...    72   8e-15
KNAG0E03990 Chr5 (788341..789045) [705 bp, 234 aa] {ON} Anc_4.32...    72   9e-15
SAKL0E12848g Chr5 (1060050..1060835) [786 bp, 261 aa] {ON} simil...    72   1e-14
NCAS0A15070 Chr1 (2971104..2971739) [636 bp, 211 aa] {ON}              71   1e-14
TDEL0D00920 Chr4 complement(167879..168568) [690 bp, 229 aa] {ON...    71   1e-14
Ecym_3286 Chr3 (542469..543143) [675 bp, 224 aa] {ON} similar to...    71   1e-14
Kpol_1039.20 s1039 (65494..66126) [633 bp, 210 aa] {ON} (65494.....    71   1e-14
NCAS0G01910 Chr7 complement(342761..343636) [876 bp, 291 aa] {ON...    72   1e-14
KLLA0B05038g Chr2 complement(457608..458279) [672 bp, 223 aa] {O...    71   1e-14
TDEL0F01360 Chr6 complement(241607..242470) [864 bp, 287 aa] {ON...    72   2e-14
Skud_9.53 Chr9 (116575..117270) [696 bp, 231 aa] {ON} YIL118W (R...    71   2e-14
ZYRO0D01474g Chr4 complement(105651..106289) [639 bp, 212 aa] {O...    71   2e-14
Suva_16.495 Chr16 (859802..860431) [630 bp, 209 aa] {ON} YPR165W...    71   2e-14
Skud_16.464 Chr16 (818093..818722) [630 bp, 209 aa] {ON} YPR165W...    71   2e-14
Smik_16.424 Chr16 (736628..737257) [630 bp, 209 aa] {ON} YPR165W...    71   2e-14
YPR165W Chr16 (875368..875997) [630 bp, 209 aa] {ON}  RHO1GTP-bi...    71   2e-14
YIL118W Chr9 (139752..140447) [696 bp, 231 aa] {ON}  RHO3Non-ess...    71   2e-14
SAKL0F15620g Chr6 (1272848..1273471) [624 bp, 207 aa] {ON} highl...    71   2e-14
Kpol_1008.17 s1008 (34952..35581) [630 bp, 209 aa] {ON} (34952.....    70   2e-14
SAKL0G17424g Chr7 (1508263..1508913) [651 bp, 216 aa] {ON} simil...    71   2e-14
Kpol_1013.49 s1013 complement(108782..109414) [633 bp, 210 aa] {...    70   2e-14
ZYRO0A09306g Chr1 (745829..746404) [576 bp, 191 aa] {ON} highly ...    70   2e-14
TBLA0J00210 Chr10 complement(27395..28039) [645 bp, 214 aa] {ON}...    71   2e-14
KNAG0A04510 Chr1 complement(632334..632939) [606 bp, 201 aa] {ON...    70   2e-14
TPHA0F01280 Chr6 complement(293022..293657) [636 bp, 211 aa] {ON...    70   2e-14
Kpol_529.16 s529 complement(43810..44385) [576 bp, 191 aa] {ON} ...    70   2e-14
SAKL0E08558g Chr5 complement(695313..695990) [678 bp, 225 aa] {O...    71   2e-14
Suva_9.76 Chr9 (134573..135271) [699 bp, 232 aa] {ON} YIL118W (R...    71   2e-14
Smik_12.290 Chr12 complement(544884..545459) [576 bp, 191 aa] {O...    70   3e-14
YLR229C Chr12 complement(604212..604787) [576 bp, 191 aa] {ON}  ...    70   3e-14
NCAS0A06070 Chr1 (1197908..1198585) [678 bp, 225 aa] {ON} Anc_4....    70   3e-14
NDAI0G04930 Chr7 complement(1191671..1192303) [633 bp, 210 aa] {...    70   3e-14
TBLA0F02960 Chr6 (719060..719707) [648 bp, 215 aa] {ON} Anc_7.52...    70   3e-14
TPHA0C02190 Chr3 complement(498886..499461) [576 bp, 191 aa] {ON...    70   3e-14
Suva_10.324 Chr10 complement(570500..571075) [576 bp, 191 aa] {O...    70   3e-14
Skud_12.297 Chr12 complement(544541..545116) [576 bp, 191 aa] {O...    70   3e-14
TPHA0I03130 Chr9 (696033..696662) [630 bp, 209 aa] {ON}                70   3e-14
ADL252W Chr4 (258347..259021) [675 bp, 224 aa] {ON} Syntenic hom...    70   4e-14
KLTH0B06996g Chr2 (565363..566142) [780 bp, 259 aa] {ON} weakly ...    70   4e-14
ACR257C Chr3 complement(808667..809446) [780 bp, 259 aa] {ON} Sy...    70   4e-14
KLLA0D08327g Chr4 (708240..709004) [765 bp, 254 aa] {ON} similar...    70   4e-14
TDEL0H00500 Chr8 complement(74047..74679) [633 bp, 210 aa] {ON} ...    70   4e-14
KLLA0F03443g Chr6 (324020..324691) [672 bp, 223 aa] {ON} highly ...    70   4e-14
NCAS0H00220 Chr8 complement(29761..30399) [639 bp, 212 aa] {ON}        70   5e-14
Suva_3.60 Chr3 (81874..82491) [618 bp, 205 aa] {ON} YCR027C (REAL)     69   6e-14
KNAG0I01930 Chr9 (376663..377622) [960 bp, 319 aa] {ON}                71   6e-14
CAGL0G08558g Chr7 complement(804969..805652) [684 bp, 227 aa] {O...    70   6e-14
Kwal_33.14015 s33 complement(484017..484832) [816 bp, 271 aa] {O...    70   7e-14
KAFR0A03120 Chr1 complement(636653..637282) [630 bp, 209 aa] {ON}      69   8e-14
TBLA0H03330 Chr8 (817665..818243) [579 bp, 192 aa] {ON} Anc_8.42...    69   9e-14
KLTH0H13970g Chr8 (1217045..1217623) [579 bp, 192 aa] {ON} simil...    69   1e-13
NDAI0C04820 Chr3 (1113624..1114199) [576 bp, 191 aa] {ON} Anc_8....    68   1e-13
NCAS0B02880 Chr2 complement(494164..494739) [576 bp, 191 aa] {ON...    68   1e-13
SAKL0D10780g Chr4 (896563..897222) [660 bp, 219 aa] {ON} similar...    68   2e-13
Kwal_55.21937 s55 (1047204..1047830) [627 bp, 208 aa] {ON} YPR16...    68   2e-13
Kpol_1041.7 s1041 (25272..26135) [864 bp, 287 aa] {ON} (25272..2...    69   2e-13
KNAG0D05300 Chr4 (974092..974730) [639 bp, 212 aa] {ON}                68   2e-13
KAFR0B00480 Chr2 complement(98402..99040) [639 bp, 212 aa] {ON} ...    68   2e-13
CAGL0I08459g Chr9 (829562..830194) [633 bp, 210 aa] {ON} highly ...    67   4e-13
TPHA0F02330 Chr6 (513129..514112) [984 bp, 327 aa] {ON} Anc_2.75...    68   4e-13
NCAS0A08470 Chr1 complement(1678221..1678847) [627 bp, 208 aa] {...    67   5e-13
NDAI0D00180 Chr4 complement(26285..26926) [642 bp, 213 aa] {ON}        67   5e-13
Kwal_23.4875 s23 (904790..905482) [693 bp, 230 aa] {ON} YIL118W ...    67   8e-13
ABL139C Chr2 complement(134873..135757) [885 bp, 294 aa] {ON} Sy...    67   9e-13
KNAG0F01270 Chr6 complement(229391..230398) [1008 bp, 335 aa] {O...    67   1e-12
Ecym_1155 Chr1 complement(318859..319560) [702 bp, 233 aa] {ON} ...    66   2e-12
Skud_3.103 Chr3 complement(150880..151509) [630 bp, 209 aa] {ON}...    65   2e-12
YNL304W Chr14 (60297..61550) [1254 bp, 417 aa] {ON}  YPT11Rab fa...    67   2e-12
NCAS0J02000 Chr10 (384676..385347) [672 bp, 223 aa] {ON} Anc_4.326     65   2e-12
AER132W Chr5 (888052..888750) [699 bp, 232 aa] {ON} Syntenic hom...    65   2e-12
KLTH0G09548g Chr7 (802001..802696) [696 bp, 231 aa] {ON} highly ...    65   2e-12
Suva_14.35 Chr14 (56635..57891) [1257 bp, 418 aa] {ON} YNL304W (...    67   2e-12
Skud_14.35 Chr14 (53689..55065) [1377 bp, 458 aa] {ON} YNL304W (...    67   3e-12
NDAI0J00230 Chr10 (38760..39515) [756 bp, 251 aa] {ON}                 65   3e-12
TDEL0A01170 Chr1 complement(198136..198957) [822 bp, 273 aa] {ON...    65   3e-12
Ecym_2048 Chr2 (75961..77217) [1257 bp, 418 aa] {ON} similar to ...    66   4e-12
Ecym_6421 Chr6 (820187..821071) [885 bp, 294 aa] {ON} similar to...    65   4e-12
Smik_14.27 Chr14 (44732..45976) [1245 bp, 414 aa] {ON} YNL304W (...    66   5e-12
KAFR0A08400 Chr1 complement(1686919..1688154) [1236 bp, 411 aa] ...    65   5e-12
KAFR0A07530 Chr1 (1520661..1521554) [894 bp, 297 aa] {ON} Anc_2....    65   6e-12
Smik_3.126 Chr3 complement(166497..167126) [630 bp, 209 aa] {ON}...    64   7e-12
TBLA0E03870 Chr5 (972894..973580) [687 bp, 228 aa] {ON} Anc_2.24...    63   1e-11
TDEL0C04120 Chr3 complement(725595..726290) [696 bp, 231 aa] {ON...    63   2e-11
ADL162W Chr4 (405599..406813) [1215 bp, 404 aa] {ON} Syntenic ho...    64   2e-11
ABR182W Chr2 (754518..755147) [630 bp, 209 aa] {ON} Rho1a; Synte...    62   3e-11
NDAI0A06180 Chr1 complement(1405552..1407303) [1752 bp, 583 aa] ...    64   3e-11
Ecym_7211 Chr7 (442765..443412) [648 bp, 215 aa] {ON} similar to...    62   3e-11
NDAI0H03720 Chr8 (909855..910775) [921 bp, 306 aa] {ON} Anc_2.75       63   3e-11
Kpol_1013.48 s1013 complement(107294..107959) [666 bp, 221 aa] {...    61   6e-11
NCAS0B06460 Chr2 complement(1221860..1222564) [705 bp, 234 aa] {...    61   7e-11
YCR027C Chr3 complement(167370..167999) [630 bp, 209 aa] {ON}  R...    61   8e-11
KAFR0F00400 Chr6 complement(94002..94754) [753 bp, 250 aa] {ON} ...    61   9e-11
TDEL0E00580 Chr5 (126371..127576) [1206 bp, 401 aa] {ON} Anc_3.4...    62   1e-10
TDEL0H00970 Chr8 complement(158769..159638) [870 bp, 289 aa] {ON...    61   1e-10
ZYRO0A01606g Chr1 (133530..134252) [723 bp, 240 aa] {ON} highly ...    60   1e-10
CAGL0M03817g Chr13 complement(431237..432664) [1428 bp, 475 aa] ...    62   1e-10
Kwal_55.21971 s55 complement(1059877..1061142) [1266 bp, 421 aa]...    61   2e-10
NDAI0B03750 Chr2 complement(940372..941094) [723 bp, 240 aa] {ON...    60   3e-10
NCAS0D00420 Chr4 complement(64888..65739) [852 bp, 283 aa] {ON} ...    60   4e-10
Skud_14.154 Chr14 complement(290647..291642) [996 bp, 331 aa] {O...    59   6e-10
YNL180C Chr14 complement(299654..300649) [996 bp, 331 aa] {ON}  ...    59   6e-10
TBLA0D05710 Chr4 (1411089..1412231) [1143 bp, 380 aa] {ON} Anc_1...    59   8e-10
KLLA0C12881g Chr3 (1090895..1092016) [1122 bp, 373 aa] {ON} simi...    59   8e-10
KLTH0F18810g Chr6 complement(1525047..1526393) [1347 bp, 448 aa]...    59   9e-10
NDAI0F03360 Chr6 (810071..811003) [933 bp, 310 aa] {ON} Anc_2.75       59   1e-09
Smik_14.150 Chr14 complement(278905..279900) [996 bp, 331 aa] {O...    58   1e-09
CAGL0G05764g Chr7 complement(552809..553681) [873 bp, 290 aa] {O...    57   3e-09
SAKL0C12716g Chr3 complement(1135452..1136720) [1269 bp, 422 aa]...    57   3e-09
Suva_14.161 Chr14 complement(295880..296878) [999 bp, 332 aa] {O...    57   4e-09
ZYRO0C02618g Chr3 complement(208102..209172) [1071 bp, 356 aa] {...    57   5e-09
TPHA0P01330 Chr16 complement(269708..271318) [1611 bp, 536 aa] {...    56   9e-09
NCAS0A10020 Chr1 complement(2005133..2006716) [1584 bp, 527 aa] ...    55   2e-08
TPHA0O00870 Chr15 complement(162632..163369) [738 bp, 245 aa] {O...    54   2e-08
Kpol_1056.30 s1056 complement(68711..69394) [684 bp, 227 aa] {ON...    54   3e-08
TBLA0B08610 Chr2 complement(2057209..2059068) [1860 bp, 619 aa] ...    55   4e-08
Kpol_1060.60 s1060 complement(139699..140631) [933 bp, 310 aa] {...    53   1e-07
Kwal_47.18241 s47 (748088..748780) [693 bp, 230 aa] {ON} YOR089C...    52   1e-07
TPHA0I03140 Chr9 (697331..697990) [660 bp, 219 aa] {ON} Anc_7.521      51   2e-07
KLTH0G05654g Chr7 complement(450410..451090,451167..451244) [759...    51   3e-07
Kpol_1076.2 s1076 complement(1580..3259) [1680 bp, 559 aa] {ON} ...    52   3e-07
KLLA0F02662g Chr6 (241804..242565) [762 bp, 253 aa] {ON} conserv...    51   3e-07
TBLA0B00790 Chr2 complement(171658..172677) [1020 bp, 339 aa] {O...    51   4e-07
Kpol_505.1 s505 (572..1471) [900 bp, 299 aa] {ON} (572..1471) [9...    50   1e-06
TDEL0A04760 Chr1 complement(841005..841718) [714 bp, 237 aa] {ON}      47   5e-06
Kpol_1002.39 s1002 (115751..116317) [567 bp, 188 aa] {ON} (11575...    47   7e-06
TPHA0J02510 Chr10 complement(557245..557814) [570 bp, 189 aa] {O...    46   1e-05
Skud_16.61 Chr16 (112172..112199,112340..112884) [573 bp, 190 aa...    46   1e-05
KAFR0E01740 Chr5 complement(352927..353958) [1032 bp, 343 aa] {O...    47   2e-05
KLLA0F17072g Chr6 complement(1566668..1567240) [573 bp, 190 aa] ...    45   2e-05
NDAI0B04050 Chr2 complement(1027616..1028029) [414 bp, 137 aa] {...    45   2e-05
KAFR0H01380 Chr8 (258305..258901) [597 bp, 198 aa] {ON} Anc_8.50...    45   2e-05
TBLA0A06090 Chr1 (1499665..1499689,1499931..1500475) [570 bp, 18...    45   2e-05
TPHA0C01660 Chr3 (384105..384704) [600 bp, 199 aa] {ON} Anc_8.50...    45   3e-05
TDEL0E05440 Chr5 complement(998317..998861,998933..998957) [570 ...    45   3e-05
ZYRO0E07304g Chr5 complement(559169..559713,559791..559815) [570...    45   3e-05
Suva_8.147 Chr8 (259965..260516) [552 bp, 183 aa] {ON} YOR094W (...    45   3e-05
KNAG0D01000 Chr4 (164190..164217,164460..165004) [573 bp, 190 aa...    45   3e-05
SAKL0G06908g Chr7 complement(568249..569100) [852 bp, 283 aa] {O...    45   3e-05
Skud_15.259 Chr15 (459133..459684) [552 bp, 183 aa] {ON} YOR094W...    44   4e-05
KAFR0K00190 Chr11 (47432..47459,47605..48149) [573 bp, 190 aa] {...    44   4e-05
AFL114W Chr6 (222754..223326) [573 bp, 190 aa] {ON} Syntenic hom...    44   5e-05
Suva_16.88 Chr16 (148107..148134,148267..148811) [573 bp, 190 aa...    44   5e-05
Smik_6.423 Chr6 complement(684936..685480,685617..685644) [573 b...    44   5e-05
YPL218W Chr16 (138698..138725,138865..139409) [573 bp, 190 aa] {...    44   5e-05
Smik_15.274 Chr15 (463883..464434) [552 bp, 183 aa] {ON} YOR094W...    44   5e-05
Smik_4.98 Chr4 (193129..193674) [546 bp, 181 aa] {ON} YDL137W (R...    44   5e-05
YDL137W Chr4 (216529..217074) [546 bp, 181 aa] {ON}  ARF2ADP-rib...    44   5e-05
Skud_1.12 Chr1 complement(28719..30704) [1986 bp, 661 aa] {ON} Y...    45   5e-05
TPHA0A03130 Chr1 (688097..688642) [546 bp, 181 aa] {ON} Anc_7.30...    44   6e-05
NDAI0A02910 Chr1 (653631..654176) [546 bp, 181 aa] {ON}                44   6e-05
KAFR0L01290 Chr12 complement(239086..239631) [546 bp, 181 aa] {O...    44   6e-05
Skud_4.117 Chr4 (212154..212699) [546 bp, 181 aa] {ON} YDL137W (...    44   6e-05
NDAI0F01490 Chr6 (367903..367927,368225..368772) [573 bp, 190 aa...    44   6e-05
Kpol_1019.32 s1019 (66082..66627) [546 bp, 181 aa] {ON} (66082.....    44   6e-05
KAFR0B01090 Chr2 (206995..207540) [546 bp, 181 aa] {ON} Anc_7.30...    44   6e-05
SAKL0H11066g Chr8 (955148..955741) [594 bp, 197 aa] {ON} highly ...    44   6e-05
YHR022C Chr8 complement(149575..150345) [771 bp, 256 aa] {ON} Pu...    44   6e-05
YOR094W Chr15 (502795..503346) [552 bp, 183 aa] {ON}  ARF3Glucos...    44   6e-05
TPHA0P00900 Chr16 complement(180898..181443) [546 bp, 181 aa] {O...    44   6e-05
TBLA0A05900 Chr1 (1456128..1456673) [546 bp, 181 aa] {ON} Anc_7....    44   7e-05
YAL048C Chr1 complement(52801..54789) [1989 bp, 662 aa] {ON}  GE...    45   7e-05
KAFR0J01900 Chr10 (369226..369768) [543 bp, 180 aa] {ON} Anc_2.1...    44   7e-05
KNAG0C04000 Chr3 (788971..789546) [576 bp, 191 aa] {ON} Anc_7.30...    44   8e-05
CAGL0E05896g Chr5 complement(584585..585129,585415..585439) [570...    44   8e-05
NCAS0D01240 Chr4 complement(226870..227421) [552 bp, 183 aa] {ON...    44   9e-05
NDAI0A02160 Chr1 (489919..490575) [657 bp, 218 aa] {ON} Anc_7.307      44   9e-05
YDL192W Chr4 (116321..116866) [546 bp, 181 aa] {ON}  ARF1ADP-rib...    43   9e-05
Suva_4.107 Chr4 (204848..205393) [546 bp, 181 aa] {ON} YDL137W (...    43   1e-04
Skud_4.66 Chr4 (113702..114247) [546 bp, 181 aa] {ON} YDL192W (R...    43   1e-04
Smik_4.48 Chr4 (94533..95078) [546 bp, 181 aa] {ON} YDL192W (REAL)     43   1e-04
Suva_4.56 Chr4 (104717..105262) [546 bp, 181 aa] {ON} YDL192W (R...    43   1e-04
SAKL0A03960g Chr1 (368829..368850,368923..369467) [567 bp, 188 a...    43   1e-04
Suva_1.16 Chr1 complement(29877..31853) [1977 bp, 658 aa] {ON} Y...    44   1e-04
ZYRO0F05742g Chr6 complement(473659..474204) [546 bp, 181 aa] {O...    43   1e-04
TDEL0C02390 Chr3 (420853..421398) [546 bp, 181 aa] {ON} Anc_7.30...    43   1e-04
CAGL0J11242g Chr10 (1094754..1095908) [1155 bp, 384 aa] {ON} sim...    44   1e-04
Kpol_2000.16 s2000 complement(29208..29753) [546 bp, 181 aa] {ON...    43   1e-04
NCAS0A13870 Chr1 complement(2722379..2722924) [546 bp, 181 aa] {...    43   1e-04
NCAS0E03720 Chr5 complement(731259..731804) [546 bp, 181 aa] {ON...    43   1e-04
CAGL0J09064g Chr10 (894680..895225) [546 bp, 181 aa] {ON} highly...    43   1e-04
Smik_1.15 Chr1 complement(35773..37758) [1986 bp, 661 aa] {ON} Y...    44   1e-04
KNAG0B02830 Chr2 (545859..546404) [546 bp, 181 aa] {ON} Anc_7.30...    43   1e-04
CAGL0I03916g Chr9 (343014..343559) [546 bp, 181 aa] {ON} highly ...    43   2e-04
NCAS0C02320 Chr3 (436472..437071) [600 bp, 199 aa] {ON} Anc_8.502      43   2e-04
TBLA0F02110 Chr6 complement(518429..518974) [546 bp, 181 aa] {ON...    42   2e-04
Kpol_333.2 s333 (2276..2875) [600 bp, 199 aa] {ON} (2276..2875) ...    42   2e-04
KLTH0H03696g Chr8 (335581..335602,335689..336233) [567 bp, 188 a...    42   2e-04
Skud_16.231 Chr16 (424100..424696) [597 bp, 198 aa] {ON} YPL051W...    42   3e-04
Ecym_2181 Chr2 (354573..355145) [573 bp, 190 aa] {ON} similar to...    42   4e-04
AEL232C Chr5 complement(196356..197285) [930 bp, 309 aa] {ON} NO...    42   4e-04
TBLA0A00450 Chr1 complement(83149..83760) [612 bp, 203 aa] {ON} ...    41   5e-04
YPL051W Chr16 (459963..460559) [597 bp, 198 aa] {ON}  ARL3GTPase...    41   5e-04
Kwal_56.24462 s56 complement(1005762..1006307) [546 bp, 181 aa] ...    41   7e-04
TPHA0H02990 Chr8 (715815..717776) [1962 bp, 653 aa] {ON} Anc_7.1...    42   8e-04
Smik_16.185 Chr16 (335352..335948) [597 bp, 198 aa] {ON} YPL051W...    41   8e-04
ZYRO0F08536g Chr6 complement(687627..688223) [597 bp, 198 aa] {O...    40   0.001
KLLA0B02046g Chr2 (178646..179218) [573 bp, 190 aa] {ON} highly ...    40   0.001
Suva_16.264 Chr16 (463019..463615) [597 bp, 198 aa] {ON} YPL051W...    40   0.001
TPHA0B03060 Chr2 complement(695421..696458) [1038 bp, 345 aa] {O...    41   0.001
Kwal_26.6810 s26 complement(74581..76575) [1995 bp, 664 aa] {ON}...    41   0.001
NCAS0B06760 Chr2 (1290711..1291256) [546 bp, 181 aa] {ON} Anc_2....    40   0.001
SAKL0E10054g Chr5 (843076..843621) [546 bp, 181 aa] {ON} highly ...    40   0.001
KLTH0G07172g Chr7 (578557..579714) [1158 bp, 385 aa] {ON} some s...    40   0.002
AGL261W Chr7 (218211..218807) [597 bp, 198 aa] {ON} Syntenic hom...    40   0.002
Kwal_27.11872 s27 complement(985259..985852) [594 bp, 197 aa] {O...    39   0.002
ZYRO0E02090g Chr5 complement(155560..156105) [546 bp, 181 aa] {O...    39   0.002
SAKL0G11154g Chr7 (951384..952457) [1074 bp, 357 aa] {ON} weakly...    40   0.003
KLTH0H02200g Chr8 (199831..200376) [546 bp, 181 aa] {ON} highly ...    39   0.003
Ecym_2552 Chr2 complement(1071072..1071668) [597 bp, 198 aa] {ON...    39   0.003
TDEL0B01350 Chr2 (239829..240425) [597 bp, 198 aa] {ON} Anc_8.50...    39   0.003
ZYRO0A05500g Chr1 complement(448060..448785) [726 bp, 241 aa] {O...    39   0.003
NDAI0E03010 Chr5 (642507..643181) [675 bp, 224 aa] {ON} Anc_8.502      39   0.004
KLTH0E11660g Chr5 complement(1038583..1039245) [663 bp, 220 aa] ...    39   0.004
Kwal_56.24453 s56 complement(1004296..1004841) [546 bp, 181 aa] ...    39   0.004
TBLA0A04400 Chr1 complement(1082864..1084813) [1950 bp, 649 aa] ...    39   0.006
CAGL0L12826g Chr12 complement(1373063..1373662) [600 bp, 199 aa]...    38   0.008
TPHA0F01600 Chr6 (371312..371857) [546 bp, 181 aa] {ON} Anc_2.19...    38   0.008
KLTH0H02222g Chr8 (201281..201826) [546 bp, 181 aa] {ON} highly ...    37   0.009
SAKL0F10296g Chr6 complement(791446..791991) [546 bp, 181 aa] {O...    37   0.010
Ecym_5356 Chr5 complement(720805..721350) [546 bp, 181 aa] {ON} ...    37   0.012
Ecym_8057 Chr8 complement(123686..124231) [546 bp, 181 aa] {ON} ...    37   0.012
ADR094W Chr4 (878121..878666) [546 bp, 181 aa] {ON} Syntenic hom...    37   0.012
TBLA0B01480 Chr2 complement(320668..321213) [546 bp, 181 aa] {ON...    37   0.013
Kwal_23.2944 s23 complement(84192..84746) [555 bp, 184 aa] {ON} ...    37   0.015
KLLA0A03465g Chr1 complement(314573..316552) [1980 bp, 659 aa] {...    38   0.015
CAGL0M12144g Chr13 (1212803..1215718) [2916 bp, 971 aa] {ON} hig...    38   0.016
Ecym_7092 Chr7 (177595..178146) [552 bp, 183 aa] {ON} similar to...    37   0.018
SAKL0H08624g Chr8 complement(744555..745106) [552 bp, 183 aa] {O...    37   0.019
SAKL0F10318g Chr6 complement(793294..793782) [489 bp, 162 aa] {O...    36   0.021
KNAG0A02140 Chr1 (186453..187052) [600 bp, 199 aa] {ON} Anc_8.50...    36   0.026
AGR221W Chr7 (1164825..1165376) [552 bp, 183 aa] {ON} Syntenic h...    36   0.029
CAGL0E06292g Chr5 (633372..634598) [1227 bp, 408 aa] {ON} some s...    37   0.034
KLTH0D08074g Chr4 complement(684208..685701) [1494 bp, 497 aa] {...    37   0.035
TDEL0F01430 Chr6 complement(253231..253776) [546 bp, 181 aa] {ON...    36   0.035
Kpol_1020.46 s1020 (107506..108051) [546 bp, 181 aa] {ON} (10750...    36   0.036
KLTH0G08074g Chr7 complement(651983..652537) [555 bp, 184 aa] {O...    36   0.036
ACL078W Chr3 (212664..213209) [546 bp, 181 aa] {ON} Syntenic hom...    36   0.036
NDAI0E02560 Chr5 complement(533331..533882) [552 bp, 183 aa] {ON...    36   0.038
CAGL0I10835g Chr9 (1071206..1071757) [552 bp, 183 aa] {ON} highl...    35   0.041
NCAS0C01840 Chr3 complement(342241..342792) [552 bp, 183 aa] {ON...    35   0.044
KLLA0F05225g Chr6 (515391..515936) [546 bp, 181 aa] {ON} highly ...    35   0.045
KLLA0E24773g Chr5 (2194554..2195105) [552 bp, 183 aa] {ON} highl...    35   0.045
Ecym_5018 Chr5 complement(39804..41783) [1980 bp, 659 aa] {ON} s...    36   0.056
KLLA0C13563g Chr3 complement(1157278..1157826) [549 bp, 182 aa] ...    35   0.058
KNAG0H03300 Chr8 (620438..620983) [546 bp, 181 aa] {ON} Anc_2.19...    35   0.060
TPHA0A01165 Chr1 complement(228734..229285) [552 bp, 183 aa] {ON}      35   0.066
TDEL0A05420 Chr1 (950041..950592) [552 bp, 183 aa] {ON} Anc_8.59...    35   0.068
Skud_2.292 Chr2 complement(535291..535842) [552 bp, 183 aa] {ON}...    35   0.069
NDAI0B04110 Chr2 (1042191..1042736) [546 bp, 181 aa] {ON} Anc_6....    35   0.071
TBLA0E04020 Chr5 (1011363..1011914) [552 bp, 183 aa] {ON} Anc_8....    35   0.077
Suva_4.416 Chr4 complement(737342..737893) [552 bp, 183 aa] {ON}...    35   0.080
Smik_2.305 Chr2 complement(554080..554631) [552 bp, 183 aa] {ON}...    35   0.081
YBR164C Chr2 complement(567875..568426) [552 bp, 183 aa] {ON}  A...    35   0.081
ZYRO0A10340g Chr1 complement(841263..841814) [552 bp, 183 aa] {O...    35   0.089
KAFR0E00655 Chr5 complement(145183..145734) [552 bp, 183 aa] {ON}      35   0.089
NDAI0H01980 Chr8 (479594..481675) [2082 bp, 693 aa] {ON} Anc_7.1...    35   0.089
KNAG0A01690 Chr1 complement(99320..99871) [552 bp, 183 aa] {ON} ...    34   0.10 
TBLA0E01940 Chr5 complement(474121..476922) [2802 bp, 933 aa] {O...    35   0.11 
TDEL0E03600 Chr5 (677077..677943) [867 bp, 288 aa] {ON} Anc_5.26...    35   0.12 
Skud_13.177 Chr13 complement(306114..307697) [1584 bp, 527 aa] {...    35   0.13 
KLLA0E11639g Chr5 (1028781..1029998) [1218 bp, 405 aa] {ON} simi...    35   0.13 
KLTH0E13838g Chr5 (1219497..1220048) [552 bp, 183 aa] {ON} highl...    34   0.14 
TDEL0H04320 Chr8 (743371..745332) [1962 bp, 653 aa] {ON} Anc_7.1...    34   0.17 
Suva_16.203 Chr16 complement(356955..357512) [558 bp, 185 aa] {O...    33   0.21 
NCAS0A07600 Chr1 (1510813..1512783) [1971 bp, 656 aa] {ON}             34   0.23 
NCAS0E02340 Chr5 complement(457570..460521) [2952 bp, 983 aa] {O...    34   0.29 
TBLA0A01350 Chr1 (320382..321452) [1071 bp, 356 aa] {ON} Anc_1.4...    33   0.32 
KLTH0D00880g Chr4 complement(84021..86015) [1995 bp, 664 aa] {ON...    33   0.35 
ADR402W Chr4 (1426897..1428882) [1986 bp, 661 aa] {ON} Syntenic ...    33   0.38 
Suva_1.30 Chr1 (53039..56005) [2967 bp, 988 aa] {ON} YAL035W (REAL)    33   0.40 
NCAS0A07490 Chr1 complement(1488151..1490121) [1971 bp, 656 aa] ...    33   0.41 
TPHA0N00410 Chr14 (75463..78426) [2964 bp, 987 aa] {ON} Anc_7.50...    33   0.43 
Suva_13.190 Chr13 complement(310063..311646) [1584 bp, 527 aa] {...    33   0.47 
Kpol_1049.6 s1049 (13314..15272) [1959 bp, 652 aa] {ON} (13314.....    33   0.47 
KAFR0E02440 Chr5 complement(494552..497515) [2964 bp, 987 aa] {O...    33   0.60 
SAKL0D14498g Chr4 (1190537..1190579,1190642..1192623) [2025 bp, ...    33   0.62 
YAL035W Chr1 (76427..79435) [3009 bp, 1002 aa] {ON}  FUN12GTPase...    33   0.62 
KAFR0B05110 Chr2 complement(1051041..1051583) [543 bp, 180 aa] {...    32   0.63 
Smik_1.29 Chr1 (59406..62372) [2967 bp, 988 aa] {ON} YAL035W (REAL)    32   0.79 
TBLA0A10480 Chr1 (2580976..2582211) [1236 bp, 411 aa] {ON} Anc_5...    32   0.81 
YMR023C Chr13 complement(319437..321017) [1581 bp, 526 aa] {ON} ...    32   0.82 
KAFR0I00240 Chr9 complement(51330..53309) [1980 bp, 659 aa] {ON}...    32   0.92 
TDEL0G03240 Chr7 complement(603053..603583) [531 bp, 176 aa] {ON...    31   1.0  
CAGL0M12276g Chr13 (1225135..1227084) [1950 bp, 649 aa] {ON} hig...    32   1.1  
KLLA0E12805g Chr5 (1135181..1135780) [600 bp, 199 aa] {ON} simil...    31   1.5  
AGR312W Chr7 (1313736..1315586) [1851 bp, 616 aa] {ON} Syntenic ...    31   1.7  
NDAI0D01840 Chr4 (432480..433610) [1131 bp, 376 aa] {ON} Anc_5.2...    31   1.9  
TPHA0I02500 Chr9 complement(554264..555934) [1671 bp, 556 aa] {O...    31   2.1  
Kwal_56.24149 s56 complement(873371..873820) [450 bp, 149 aa] {O...    30   2.3  
TBLA0I01600 Chr9 complement(348934..351318) [2385 bp, 794 aa] {O...    31   2.4  
KNAG0F02740 Chr6 (519000..519956) [957 bp, 318 aa] {ON} Anc_5.26...    31   2.4  
TBLA0B09230 Chr2 complement(2184288..2184752) [465 bp, 154 aa] {...    30   2.8  
Smik_13.187 Chr13 complement(311260..312843) [1584 bp, 527 aa] {...    30   3.6  
ZYRO0E06446g Chr5 complement(488300..489820) [1521 bp, 506 aa] {...    30   4.0  
KAFR0A02180 Chr1 complement(455809..457344) [1536 bp, 511 aa] {O...    30   4.2  
YMR138W Chr13 (545155..545730) [576 bp, 191 aa] {ON}  CIN4GTP-bi...    30   4.5  
ZYRO0C00770g Chr3 complement(58234..60192) [1959 bp, 652 aa] {ON...    30   5.6  
KNAG0E04140 Chr5 (820949..822970) [2022 bp, 673 aa] {ON} Anc_7.1...    30   6.1  
CAGL0M07546g Chr13 (756457..757920) [1464 bp, 487 aa] {ON} simil...    30   6.1  
Skud_9.149 Chr9 complement(283642..284427) [786 bp, 261 aa] {ON}...    29   6.5  
Ecym_8058 Chr8 complement(125461..126084) [624 bp, 207 aa] {ON} ...    29   6.8  
SAKL0E04906g Chr5 (398680..399306) [627 bp, 208 aa] {ON} similar...    29   7.8  
TPHA0A04860 Chr1 (1101377..1102297) [921 bp, 306 aa] {ON} Anc_5....    29   7.9  

>NCAS0H00850 Chr8 (155266..155892) [627 bp, 208 aa] {ON} Anc_6.24
          Length = 208

 Score =  395 bits (1015), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 193/208 (92%), Positives = 193/208 (92%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN
Sbjct: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           QS               QLDDEPNSCSC
Sbjct: 181 QSDADAFDDDFNDAINIQLDDEPNSCSC 208

>NDAI0D00840 Chr4 (189925..190551) [627 bp, 208 aa] {ON} Anc_6.24
          Length = 208

 Score =  368 bits (944), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 174/208 (83%), Positives = 189/208 (90%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDK+ATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKIATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFL+HAN+S+PETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLIHANISTPETFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNK+D++E+KK+VS+N+A ELAKSLG+ PLF TSAKDSINI+NAFEEIARSALQQN
Sbjct: 121 FVILGNKIDVEESKKIVSSNSATELAKSLGDIPLFFTSAKDSINIENAFEEIARSALQQN 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               +LD EPNSCSC
Sbjct: 181 QNDVDAFDEDFNDAINIRLDGEPNSCSC 208

>SAKL0E01386g Chr5 (105246..105872) [627 bp, 208 aa] {ON} highly
           similar to uniprot|P32939 Saccharomyces cerevisiae
           YML001W YPT7 Gtp-binding protein of the rab family
           required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 208

 Score =  360 bits (923), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 187/208 (89%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT+D+DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDEDKVATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNK+D++E+KKVV+  +AQELAKSLGN PLF+TSAK SIN++ AFEEIARSALQQ+
Sbjct: 121 FVILGNKIDVEESKKVVNTRSAQELAKSLGNVPLFLTSAKGSINVETAFEEIARSALQQS 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               QLD EP+SC+C
Sbjct: 181 QADADAFEDDFNDAINIQLDGEPSSCNC 208

>TDEL0G04450 Chr7 complement(808210..808836) [627 bp, 208 aa] {ON}
           Anc_6.24 YML001W
          Length = 208

 Score =  359 bits (922), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 184/208 (88%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +DDDKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIKSWRDEFLVHANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNVKSFENIKSWRDEFLVHANVSSPETFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNK+D++E+KKVV+  +AQ+LAKSLGN PLF TSAK++IN+D AFEEI RSALQQN
Sbjct: 121 FVILGNKIDVEESKKVVNTKSAQDLAKSLGNVPLFFTSAKNAINVDTAFEEIGRSALQQN 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               QLD EP+SCSC
Sbjct: 181 QADADAFEEDFNDAINIQLDGEPSSCSC 208

>ZYRO0C07700g Chr3 complement(584547..585170) [624 bp, 207 aa] {ON}
           highly similar to uniprot|P32939 Saccharomyces
           cerevisiae YML001W YPT7 Gtp-binding protein of the rab
           family required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 207

 Score =  358 bits (919), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 185/208 (88%), Gaps = 1/208 (0%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT+DD KVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD-KVATM 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANV SPETFP
Sbjct: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVLSPETFP 119

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNKVD++E+KK VS  +AQELAKSLGN PLF+TSAK++IN+D AFEEIARSALQQN
Sbjct: 120 FVILGNKVDVEESKKTVSVKSAQELAKSLGNVPLFLTSAKNAINVDTAFEEIARSALQQN 179

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               QLD EP++CSC
Sbjct: 180 QADADAFEEDFNDAINIQLDGEPSACSC 207

>Kpol_1037.28 s1037 (68071..68697) [627 bp, 208 aa] {ON}
           (68071..68697) [627 nt, 209 aa]
          Length = 208

 Score =  358 bits (919), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 186/208 (89%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSSRKKNILKVI+LGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT+DDDK ATM
Sbjct: 1   MSSRKKNILKVIVLGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDDKAATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN+KSFENIKSWRDEFL+HANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNSKSFENIKSWRDEFLIHANVSSPETFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNK+D++++KK+V+  +AQELAK LG+ PLF+TSAK++IN+D AFEEIARSALQQN
Sbjct: 121 FVILGNKIDVEDSKKIVTQKSAQELAKELGDVPLFLTSAKNAINVDQAFEEIARSALQQN 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               QLD EP+SCSC
Sbjct: 181 QADADAFEDDFNDAINIQLDGEPSSCSC 208

>Smik_13.158 Chr13 (258333..258959) [627 bp, 208 aa] {ON} YML001W
           (REAL)
          Length = 208

 Score =  357 bits (917), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 172/208 (82%), Positives = 184/208 (88%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT+D DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNA SFENIKSWRDEFLVHANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVSSPETFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNK+D +E+KKVVS  +AQELAKSLG+ PLF+TSAK++IN+D AFEEIARSALQQN
Sbjct: 121 FVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               +LD E NSCSC
Sbjct: 181 QADTEAFEDDYNDAINIRLDGENNSCSC 208

>KLTH0C11132g Chr3 complement(915337..915963) [627 bp, 208 aa] {ON}
           highly similar to uniprot|P32939 Saccharomyces
           cerevisiae YML001W YPT7 Gtp-binding protein of the rab
           family required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 208

 Score =  357 bits (916), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 186/208 (89%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSSRKKNILKVIILGDSGVGKTSLMHRYVNDK+SQQYKATIGADFLTKEVT+D DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKFSQQYKATIGADFLTKEVTMDGDKVATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNK+D++E+KKVVS  +AQ++AKSLGN PLF+TSAK SIN+D AFEEIAR+ALQQ+
Sbjct: 121 FVILGNKLDVEESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQS 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               QLD EP+SCSC
Sbjct: 181 QADADAFEDDFNDAINIQLDGEPSSCSC 208

>Ecym_3028 Chr3 (54759..55385) [627 bp, 208 aa] {ON} similar to
           Ashbya gossypii ACR003C
          Length = 208

 Score =  356 bits (914), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 168/208 (80%), Positives = 186/208 (89%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT+D DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN+KSFENIK+WRDEFLVHANV SPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNSKSFENIKAWRDEFLVHANVPSPETFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNK+D++E+KKVV+  ++QELAKSLGN P F+TSAK++IN+D+AFEEIARSALQQ+
Sbjct: 121 FVILGNKIDVEESKKVVTTRSSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQS 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               QLD EP+SCSC
Sbjct: 181 QADADAYEDDFNDAINIQLDGEPSSCSC 208

>Suva_13.161 Chr13 (257150..257776) [627 bp, 208 aa] {ON} YML001W
           (REAL)
          Length = 208

 Score =  356 bits (913), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 184/208 (88%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT+D DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNA SFENIKSWRDEFLVHANV+SPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNK+D +E+KKVVS  +AQELAKSLG+ PLF+TSAK++IN+D AFEEIARSALQQN
Sbjct: 121 FVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               +LD E NSCSC
Sbjct: 181 QADTEAFEDDYNDAINIRLDGENNSCSC 208

>Skud_13.153 Chr13 (253075..253701) [627 bp, 208 aa] {ON} YML001W
           (REAL)
          Length = 208

 Score =  356 bits (913), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 184/208 (88%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT+D DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNA SFENIKSWRDEFLVHANV+SPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNK+D +E+KKVVS  +AQELAKSLG+ PLF+TSAK++IN+D AFEEIARSALQQN
Sbjct: 121 FVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               +LD E NSCSC
Sbjct: 181 QADTEAFEDDYNDAINIRLDGENNSCSC 208

>YML001W Chr13 (267174..267800) [627 bp, 208 aa] {ON}  YPT7Rab
           family GTPase; GTP-binding protein of the rab family;
           required for homotypic fusion event in vacuole
           inheritance, for endosome-endosome fusion, similar to
           mammalian Rab7
          Length = 208

 Score =  355 bits (912), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 170/208 (81%), Positives = 184/208 (88%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT+D DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNA SFENIKSWRDEFLVHANV+SPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNK+D +E+KK+VS  +AQELAKSLG+ PLF+TSAK++IN+D AFEEIARSALQQN
Sbjct: 121 FVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               +LD E NSCSC
Sbjct: 181 QADTEAFEDDYNDAINIRLDGENNSCSC 208

>ACR003C Chr3 complement(359762..360388) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML001W
           (YPT7)
          Length = 208

 Score =  355 bits (910), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 185/208 (88%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT+D DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFEN+KSWRDEFLVHANV SPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNK+D++E+KKVV+   +QELAKSLGN P F+TSAK++IN+D+AFEEIARSALQQ+
Sbjct: 121 FVILGNKIDVEESKKVVTTRTSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQS 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               QLD EP+SC+C
Sbjct: 181 QADAGAYEDDFNDAINIQLDGEPSSCNC 208

>KNAG0M01220 Chr13 (222591..223214) [624 bp, 207 aa] {ON} Anc_6.24
           YML001W
          Length = 207

 Score =  353 bits (905), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 183/208 (87%), Gaps = 1/208 (0%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MS RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT+DD KVATM
Sbjct: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD-KVATM 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIK+W+DEFLVHANVSSPETFP
Sbjct: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNKVD++E+KK+V+  AAQELA SLGN PLF+TSAK +IN+D AFEEIARSALQQN
Sbjct: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               QLD EPNSCSC
Sbjct: 180 QNDADAFEEDFNDAINIQLDGEPNSCSC 207

>Kwal_56.22440 s56 (130574..131200) [627 bp, 208 aa] {ON} YML001W
           (YPT7) - GTP-binding protein, rab family [contig 185]
           FULL
          Length = 208

 Score =  352 bits (904), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 168/208 (80%), Positives = 186/208 (89%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MS+RKKNILKVIILGDSGVGKTSLMHRYV+DK+SQQYKATIGADFLTKEV++D DKVATM
Sbjct: 1   MSARKKNILKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSMDGDKVATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNK+D++E+KKVVS  +AQ++AKSLGN PLF+TSAK SIN+D AFEEIAR+ALQQ+
Sbjct: 121 FVILGNKLDVEESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQS 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               QLD EP+SCSC
Sbjct: 181 QADADAFEDDFNDAINIQLDGEPSSCSC 208

>KLLA0D01265g Chr4 (110784..111407) [624 bp, 207 aa] {ON} highly
           similar to uniprot|P32939 Saccharomyces cerevisiae
           YML001W YPT7 Gtp-binding protein of the rab family
           required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 207

 Score =  352 bits (903), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 168/206 (81%), Positives = 182/206 (88%)

Query: 3   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQV 62
           SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV ++DDKVATMQV
Sbjct: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61

Query: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFV 122
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+KSWRDEFLVHANVSSPETFPFV
Sbjct: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121

Query: 123 ILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQS 182
           IL NKVD++E+KKVVS+ +AQE AKSLGN PLF TSAKDSIN+ +AFEEIARSALQQ+QS
Sbjct: 122 ILANKVDVEESKKVVSSRSAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181

Query: 183 XXXXXXXXXXXXXXXQLDDEPNSCSC 208
                          QLD EP+SC+C
Sbjct: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207

>CAGL0E02607g Chr5 complement(248998..249624) [627 bp, 208 aa] {ON}
           highly similar to uniprot|P32939 Saccharomyces
           cerevisiae YML001w YPT7 GTP-binding protein of the RAB
           family
          Length = 208

 Score =  350 bits (898), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 182/208 (87%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M +RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +DDDKV TM
Sbjct: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSW+DEFLVHAN+SSPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNKVDI+++KKVVS  A QELAKSLG+ PLF+TSAK +IN+D AFEEIA+SALQQN
Sbjct: 121 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               QL+ E NSCSC
Sbjct: 181 QNDAHAFEDDFNDAINIQLEGESNSCSC 208

>KAFR0G02670 Chr7 complement(552130..552756) [627 bp, 208 aa] {ON}
           Anc_6.24 YML001W
          Length = 208

 Score =  349 bits (895), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 166/208 (79%), Positives = 181/208 (87%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MSS+KK ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKE+ +D D+ ATM
Sbjct: 1   MSSKKKTILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEINVDGDRTATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIKSWRDEFLVHANVSSPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNTKSFENIKSWRDEFLVHANVSSPESFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNK+DI+ETKKV+S  +AQ+LAKSLGN PLF+TSAK SIN+D AFEEIARSALQQN
Sbjct: 121 FVILGNKIDIEETKKVISVKSAQDLAKSLGNIPLFLTSAKSSINVDPAFEEIARSALQQN 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           Q+               QLD E +SC+C
Sbjct: 181 QNDADAFEEDFNDAINIQLDGEADSCAC 208

>TBLA0A07180 Chr1 complement(1787774..1788400) [627 bp, 208 aa] {ON}
           Anc_6.24 YML001W
          Length = 208

 Score =  343 bits (881), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 164/208 (78%), Positives = 179/208 (86%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MS+RKK ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV ID+D  ATM
Sbjct: 1   MSTRKKQILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVAIDNDTTATM 60

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIKSWRDEFL+HANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNPKSFENIKSWRDEFLIHANVSSPETFP 120

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           FVILGNKVD  ++KK V+  AAQEL+KSLGN PLF TSAK+SIN+D+AFEEIAR AL+QN
Sbjct: 121 FVILGNKVDTKDSKKSVTLKAAQELSKSLGNIPLFQTSAKNSINVDSAFEEIARGALEQN 180

Query: 181 QSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           ++               QLD EP+SC+C
Sbjct: 181 KADADAYEDDFNDAINIQLDGEPSSCAC 208

>TPHA0J00360 Chr10 (80553..81182) [630 bp, 209 aa] {ON} Anc_6.24
           YML001W
          Length = 209

 Score =  339 bits (869), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 162/209 (77%), Positives = 179/209 (85%), Gaps = 1/209 (0%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDD-DKVAT 59
           MSSRKKN+LKVI+LGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV IDD  + AT
Sbjct: 1   MSSRKKNLLKVIVLGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVIDDGSQAAT 60

Query: 60  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETF 119
           MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+NIKSWRDEFL+HANVSSPETF
Sbjct: 61  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNPKSFDNIKSWRDEFLIHANVSSPETF 120

Query: 120 PFVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQ 179
           PFVILGNK+DI+++K+ +SA   QE+AK LGN PLF+TSAKDSIN+D AFEEI R ALQQ
Sbjct: 121 PFVILGNKIDIEDSKQKISAKQGQEMAKELGNIPLFLTSAKDSINVDVAFEEITRGALQQ 180

Query: 180 NQSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           NQ+               QLDDE +SC+C
Sbjct: 181 NQNDADAFKDDFNDAINIQLDDESSSCAC 209

>Kwal_23.5058 s23 (989533..990174) [642 bp, 213 aa] {ON} YFL005W
           (SEC4) - Ras-like small GTP-binding protein [contig 7]
           FULL
          Length = 213

 Score =  140 bits (353), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 110/168 (65%), Gaps = 8/168 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTA 66
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V I+  KV  +Q+WDTA
Sbjct: 19  SIMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 77

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFANVKQWFSTVNQHAN----DEAQLLLVGN 133

Query: 127 KVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           K D+D   + VS +  + LAK LG  P    SAKD  N+++ F ++A+
Sbjct: 134 KSDMDT--RAVSTDQGESLAKELG-IPFVEASAKDDTNVNDIFFQLAK 178

>ABR220W Chr2 (817292..817906) [615 bp, 204 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL038C (YPT1)
          Length = 204

 Score =  140 bits (352), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 74/174 (42%), Positives = 113/174 (64%), Gaps = 7/174 (4%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRGA   ++VYDVT+ +SF+N+K+W  E   +      +   
Sbjct: 60  QIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQEIDRYGTAGVVK--- 116

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            +++GNK D+ + KKVV    A+E A SL N P+  TSA DS N++ AF  +AR
Sbjct: 117 -LLVGNKNDLKD-KKVVDFEVAREFADSL-NIPVLETSALDSSNVEEAFLTMAR 167

>KLTH0A02662g Chr1 complement(226313..226954) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P07560 Saccharomyces
           cerevisiae YFL005W SEC4 Secretory vesicle-associated Rab
           GTPase essential for exocytosis associates with the
           exocyst component Sec15p and may regulate polarized
           delivery of transport vesicles to the exocyst at the
           plasma membrane
          Length = 213

 Score =  139 bits (350), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 109/168 (64%), Gaps = 8/168 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTA 66
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V I+  KV  +Q+WDTA
Sbjct: 19  SIMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 77

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWFSTVNQHAN----DEAQLLLVGN 133

Query: 127 KVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           K D+D   + VS +  + LAK LG  P    SAKD  N+++ F  +A+
Sbjct: 134 KSDMDT--RAVSTDQGEALAKELG-IPFVEASAKDDTNVNDIFFLLAK 178

>Suva_6.54 Chr6 (102191..102838) [648 bp, 215 aa] {ON} YFL005W
           (REAL)
          Length = 215

 Score =  139 bits (350), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 111/168 (66%), Gaps = 8/168 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTA 66
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V I+  KV  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 77

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN----DEAQLLLVGN 133

Query: 127 KVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           K D+D   +VV+A+  + LAK LG  P   +SAK+  N++  F  +AR
Sbjct: 134 KSDMD--TRVVTADQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAR 178

>AGL021W Chr7 (681754..682392) [639 bp, 212 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL005W (SEC4)
          Length = 212

 Score =  139 bits (350), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 111/176 (63%), Gaps = 11/176 (6%)

Query: 2   SSRKKN---ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVA 58
           SS  KN   I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V I+  K+ 
Sbjct: 10  SSGAKNYDSIMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKAVDINGKKIK 69

Query: 59  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPET 118
            +Q+WDTAGQERF+++  A+YRGA   +LVYDVT+ ++FENI+ W      HAN    E 
Sbjct: 70  -LQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFTTVNQHAN----EE 124

Query: 119 FPFVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
              +++GNK D+D   + V+    + LAK LG  P    SAKD  N+ + F  +A+
Sbjct: 125 AQLLLVGNKKDMD--TRAVTYEQGESLAKELG-VPFIEASAKDDENVSDIFFTLAK 177

>KAFR0B01660 Chr2 complement(318959..319579) [621 bp, 206 aa] {ON}
           Anc_8.70 YFL005W
          Length = 206

 Score =  139 bits (350), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 112/177 (63%), Gaps = 11/177 (6%)

Query: 1   MSSRKKN---ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKV 57
           MS   KN   I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V I+  KV
Sbjct: 1   MSGNGKNYDSIMKILLIGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKV 60

Query: 58  ATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPE 117
             +Q+WDTAGQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +
Sbjct: 61  K-LQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNDHAN----D 115

Query: 118 TFPFVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
               +++GNK D+D   ++V+    + LAK LG  P   +SAKD  N++  F  +AR
Sbjct: 116 DAQLLLVGNKSDMDT--RLVTYEQGEALAKELG-LPFVESSAKDDQNVNEIFFTLAR 169

>KAFR0C03330 Chr3 (679443..680075) [633 bp, 210 aa] {ON} Anc_8.70
           YFL005W
          Length = 210

 Score =  138 bits (347), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 108/167 (64%), Gaps = 8/167 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V I+  K+  +Q+WDTAG
Sbjct: 16  IMKILLIGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVEINGKKIK-LQLWDTAG 74

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QERF+++  A+YRGA   +LVYDVT+ K+F NI  W      HAN    +    +++GNK
Sbjct: 75  QERFRTITTAYYRGAMGIILVYDVTDEKTFANINKWFKTVTEHAN----DDAQLLLVGNK 130

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            D+D   +VVS    + LAK LG  P   +SAKD+ N+ + F  +A+
Sbjct: 131 NDMDT--RVVSCEQGEVLAKELG-LPFVESSAKDNNNVSDIFLSLAK 174

>Ecym_1518 Chr1 (1069582..1070196) [615 bp, 204 aa] {ON} similar to
           Ashbya gossypii ABR220W
          Length = 204

 Score =  138 bits (347), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 73/174 (41%), Positives = 112/174 (64%), Gaps = 7/174 (4%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRGA   ++VYDVT+ +SF N+K+W  E   +      +   
Sbjct: 60  QIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRYGTAGVVK--- 116

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            +++GNK D+ + KKVV    A+E A SL + P+  TSA DS N++ AF  +AR
Sbjct: 117 -LLVGNKNDLKD-KKVVDFEVAKEFADSL-SIPVLETSALDSSNVEEAFLTMAR 167

>SAKL0B01012g Chr2 complement(92466..93080) [615 bp, 204 aa] {ON}
           highly similar to uniprot|P01123 Saccharomyces
           cerevisiae YFL038C YPT1 Ras-like small GTPase involved
           in the ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 204

 Score =  137 bits (346), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 73/174 (41%), Positives = 111/174 (63%), Gaps = 7/174 (4%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVDLDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRGA   ++VYDVT+ +SF N+K+W  E   +      +   
Sbjct: 60  QIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRYGTAGVLK--- 116

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            +++GNK D+ + KKVV    A+E A SL   P+  TSA DS N++ AF  +AR
Sbjct: 117 -LLVGNKNDLTD-KKVVEYEVAKEFADSL-QIPVLETSALDSSNVEEAFLTMAR 167

>Ecym_7305 Chr7 (650045..650686) [642 bp, 213 aa] {ON} similar to
           Ashbya gossypii AGL021W
          Length = 213

 Score =  137 bits (346), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 107/168 (63%), Gaps = 8/168 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTA 66
           +I+KV+++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ID  K+  +Q+WDTA
Sbjct: 19  SIMKVLLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDIDGKKIK-LQLWDTA 77

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQERF+++  A+YRGA   +LVYDVT+ ++FENI+ W      HA     E    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFSTVNQHAT----EDAQILLVGN 133

Query: 127 KVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           K D+D   + V+    + LAK LG  P    SAKD  N+ + F  +A+
Sbjct: 134 KKDMD--TRAVTYEQGESLAKELG-VPFIEASAKDDENVSDIFFTLAK 178

>Smik_6.73 Chr6 (143556..144203) [648 bp, 215 aa] {ON} YFL005W
           (REAL)
          Length = 215

 Score =  138 bits (347), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 111/168 (66%), Gaps = 8/168 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTA 66
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V I+  KV  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 77

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN----DEAQLLLVGN 133

Query: 127 KVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           K D+D   +VV+A+  + LAK LG  P   +SAK+  N++  F  +A+
Sbjct: 134 KSDMDT--RVVTADQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAK 178

>Kpol_1011.3 s1011 complement(4828..5472) [645 bp, 214 aa] {ON}
           complement(4828..5472) [645 nt, 215 aa]
          Length = 214

 Score =  137 bits (345), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 109/167 (65%), Gaps = 8/167 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V I+  K+  +Q+WDTAG
Sbjct: 19  IMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVEINGKKIK-LQLWDTAG 77

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QERF+++  A+YRGA   +LVYDVT+ K+F NI+ W      HAN    +    +++GNK
Sbjct: 78  QERFRTITTAYYRGAMGIILVYDVTDEKTFANIRQWFKTVTEHAN----DEAQLLLVGNK 133

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            D+D   + V+    +EL+K LG  P   +SAK+  N++  F  +A+
Sbjct: 134 SDMD--TRAVTYEQGEELSKELG-IPFIESSAKNDENVNEIFSTLAK 177

>KLLA0E12079g Chr5 (1075299..1075943) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005W SEC4 Secretory vesicle-associated Rab GTPase
           essential for exocytosis associates with the exocyst
           component Sec15p and may regulate polarized delivery of
           transport vesicles to the exocyst at the plasma membrane
          Length = 214

 Score =  137 bits (345), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 107/168 (63%), Gaps = 8/168 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTA 66
           +++K+++LGDSGVGK+ L+ R+V DK++  +  TIG DF  K V I+  +V  +Q+WDTA
Sbjct: 19  SVMKILLLGDSGVGKSCLLVRFVEDKFTPTFITTIGIDFKIKTVDINGKRVK-LQLWDTA 77

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQERF+++  A+YRGA   VL+YDVT+ ++FENI+ W      HA+    E    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIVLIYDVTDERTFENIRQWFSTVNQHAS----EDVVMLLVGN 133

Query: 127 KVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           K D+D   + VS    + LAK LG  P    SAKD  N+   F  +A+
Sbjct: 134 KKDMD--TRTVSYEQGEALAKELG-IPFIEASAKDDTNVSEIFFTLAK 178

>KNAG0D02650 Chr4 (474662..475297) [636 bp, 211 aa] {ON} Anc_8.70
           YFL005W
          Length = 211

 Score =  137 bits (344), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 110/173 (63%), Gaps = 8/173 (4%)

Query: 2   SSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQ 61
           S +  +I+KV+++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V I+  K+  +Q
Sbjct: 8   SKQYDSIMKVLLIGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKIK-LQ 66

Query: 62  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPF 121
           +WDTAGQERF+++  A+YRGA   +LVYDVT+ ++FEN+K+W      HA     +    
Sbjct: 67  LWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFENVKNWFKTVSDHA----TDDAQL 122

Query: 122 VILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           +++GNK D+D   ++V+    + L K LG  P    SAKD  N++  F  +A+
Sbjct: 123 LLVGNKCDMD--TRLVTHEQGEALGKELG-IPFVEASAKDDTNVNEVFFTLAK 172

>CAGL0F02123g Chr6 (212117..212764) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005w SEC4
          Length = 215

 Score =  137 bits (344), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 108/167 (64%), Gaps = 8/167 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V I+  KV  +Q+WDTAG
Sbjct: 20  IMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTAG 78

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFANIKQWFKTVNEHAN----DEAQLLLVGNK 134

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            D+D   +VV+    + LAK LG  P   +SAK+  N++  F  +AR
Sbjct: 135 SDMDT--RVVTYEQGEALAKELG-LPFIESSAKNDDNVNEIFFTLAR 178

>YFL005W Chr6 (130334..130981) [648 bp, 215 aa] {ON}  SEC4Rab family
           GTPase essential for vesicle-mediated exocytic secretion
           and autophagy; associates with the exocyst component
           Sec15p and may regulate polarized delivery of transport
           vesicles to the exocyst at the plasma membrane
          Length = 215

 Score =  136 bits (342), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 111/168 (66%), Gaps = 8/168 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTA 66
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V I+  KV  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 77

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN----DEAQLLLVGN 133

Query: 127 KVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           K D++   +VV+A+  + LAK LG  P   +SAK+  N++  F  +A+
Sbjct: 134 KSDME--TRVVTADQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAK 178

>NDAI0G03340 Chr7 (792718..793341) [624 bp, 207 aa] {ON} Anc_8.70
          Length = 207

 Score =  135 bits (339), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 109/168 (64%), Gaps = 8/168 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTA 66
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V I+  KV  +Q+WDTA
Sbjct: 12  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 70

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GN
Sbjct: 71  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWFKTVNEHAN----DEAQLLLVGN 126

Query: 127 KVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           K D+D   +VV+    + LAK LG  P   +SAK+  N++  F  +A+
Sbjct: 127 KSDMD--TRVVTYEQGESLAKELG-LPFVESSAKNDDNVNEIFFTLAK 171

>NCAS0C04020 Chr3 (817944..818576) [633 bp, 210 aa] {ON} Anc_1.215
           YKR055W
          Length = 210

 Score =  134 bits (338), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 108/167 (64%), Gaps = 8/167 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V I+  KV  +Q+WDTAG
Sbjct: 16  IMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTAG 74

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++GNK
Sbjct: 75  QERFRTITTAYYRGAMGIILVYDVTDERTFSNVKQWFKTVNEHAN----DEAQLLLVGNK 130

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            D+D   +VV+    + LAK LG  P   +SAK+  N++  F  +A+
Sbjct: 131 SDMDT--RVVTYEQGESLAKELG-LPFIESSAKNDDNVNEIFFTLAK 174

>KNAG0E03100 Chr5 complement(618438..619076) [639 bp, 212 aa] {ON}
           Anc_8.25 YFL038C
          Length = 212

 Score =  134 bits (338), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 111/174 (63%), Gaps = 7/174 (4%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYDVT+  SF+ +K W  E   +A      T  
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQDSFDGVKMWLQEIDRYA----TSTVL 115

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            +++GNK D+++ K+VV  + A+E A +  N P   TSA DS N++ AF  +AR
Sbjct: 116 KLLVGNKCDLND-KRVVEYDVAKEFADA-NNMPFLETSALDSTNVEEAFLTMAR 167

>KAFR0C03580 Chr3 (733658..734296) [639 bp, 212 aa] {ON} Anc_8.25
           YFL038C
          Length = 212

 Score =  134 bits (337), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 112/174 (64%), Gaps = 7/174 (4%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K + +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTIELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A  +  +   
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSAVLK--- 116

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            +++GNK D+D  K++V  + A+E A+S  N P   TSA DS N++ AF  +AR
Sbjct: 117 -LLVGNKCDLD-GKRMVEYDVAKEFAES-NNMPFLETSALDSTNVEEAFLTMAR 167

>KLLA0D05313g Chr4 (459496..460110) [615 bp, 204 aa] {ON} highly
           similar to uniprot|P01123 Saccharomyces cerevisiae
           YFL038C YPT1 Ras-like small GTPase involved in the
           ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 204

 Score =  134 bits (336), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 114/185 (61%), Gaps = 11/185 (5%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M++    + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNTEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRGA   ++VYDVT+ +SF N+K+W  E          +   
Sbjct: 60  QIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRFGTAGVLK--- 116

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAF----EEIARSA 176
            +++GNK D+ + KKVV    A+E A S+G  P   TSA DS N++ AF    ++I  S 
Sbjct: 117 -LLVGNKNDLTD-KKVVDTEVAKEFADSIG-IPFIETSALDSSNVEEAFLIMTKQIKESV 173

Query: 177 LQQNQ 181
            +Q +
Sbjct: 174 AKQQK 178

>TBLA0D02650 Chr4 (655924..656577) [654 bp, 217 aa] {ON} Anc_8.70
           YFL005W
          Length = 217

 Score =  134 bits (336), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 68/162 (41%), Positives = 106/162 (65%), Gaps = 8/162 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K + I+  K+  +Q+WDTAG
Sbjct: 20  IMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTIDINGKKIK-LQLWDTAG 78

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QERF+++  A+YRGA   +LVYDVT+  +FENI++W      HAN  +      +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDENTFENIRTWFKTVNEHANGEA----QLLLVGNK 134

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAF 169
            D++   + V+    + LAK LG  P   +SAKD  N++  F
Sbjct: 135 SDME--TRTVTYEQGESLAKELG-IPFIESSAKDDKNVNEIF 173

>Skud_6.66 Chr6 (132521..133168) [648 bp, 215 aa] {ON} YFL005W
           (REAL)
          Length = 215

 Score =  134 bits (336), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 109/168 (64%), Gaps = 8/168 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTA 66
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V I+  KV  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 77

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HA     +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHA----TDEAQLLLVGN 133

Query: 127 KVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           K D+D   +VV+ +  + LAK LG  P   +SAK+  N++  F  +A+
Sbjct: 134 KSDMDT--RVVTVDQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAK 178

>TBLA0C00450 Chr3 complement(84352..84984) [633 bp, 210 aa] {ON}
           Anc_8.25 YFL038C
          Length = 210

 Score =  134 bits (336), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 116/184 (63%), Gaps = 10/184 (5%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D YS  Y +TIG DF  K + ID  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYSNDYISTIGVDFKIKTIEIDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYDVT+  SF ++K W  E   +A  S  +   
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQDSFNSVKMWLQEIDRYATSSVLK--- 116

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA---RSAL 177
            +++GNK D+ + K++V  + A+E A++  N P   TSA DS N++ AF  +A   + +L
Sbjct: 117 -LLVGNKSDLKD-KRIVEYDVAKEFAET-NNMPFLETSALDSTNVEEAFLTMAKQIKESL 173

Query: 178 QQNQ 181
            Q Q
Sbjct: 174 SQQQ 177

>Kwal_14.1116 s14 complement(202534..203148) [615 bp, 204 aa] {ON}
           YFL038C (YPT1) - Ras-like GTP-binding protein; most
           similar to mammalian Rab1A protein [contig 244] FULL
          Length = 204

 Score =  133 bits (334), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 115/185 (62%), Gaps = 11/185 (5%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRGA   ++VYDVT+  SF ++K W  E   +A     +   
Sbjct: 60  QIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEIDRYATAGVLK--- 116

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAF----EEIARSA 176
            +++GNK D+ + K++V  + A+E A SL   P   TSA DS N++ AF    ++I  S 
Sbjct: 117 -LMVGNKSDL-QDKRMVEYDVAKEFADSL-QIPFLETSALDSSNVEEAFLTMAKQIKESM 173

Query: 177 LQQNQ 181
            QQ++
Sbjct: 174 AQQHR 178

>KLTH0G18788g Chr7 (1624218..1624832) [615 bp, 204 aa] {ON} highly
           similar to uniprot|P01123 Saccharomyces cerevisiae
           YFL038C YPT1 Ras-like small GTPase involved in the
           ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 204

 Score =  133 bits (334), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 115/185 (62%), Gaps = 11/185 (5%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRGA   ++VYDVT+  SF ++K W  E   +A     +   
Sbjct: 60  QIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEIDRYATAGVLK--- 116

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAF----EEIARSA 176
            +++GNK D+ + K++V  + A+E A SL   P   TSA DS N++ AF    ++I  S 
Sbjct: 117 -LMVGNKSDL-QDKRMVEYDVAKEFADSL-QIPFLETSALDSSNVEEAFLTMAKQIKESM 173

Query: 177 LQQNQ 181
            QQ++
Sbjct: 174 AQQHK 178

>CAGL0K12672g Chr11 (1256370..1256990) [621 bp, 206 aa] {ON} highly
           similar to uniprot|P01123 Saccharomyces cerevisiae
           YFL038c YPT1
          Length = 206

 Score =  133 bits (334), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 73/184 (39%), Positives = 114/184 (61%), Gaps = 11/184 (5%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T  
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVL 115

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR----SA 176
            +++GNK D+ + K+VV  + A+E A++    P   TSA DS N++ AF  +AR    S 
Sbjct: 116 KLLVGNKCDLAD-KRVVEYDVAKEFAEA-NKMPFLETSALDSTNVEEAFLTMARQIKESM 173

Query: 177 LQQN 180
            QQN
Sbjct: 174 TQQN 177

>SAKL0B02332g Chr2 (227078..227719) [642 bp, 213 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005W SEC4 Secretory vesicle-associated Rab GTPase
           essential for exocytosis associates with the exocyst
           component Sec15p and may regulate polarized delivery of
           transport vesicles to the exocyst at the plasma membrane
          Length = 213

 Score =  133 bits (334), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 106/167 (63%), Gaps = 8/167 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V I+  K+  +Q+WDTAG
Sbjct: 20  IMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKIK-LQLWDTAG 78

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWLSTVNQHAN----DEAQLLLVGNK 134

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            D+D   + V+    + L+K LG  P    SAK+  N++  F  +A+
Sbjct: 135 SDMDT--RAVTYEQGEALSKELG-LPFVEASAKNDDNVNEIFFTLAK 178

>NCAS0J00630 Chr10 complement(95335..95991) [657 bp, 218 aa] {ON}
           Anc_8.70
          Length = 218

 Score =  132 bits (333), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 66/167 (39%), Positives = 108/167 (64%), Gaps = 8/167 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           ++K++++GDSGVGK+ L+ R+V +K++  +  TIG DF  K + I   K+  +Q+WDTAG
Sbjct: 26  VMKILLIGDSGVGKSCLLVRFVENKFNPSFITTIGIDFKIKTLDIQGRKIK-LQLWDTAG 84

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QERF+++  A+YRGA   +LVYDVT+ ++F+NI+ W      HAN    E    +++GNK
Sbjct: 85  QERFRTITTAYYRGAMGIILVYDVTDERTFQNIRQWYSTVNEHAN----EQVQLLLVGNK 140

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            D+    + V+    +ELA+ LG  P    SAK+  N+++ F ++A+
Sbjct: 141 SDLGN--RQVTKEQGEELARELG-LPFMEASAKNDDNVNDLFLQLAK 184

>TDEL0C00980 Chr3 (164219..164866) [648 bp, 215 aa] {ON} Anc_8.70
           YFL005W
          Length = 215

 Score =  132 bits (333), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 107/167 (64%), Gaps = 8/167 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V I+  K   +Q+WDTAG
Sbjct: 20  IMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVDINGKKTK-LQLWDTAG 78

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QERF+++  A+YRGA   +LVYDVT+ ++F NI+ W      HAN    +    +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFTNIRQWFKTVNEHAN----DDAQLLLVGNK 134

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            D+D   + V+    + LAK LG  P   +SAK+  N++  F  +AR
Sbjct: 135 SDMDT--RTVTYEQGETLAKELG-IPFVESSAKNDDNVNEIFFTLAR 178

>Skud_6.32 Chr6 complement(58531..59151) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score =  132 bits (332), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 73/184 (39%), Positives = 114/184 (61%), Gaps = 11/184 (5%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T  
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVL 115

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR----SA 176
            +++GNK D+ + K+VV  + A+E A +    P   TSA DS N+++AF  +AR    S 
Sbjct: 116 KLLVGNKCDLKD-KRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESM 173

Query: 177 LQQN 180
            QQN
Sbjct: 174 SQQN 177

>Smik_6.40 Chr6 complement(70749..71369) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score =  132 bits (332), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 73/184 (39%), Positives = 114/184 (61%), Gaps = 11/184 (5%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T  
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVL 115

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR----SA 176
            +++GNK D+ + K+VV  + A+E A +    P   TSA DS N+++AF  +AR    S 
Sbjct: 116 KLLVGNKCDLKD-KRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESM 173

Query: 177 LQQN 180
            QQN
Sbjct: 174 SQQN 177

>YFL038C Chr6 complement(55366..55986) [621 bp, 206 aa] {ON}
           YPT1Rab family GTPase, involved in the ER-to-Golgi step
           of the secretory pathway; complex formation with the Rab
           escort protein Mrs6p is required for prenylation of
           Ypt1p by protein geranylgeranyltransferase type II
           (Bet2p-Bet4p)
          Length = 206

 Score =  132 bits (332), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 73/184 (39%), Positives = 114/184 (61%), Gaps = 11/184 (5%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T  
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVL 115

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR----SA 176
            +++GNK D+ + K+VV  + A+E A +    P   TSA DS N+++AF  +AR    S 
Sbjct: 116 KLLVGNKCDLKD-KRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESM 173

Query: 177 LQQN 180
            QQN
Sbjct: 174 SQQN 177

>Suva_6.19 Chr6 complement(28872..29492) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score =  132 bits (332), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 73/184 (39%), Positives = 114/184 (61%), Gaps = 11/184 (5%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T  
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVL 115

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR----SA 176
            +++GNK D+ + K+VV  + A+E A +    P   TSA DS N+++AF  +AR    S 
Sbjct: 116 KLLVGNKCDLKD-KRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESM 173

Query: 177 LQQN 180
            QQN
Sbjct: 174 SQQN 177

>Kpol_1023.21 s1023 complement(39597..40220) [624 bp, 207 aa] {ON}
           complement(39597..40220) [624 nt, 208 aa]
          Length = 207

 Score =  132 bits (332), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 115/185 (62%), Gaps = 11/185 (5%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVQLDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYD+T+ +SF  +K W  E   +A      T  
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDITDQESFNGVKMWLQEIDRYA----TSTVL 115

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR----SA 176
            +++GNK D+++ K+VV  + A+E A++    P   TSA DS N++ AF  +AR    S 
Sbjct: 116 KLLVGNKCDLND-KRVVEYDVAKEFAEA-NKMPFLETSALDSTNVEEAFLTMARQIKESI 173

Query: 177 LQQNQ 181
            QQ Q
Sbjct: 174 SQQQQ 178

>KNAG0G00930 Chr7 (183672..184313) [642 bp, 213 aa] {ON} Anc_8.70
           YFL005W
          Length = 213

 Score =  132 bits (332), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 104/162 (64%), Gaps = 8/162 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           I+K++++GDSGVGK+ L+ R+V D+++  +  TIG DF  K V I+  KV  +Q+WDTAG
Sbjct: 18  IMKILLVGDSGVGKSCLLVRFVEDRFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTAG 76

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QERF+++  A+YRGA   +LVYDVT+ ++F NI+ W      HAN    +    +++GNK
Sbjct: 77  QERFRTITTAYYRGAMGIILVYDVTDERTFNNIRQWFTTVTEHAN----DDAQLLLVGNK 132

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAF 169
            D+D   +VVS    + LA  LG  P   +SAKD  N++  F
Sbjct: 133 SDMD--TRVVSREQGETLAAELG-LPFVESSAKDDDNVNEIF 171

>ZYRO0F03872g Chr6 (329213..329866) [654 bp, 217 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005W SEC4 Secretory vesicle-associated Rab GTPase
           essential for exocytosis associates with the exocyst
           component Sec15p and may regulate polarized delivery of
           transport vesicles to the exocyst at the plasma membrane
          Length = 217

 Score =  132 bits (332), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 108/167 (64%), Gaps = 8/167 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V I+  K+  +Q+WDTAG
Sbjct: 20  IMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVDINGKKIK-LQLWDTAG 78

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QERF+++  A+YRGA   +LVYDVT+ ++F NI+ W      HAN    +    +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFSNIRQWFKTVNEHAN----DDAQLLLVGNK 134

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            D+D   + V+    + LAK LG  P   +SAK+  N++  F  +A+
Sbjct: 135 SDMDT--RTVTYEQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAK 178

>NDAI0G03050 Chr7 complement(711396..712028) [633 bp, 210 aa] {ON}
           Anc_8.25
          Length = 210

 Score =  132 bits (331), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 109/174 (62%), Gaps = 7/174 (4%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYDVT+  SF+ +K W  E   +A      T  
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQDSFDGVKMWLQEIDRYA----TSTVL 115

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            +++GNK D+ E K+VV  + A+E A S    P   TSA +S N++ AF  +AR
Sbjct: 116 KLLVGNKCDL-EDKRVVEYDVAKEFADS-NKMPFLETSALNSTNVEEAFLTMAR 167

>TDEL0C00490 Chr3 complement(75792..76418) [627 bp, 208 aa] {ON}
           Anc_8.25 YFL038C
          Length = 208

 Score =  131 bits (330), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 110/174 (63%), Gaps = 7/174 (4%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T  
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVL 115

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            +++GNK D+ E K+VV  + A+E A++    P   TSA DS N++ AF  +A+
Sbjct: 116 KLLVGNKCDL-EDKRVVEYDVAREFAEA-NKMPFLETSALDSTNVEQAFLTMAK 167

>TPHA0D00270 Chr4 complement(37369..37992) [624 bp, 207 aa] {ON}
           Anc_8.25 YFL038C
          Length = 207

 Score =  131 bits (329), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 110/174 (63%), Gaps = 7/174 (4%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYDVT+ +SF ++K W  E   +A      T  
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNSVKMWLQEIDRYA----TSTVL 115

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            +++GNK D+ + K+VV  + A+E A+     P   TSA DS N++ AF  +AR
Sbjct: 116 KLLVGNKSDMTD-KRVVEYDVAKEFAEQ-NKMPFLETSALDSTNVEEAFLTMAR 167

>TPHA0P00360 Chr16 (76379..77023) [645 bp, 214 aa] {ON} Anc_8.70
           YFL005W
          Length = 214

 Score =  131 bits (329), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 108/168 (64%), Gaps = 8/168 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTA 66
           +I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V I+  K+  +Q+WDTA
Sbjct: 18  SIMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVEINGRKIK-LQLWDTA 76

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQERF+++  A+YRGA   +LVYDVT+ K+F NI+ W      HAN    +    +++GN
Sbjct: 77  GQERFRTITTAYYRGAMGIILVYDVTDEKTFANIRQWFKTVTEHAN----DDAQLLLVGN 132

Query: 127 KVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           K D++   + V+     EL++ LG  P    SAK+  N++  F  +A+
Sbjct: 133 KSDME--TRTVTHEQGDELSRELG-IPFVEASAKNDDNVNEIFFTLAK 177

>ZYRO0F02816g Chr6 complement(237904..238533) [630 bp, 209 aa] {ON}
           highly similar to uniprot|P01123 Saccharomyces
           cerevisiae YFL038C YPT1 Ras-like small GTPase involved
           in the ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 209

 Score =  130 bits (327), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 109/174 (62%), Gaps = 7/174 (4%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVDLDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T  
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVL 115

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            +++GNK D+ + K+VV  + A+E A +    P   TSA DS N++ AF  +AR
Sbjct: 116 KLLVGNKCDLKD-KRVVEYDVAKEFADA-NKMPFIETSALDSTNVEEAFLTMAR 167

>CAGL0K06017g Chr11 complement(586922..587581) [660 bp, 219 aa] {ON}
           highly similar to uniprot|Q99260 Saccharomyces
           cerevisiae YLR262c GTP-binding protein
          Length = 219

 Score =  129 bits (325), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 71/178 (39%), Positives = 109/178 (61%), Gaps = 8/178 (4%)

Query: 1   MSSRKKNIL---KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKV 57
           MS R+  +L   K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K 
Sbjct: 1   MSGRQDKLLTKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYLDD-KT 59

Query: 58  ATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPE 117
             +Q+WDTAGQERF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E
Sbjct: 60  IRLQLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDV---KNERGAE 116

Query: 118 TFPFVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
                ++GNK D+ + ++ V+A   ++ A+ LG      TS K   N+ N F++IA+S
Sbjct: 117 NVILCVVGNKSDLADERQ-VTAEEGEKKAQDLGAKIFMQTSTKVGYNVKNLFKKIAKS 173

>KAFR0A05260 Chr1 complement(1040753..1041460) [708 bp, 235 aa] {ON}
           Anc_6.49 YLR262C
          Length = 235

 Score =  130 bits (326), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 100/166 (60%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 24  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 82

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYD+T  KSFE I  W D+     N    E     I+GNK D
Sbjct: 83  RFRSLIPSYIRDSKVAIVVYDITKKKSFEFIDKWVDDV---KNERGEENVVLCIVGNKND 139

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++ VS    +  AK LG      TS K   N+ N F+ IA+S
Sbjct: 140 LGDERQ-VSTEEGEAKAKKLGAKIFMETSTKAGYNVKNLFKRIAKS 184

>Suva_10.359 Chr10 complement(629445..630092) [648 bp, 215 aa] {ON}
           YLR262C (REAL)
          Length = 215

 Score =  129 bits (324), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 68/166 (40%), Positives = 102/166 (61%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E     I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGEENVILCIVGNKSD 127

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++ +S    ++ AK LG      TS K   N+ N F++IA+S
Sbjct: 128 LSDERQ-ISTEEGEKKAKLLGAKIFMETSTKAGYNVKNLFKKIAKS 172

>TPHA0F02500 Chr6 complement(551815..552462) [648 bp, 215 aa] {ON}
           Anc_6.49 YLR262C
          Length = 215

 Score =  128 bits (322), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 68/166 (40%), Positives = 101/166 (60%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++          E     I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDVKTE---RGSENVILCIVGNKSD 127

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++V +     + AK LG T    TS K   N+ N F++IA+S
Sbjct: 128 LSDERQVTTEEGEAK-AKELGATIFMETSTKAGHNVKNLFKKIAKS 172

>NCAS0C03710 Chr3 complement(747168..747803) [636 bp, 211 aa] {ON}
           Anc_8.25
          Length = 211

 Score =  128 bits (321), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 108/174 (62%), Gaps = 7/174 (4%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S    + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D  K   +
Sbjct: 1   MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+++  ++YRG+   ++VYDVT+  SF  +K W  E   +A      T  
Sbjct: 60  QIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQDSFNGVKMWLQEIDRYA----TSTVL 115

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            +++GNK D+ + K+VV  + A+E A +    P   TSA +S N++ AF  +AR
Sbjct: 116 KLLVGNKCDLTD-KRVVEYDVAKEFADA-NKMPFLETSALNSTNVEEAFLTMAR 167

>ZYRO0C07062g Chr3 (532175..532819) [645 bp, 214 aa] {ON} highly
           similar to uniprot|Q99260 Saccharomyces cerevisiae
           YLR262C YPT6 Ras-like GTP binding protein involved in
           the secretory pathway, required for fusion of
           endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 214

 Score =  128 bits (321), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 69/166 (41%), Positives = 100/166 (60%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 72

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E     I+GNK D
Sbjct: 73  RFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDV---KNERGEENVILCIVGNKSD 129

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++ VS    +  AK LG      TS K   N+ N F+ IA+S
Sbjct: 130 LSDERQ-VSTEEGETKAKVLGAKIFMETSTKAGYNVKNLFKRIAKS 174

>TBLA0E03190 Chr5 complement(803935..804558) [624 bp, 207 aa] {ON}
           Anc_6.49 YLR262C
          Length = 207

 Score =  127 bits (319), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 105/175 (60%), Gaps = 5/175 (2%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           MS++     K++ LG+ GVGKTSL+ R++ D + + Y+ATIG DFL+K + +DD K   +
Sbjct: 1   MSNKTLTKYKIVFLGEQGVGKTSLITRFMYDTFDEHYQATIGIDFLSKTMYLDD-KTIRL 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           Q+WDTAGQERF+SL  ++ R +   ++VYD+T  KSFE I  W  +     N    +   
Sbjct: 60  QLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIQDV---KNERGDDGVI 116

Query: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
             I+GNK D+ + ++ VS    +  AK LG      TS K   N+ N F++IA+S
Sbjct: 117 LCIVGNKSDLSDQRQ-VSNEEGENKAKLLGADIFMETSTKAGYNVKNLFKKIAKS 170

>KNAG0E02720 Chr5 (541478..542173) [696 bp, 231 aa] {ON} 
          Length = 231

 Score =  127 bits (319), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 68/166 (40%), Positives = 102/166 (61%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD  +   Q+WDTAGQE
Sbjct: 18  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDHTIR-FQLWDTAGQE 76

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N  S +   F I+GNK D
Sbjct: 77  RFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWVEDV---KNERSADNVIFCIVGNKSD 133

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++ VS    ++  K LG      TS K   N+ N F++IA+S
Sbjct: 134 LTDERQ-VSTEEGEQKTKVLGAQIFMETSTKAGYNVKNLFKKIAKS 178

>Skud_12.341 Chr12 complement(609187..609837) [651 bp, 216 aa] {ON}
           YLR262C (REAL)
          Length = 216

 Score =  126 bits (317), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 100/166 (60%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E     I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGEENVILCIVGNKSD 127

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++ +S    ++ AK LG      TS K   N+   F+ IA+S
Sbjct: 128 LSDERQ-ISTEEGEKKAKLLGAKIFMETSTKAGYNVKTLFKRIAKS 172

>Smik_12.336 Chr12 complement(606255..606905) [651 bp, 216 aa] {ON}
           YLR262C (REAL)
          Length = 216

 Score =  126 bits (317), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 101/166 (60%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E     I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGEENVILCIVGNKSD 127

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++ +S    ++ AK LG      TS K   N+   F++IA+S
Sbjct: 128 LSDERQ-ISTEEGEKKAKLLGAKIFMETSTKAGYNVKTLFKKIAKS 172

>TDEL0G04210 Chr7 (764766..765434) [669 bp, 222 aa] {ON} Anc_6.49
           YLR262C
          Length = 222

 Score =  126 bits (317), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 69/166 (41%), Positives = 101/166 (60%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 72

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E     I+GNK D
Sbjct: 73  RFRSLIPSYIRDSRVAIVVYDITKKKSFEFIDKWIEDV---KNERGEENVILCIVGNKSD 129

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++ VS    +  AK LG      TS K   N+ N F++IA+S
Sbjct: 130 LADERQ-VSTEEGEAKAKLLGAKIFMETSTKAGHNVKNLFKKIAKS 174

>SAKL0E02090g Chr5 complement(160194..160838) [645 bp, 214 aa] {ON}
           highly similar to uniprot|Q99260 Saccharomyces
           cerevisiae YLR262C YPT6 Ras-like GTP binding protein
           involved in the secretory pathway, required for fusion
           of endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 214

 Score =  126 bits (316), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 109/175 (62%), Gaps = 8/175 (4%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 72

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYDVTN KSFE I  W ++     +    E     I+GNK D
Sbjct: 73  RFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWIEDV---KSERGEENVILCIVGNKND 129

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ-QNQS 182
           + + ++ VS    +  A+ L N  +FM TS K   N+ N F++IA+S  + QN S
Sbjct: 130 LVDERQ-VSTEEGERKAQVL-NAKIFMETSTKAGFNVKNLFKKIAKSLPEFQNSS 182

>YLR262C Chr12 complement(668244..668891) [648 bp, 215 aa] {ON}
           YPT6Rab family GTPase, Ras-like GTP binding protein
           involved in the secretory pathway, required for fusion
           of endosome-derived vesicles with the late Golgi,
           maturation of the vacuolar carboxypeptidase Y; has
           similarity to the human GTPase, Rab6
          Length = 215

 Score =  125 bits (315), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 101/166 (60%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E     I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGDENVILCIVGNKSD 127

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++ +S    ++ AK LG      TS K   N+   F++IA+S
Sbjct: 128 LSDERQ-ISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKS 172

>KLLA0F20471g Chr6 (1901749..1902387) [639 bp, 212 aa] {ON} highly
           similar to uniprot|Q99260 Saccharomyces cerevisiae
           YLR262C YPT6 Ras-like GTP binding protein involved in
           the secretory pathway, required for fusion of
           endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 212

 Score =  125 bits (314), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 69/166 (41%), Positives = 103/166 (62%), Gaps = 7/166 (4%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 13  KIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 71

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYDVTN KSFE I  W ++  +       E    VI+GNK D
Sbjct: 72  RFRSLIPSYIRDSHVAIVVYDVTNRKSFEYIDKWIEDVKME---RGEENVILVIVGNKSD 128

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIAR 174
           + E ++V +     E   ++ N  LF+ TS K   N+   F++IA+
Sbjct: 129 LVEERQVSTEEG--ERKSTVLNAKLFIETSTKAGFNVKTLFKKIAK 172

>Kpol_1042.2 s1042 complement(4659..5303) [645 bp, 214 aa] {ON}
           complement(4659..5303) [645 nt, 215 aa]
          Length = 214

 Score =  125 bits (314), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 66/166 (39%), Positives = 102/166 (61%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYD+T  KSF+ I  W ++     N    +     ++GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIVVYDITKKKSFDCIDKWIEDV---KNERGEDNVILCVVGNKSD 127

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++ VS    ++ AK LG      TS K   N+ N F++IA+S
Sbjct: 128 LTDERQ-VSTEDGEKKAKELGAKIFMETSTKAGYNVKNLFKKIAKS 172

>Kwal_56.22555 s56 complement(178575..179213) [639 bp, 212 aa] {ON}
           YLR262C (YPT6) - highly homologous to the human GTPase,
           Rab6 [contig 185] FULL
          Length = 212

 Score =  125 bits (313), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 100/166 (60%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 72

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYDVTN KSFE I  W ++     +    E     I+GNK D
Sbjct: 73  RFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDV---KSERGEENVVLCIVGNKND 129

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++ VS    +  A+ L       TS K   N+ N F +IA++
Sbjct: 130 LSDERQ-VSTEEGERKAQVLNAKIFIETSTKAGFNVKNLFRKIAKT 174

>KLTH0C10384g Chr3 (861122..861826) [705 bp, 234 aa] {ON} highly
           similar to uniprot|Q99260 Saccharomyces cerevisiae
           YLR262C YPT6 Ras-like GTP binding protein involved in
           the secretory pathway, required for fusion of
           endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 234

 Score =  125 bits (314), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 100/166 (60%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 35  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 93

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYDVTN KSFE I  W ++     +    E     I+GNK D
Sbjct: 94  RFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDV---KSERGEENVVLCIVGNKND 150

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++ VS    +  A+ L       TS K   N+ N F +IA++
Sbjct: 151 LSDERQ-VSTEEGERKAQVLNAKIFIETSTKVGFNVKNLFRKIAKT 195

>NCAS0D02500 Chr4 (474037..474705) [669 bp, 222 aa] {ON} Anc_6.49
          Length = 222

 Score =  124 bits (312), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 101/166 (60%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    +     I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDV---KNERGDDNVILCIVGNKSD 127

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++ V+    +  AK LG      TS K   N+ N F++IA+S
Sbjct: 128 LSDERQ-VTIEEGENKAKILGADIFMETSTKAGYNVKNLFKKIAKS 172

>AGR257C Chr7 complement(1225880..1226542) [663 bp, 220 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR262C
           (YPT6)
          Length = 220

 Score =  123 bits (309), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 98/165 (59%), Gaps = 5/165 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K V +DD +   +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYLDD-RTIRLQLWDTAGQE 72

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYD+TN KSFE I  W ++     N    E     I+GNK D
Sbjct: 73  RFRSLIPSYIRDSHVAIVVYDITNKKSFEYIDKWVEDV---RNERGEENLILCIVGNKSD 129

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           + + +K V+    +  AK L       TS K   N+   F+ IA+
Sbjct: 130 LVDERK-VTVEEGENKAKLLNAKIFVETSTKAGFNVGALFKRIAK 173

>Ecym_3137 Chr3 (254058..254723) [666 bp, 221 aa] {ON} similar to
           Ashbya gossypii AGR257C
          Length = 221

 Score =  123 bits (308), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 99/166 (59%), Gaps = 7/166 (4%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K V +DD  +  +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYLDDRNIR-LQLWDTAGQE 72

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYDVTN +SFE I  W ++          E     I+GNK D
Sbjct: 73  RFRSLIPSYIRDSHVAIVVYDVTNKRSFEYIDKWVEDVKTE---RGEENLILCIVGNKND 129

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIAR 174
           + + + V +     E+   L N  +FM TS K   N+   F+ IA+
Sbjct: 130 LVDERSVSTKEG--EMKAQLLNAKIFMETSTKAGFNVKQLFKSIAK 173

>KAFR0A03560 Chr1 (729254..729877) [624 bp, 207 aa] {ON} Anc_1.289
           YKR014C
          Length = 207

 Score =  120 bits (302), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 65/173 (37%), Positives = 105/173 (60%), Gaps = 12/173 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDK---VATMQVWDT 65
            K+++LGDS VGK+S+++R+V D +    ++TIGA FL++ + ++D+    +   ++WDT
Sbjct: 4   FKLVLLGDSSVGKSSIVNRFVKDSFEDLRESTIGAAFLSQTIKLNDNGKEVIVKFEIWDT 63

Query: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILG 125
           AGQER++SL   +YR A+  ++VYD+T   S    K+W +E     N    +     ++G
Sbjct: 64  AGQERYKSLAPMYYRNANAALVVYDITELDSLNKAKTWVEEL---KNKVGDDNIVIYLVG 120

Query: 126 NKVDI---DETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIAR 174
           NK+D+   D +K++VS   A+E AK  G   LF+ TSAK   NI   F+EI  
Sbjct: 121 NKLDVCEKDSSKRLVSLEGAKEYAKEQG--LLFIETSAKTGANIKETFQEIGE 171

>NDAI0I02380 Chr9 complement(542975..543643) [669 bp, 222 aa] {ON} 
          Length = 222

 Score =  120 bits (301), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 99/166 (59%), Gaps = 5/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD K   +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           RF+SL  ++ R +   ++VYD+T  +SF+ I  W ++     N    +     I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIVVYDITKKESFDFIDKWINDV---KNERGEDNVILCIVGNKND 127

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           + + ++ VS    +  AK LG      TS K   N+   F+ IA+S
Sbjct: 128 LTDQRQ-VSIEEGENKAKQLGANIFMETSTKAGYNVKTLFKRIAKS 172

>Smik_5.154 Chr5 complement(218975..219646) [672 bp, 223 aa] {ON}
           YER031C (REAL)
          Length = 223

 Score =  119 bits (299), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 108/176 (61%), Gaps = 15/176 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + ID  ++   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANA---AQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQQ 179
            D+   + V +  A   AQE      N  LF  TSA +S N+D AFEE+  +  Q+
Sbjct: 128 SDLAHLRAVPTEEAKTFAQE------NQLLFTETSALNSENVDKAFEELINTIYQK 177

>Kpol_423.12 s423 (26761..27423) [663 bp, 220 aa] {ON}
           (26761..27423) [663 nt, 221 aa]
          Length = 220

 Score =  119 bits (297), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 106/172 (61%), Gaps = 9/172 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  D++  + K+TIG +F T+ + +D  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFHLESKSTIGVEFATRTIDVDGKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++   S+EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKQSSYENCNHWLAELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+    + V  + A++ A+   N  LF  TSA +S N+D AF E+  S  Q
Sbjct: 128 SDLSHL-RAVPTDEAKKFAQE--NQLLFTETSALNSENVDQAFRELITSIYQ 176

>AER434C Chr5 complement(1466442..1467052,1467106..1467154) [660 bp,
           219 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YGL210W (YPT32) and YER031C (YPT31); 1-intron
          Length = 219

 Score =  119 bits (297), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 107/172 (62%), Gaps = 9/172 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  D+++   K+TIG +F T+ + ++  KV   Q+WDTAG
Sbjct: 14  LFKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEVEGKKVKA-QIWDTAG 72

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    E     ++GNK
Sbjct: 73  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----ENVAVGLIGNK 128

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+    + V  + A+  A+  GN  LF  TSA ++ N+D AF E+  +  Q
Sbjct: 129 SDLAHL-RAVPTDEAKNFAQ--GNQMLFTETSALNAENVDLAFRELITAIYQ 177

>Suva_7.51 Chr7 (90232..90897) [666 bp, 221 aa] {ON} YGL210W (REAL)
          Length = 221

 Score =  118 bits (296), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 108/172 (62%), Gaps = 9/172 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + ++D K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVEDKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+    + V  + A+  A  + N  LF  TSA +S N+D AF E+  +  Q
Sbjct: 128 SDLAHL-RAVPTDEARNFA--MENQMLFTETSALNSDNVDKAFRELIVAIFQ 176

>YER031C Chr5 complement(214076..214747) [672 bp, 223 aa] {ON}
           YPT31Rab family GTPase, very similar to Ypt32p; involved
           in the exocytic pathway; mediates intra-Golgi traffic or
           the budding of post-Golgi vesicles from the trans-Golgi
          Length = 223

 Score =  118 bits (295), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 63/176 (35%), Positives = 108/176 (61%), Gaps = 15/176 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + ID  ++   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANA---AQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQQ 179
            D+   + V +  +   AQE      N  LF  TSA +S N+D AFEE+  +  Q+
Sbjct: 128 SDLAHLRAVPTEESKTFAQE------NQLLFTETSALNSENVDKAFEELINTIYQK 177

>Suva_5.128 Chr5 complement(190103..190774) [672 bp, 223 aa] {ON}
           YER031C (REAL)
          Length = 223

 Score =  118 bits (295), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 63/176 (35%), Positives = 108/176 (61%), Gaps = 15/176 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + ID  ++   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANA---AQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQQ 179
            D+   + V +  +   AQE      N  LF  TSA +S N+D AFEE+  +  Q+
Sbjct: 128 SDLAHLRAVPTEESKTFAQE------NQLLFTETSALNSENVDKAFEELINTIYQK 177

>Skud_5.140 Chr5 complement(211975..212646) [672 bp, 223 aa] {ON}
           YER031C (REAL)
          Length = 223

 Score =  118 bits (295), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 63/176 (35%), Positives = 108/176 (61%), Gaps = 15/176 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + ID  ++   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANA---AQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQQ 179
            D+   + V +  +   AQE      N  LF  TSA +S N+D AFEE+  +  Q+
Sbjct: 128 SDLAHLRAVPTEESKTFAQE------NQLLFTETSALNSENVDEAFEELINTIYQK 177

>TBLA0C04910 Chr3 complement(1193590..1194285) [696 bp, 231 aa] {ON}
           Anc_3.521 YER031C
          Length = 231

 Score =  118 bits (296), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 107/175 (61%), Gaps = 15/175 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++   S+EN + W  E   +A+ +        ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKPSSYENCQHWLTELRGNADAN----VAVGLIGNK 127

Query: 128 VDIDETKKVVS---ANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+D  + V +    N AQE      N  LF  TSA  S N+D AF E+  +  Q
Sbjct: 128 SDLDHMRAVPTDEAKNFAQE------NQLLFTETSALQSSNVDQAFRELITAIYQ 176

>KLTH0G01760g Chr7 (132121..132166,132307..132917) [657 bp, 218 aa]
           {ON} highly similar to uniprot|P51996 Saccharomyces
           cerevisiae YGL210W YPT32 probably involved in
           intra-Golgi transport or in the formation of transport
           vesicles at the most distal Golgi compartment; ras-like
           GTPase, highly homologous to YPT31
          Length = 218

 Score =  117 bits (294), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 107/175 (61%), Gaps = 15/175 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNMESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    E     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----ENVAVGLIGNK 127

Query: 128 VDIDETKKVVS---ANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+   + V +    N AQE      N  LF  TSA +S N+D AF E+  +  Q
Sbjct: 128 SDLAHLRAVPTDEAKNFAQE------NQLLFTETSALNSENVDQAFRELITAIYQ 176

>TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON}
           Anc_1.289 YKR014C
          Length = 220

 Score =  117 bits (294), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 99/168 (58%), Gaps = 7/168 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K+++LGDS VGK+S+++R+V D + +  ++TIGA FL++ +T+ +  V   ++WDTAGQ
Sbjct: 4   FKLVLLGDSSVGKSSIVNRFVKDSFDELRESTIGAAFLSQTITLKNKTVIKFEIWDTAGQ 63

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ER++SL   +YR A+  ++VYD+T   S    +SW DE          E     ++GNK+
Sbjct: 64  ERYKSLAPMYYRNANAALVVYDITENDSLMKAQSWVDELKSKV---GDENLVICLVGNKI 120

Query: 129 DI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA 173
           D+   DE+K+VV    A++ A    N   +  SAK   N+   F+ I 
Sbjct: 121 DLCDEDESKRVVLTKDAKDYADE-QNLMFYEVSAKSGENVKEVFQVIG 167

>Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON}
           (61782..62417) [636 nt, 212 aa]
          Length = 211

 Score =  117 bits (293), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 103/171 (60%), Gaps = 8/171 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTID-DDKVATMQVWDTAG 67
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +D DD V   ++WDTAG
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQSIKLDEDDTVIKFEIWDTAG 63

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++SL   +YR A+  ++VYD+T + S    +SW +E     N  + +     ++GNK
Sbjct: 64  QERYKSLAPMYYRNANAALVVYDITASDSLSKAQSWVEEL---KNKVADDKLVICLVGNK 120

Query: 128 VDI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           +D+   D  K+ V  + A++ A   G    F  SAK    +++ F+ I  S
Sbjct: 121 LDLCQEDSGKRSVEISDAKQYADEQG-LLFFEVSAKTGEKVNDVFKSIGES 170

>YGL210W Chr7 (93792..94460) [669 bp, 222 aa] {ON}  YPT32Rab family
           GTPase, very similar to Ypt31p; involved in the exocytic
           pathway; mediates intra-Golgi traffic or the budding of
           post-Golgi vesicles from the trans-Golgi
          Length = 222

 Score =  117 bits (293), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 108/172 (62%), Gaps = 9/172 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + +++ K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+    + V  + A+  A  + N  LF  TSA +S N+D AF E+  +  Q
Sbjct: 128 SDLAHL-RAVPTDEAKNFA--MENQMLFTETSALNSDNVDKAFRELIVAIFQ 176

>Skud_7.58 Chr7 (99129..99797) [669 bp, 222 aa] {ON} YGL210W (REAL)
          Length = 222

 Score =  117 bits (293), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 108/172 (62%), Gaps = 9/172 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + +++ K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+    + V  + A+  A  + N  LF  TSA +S N+D AF E+  +  Q
Sbjct: 128 SDLAHL-RAVPTDEAKNFA--MENQMLFTETSALNSDNVDRAFRELIVAIFQ 176

>Smik_7.53 Chr7 (88592..89260) [669 bp, 222 aa] {ON} YGL210W (REAL)
          Length = 222

 Score =  117 bits (293), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 108/172 (62%), Gaps = 9/172 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + +++ K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+    + V  + A+  A  + N  LF  TSA +S N+D AF E+  +  Q
Sbjct: 128 SDLAHL-RAVPTDEAKNFA--MENQMLFTETSALNSDNVDRAFRELIIAIFQ 176

>SAKL0F01914g Chr6 (162387..162432,162627..163246) [666 bp, 221 aa]
           {ON} highly similar to uniprot|P51996 Saccharomyces
           cerevisiae YGL210W YPT32 probably involved in
           intra-Golgi transport or in the formation of transport
           vesicles at the most distal Golgi compartment ras-like
           GTPase highly homologous to YPT31
          Length = 221

 Score =  117 bits (292), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 107/175 (61%), Gaps = 15/175 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNMESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    E     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSNSYENCNHWLTELRENAD----ENVAVGLIGNK 127

Query: 128 VDIDETKKVVS---ANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+   + V +    N AQE      N  LF  TSA +S N+D AF E+  +  Q
Sbjct: 128 SDLAHLRAVPTDEAKNFAQE------NQLLFTETSALNSENVDLAFRELITAIYQ 176

>TPHA0D03430 Chr4 complement(719751..720422) [672 bp, 223 aa] {ON}
           Anc_3.521 YER031C
          Length = 223

 Score =  117 bits (292), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 106/175 (60%), Gaps = 15/175 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  + ++ + K+TIG +F T+ + +++ K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNDFNLESKSTIGVEFATRTIEVENKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++   S+EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKQSSYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANA---AQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+   + V +  A   AQE      N  LF  TSA +S N+D AF E+  S  Q
Sbjct: 128 SDLSHLRAVPTEEAKNFAQE------NQLLFTETSALNSENVDQAFRELITSIYQ 176

>Ecym_1207 Chr1 (420728..420773,421159..421766) [654 bp, 217 aa]
           {ON} similar to Ashbya gossypii AER434C  1-intron
          Length = 217

 Score =  116 bits (291), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 64/175 (36%), Positives = 106/175 (60%), Gaps = 15/175 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  D+++   K+TIG +F T+ + ++  KV   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEVEGKKVKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    E     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLAELRENAD----ENVAVGLIGNK 127

Query: 128 VDIDETKKVVS---ANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+   + V +    N AQE      N  LF  TSA ++ N+D AF E+  +  Q
Sbjct: 128 SDLAHLRAVPTDEAKNYAQE------NQMLFTETSALNAENVDLAFRELITAIYQ 176

>CAGL0C02453g Chr3 (247493..248149) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P38555 Saccharomyces cerevisiae
           YER031c YPT31
          Length = 218

 Score =  116 bits (290), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 108/173 (62%), Gaps = 9/173 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + +D  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIDSKSTIGVEFATRTIDVDGKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCHHWLSELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQQ 179
            D+   + V +  A Q  ++   N  LF  TSA +S N+D AF+E+  +  Q+
Sbjct: 128 SDLAHLRAVPTEEAKQFASE---NQLLFTETSALNSDNVDLAFKELITAIHQK 177

>CAGL0G07689g Chr7 complement(729919..730566) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P36018 Saccharomyces
           cerevisiae YKR014c YPT52 GTP-binding protein
          Length = 215

 Score =  115 bits (289), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 98/172 (56%), Gaps = 12/172 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDD---DKVATMQVWDT 65
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ V I D   D V   ++WDT
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63

Query: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILG 125
           AGQER++SL   +YR A+  ++VYDVT   S    +SW  E     N    E     ++G
Sbjct: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL---QNKVGDEELVIYLVG 120

Query: 126 NKVDI---DETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIA 173
           NKVDI   DE+ + +      E A++     LF   SAK    + + F+EI 
Sbjct: 121 NKVDIVEADESARKIETEEGAEYAQA--QKLLFKEVSAKTGAGVKDIFQEIG 170

>ZYRO0E08492g Chr5 complement(676074..676684,676766..676811) [657
           bp, 218 aa] {ON} highly similar to uniprot|P51996
           Saccharomyces cerevisiae YGL210W YPT32 probably involved
           in intra-Golgi transport or in the formation of
           transport vesicles at the most distal Golgi compartment;
           ras-like GTPase, highly homologous to YPT31
          Length = 218

 Score =  115 bits (288), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 105/175 (60%), Gaps = 15/175 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  + ++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNDFNMESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++   S+EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKPSSYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVS---ANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+D  + V +    N AQE      N  LF  TSA  S N+D AF E+  +  Q
Sbjct: 128 SDLDHLRAVPTDEAKNFAQE------NQLLFTETSALKSENVDLAFRELITAIYQ 176

>TPHA0I02780 Chr9 complement(614605..615231) [627 bp, 208 aa] {ON}
           Anc_1.289 YKR014C
          Length = 208

 Score =  115 bits (287), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 102/169 (60%), Gaps = 8/169 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDD-KVATMQVWDTAG 67
            K+++LGDS VGK+S+++R+V D + +  ++TIGA FL++ +T++++ +V   ++WDTAG
Sbjct: 4   FKLVLLGDSSVGKSSIVYRFVKDSFDEFRESTIGAAFLSQTITLEENNQVIKFEIWDTAG 63

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++SL   +YR A+  ++VYDVT   S    KSW +E          E     ++GNK
Sbjct: 64  QERYKSLAPMYYRNANAALVVYDVTAPDSLMKAKSWIEELKKKV---GNEELVICLVGNK 120

Query: 128 VDI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA 173
           VDI   D+TK+ +    A++ A    N   +  SAK   N+   F++I 
Sbjct: 121 VDICEEDDTKRKIEFEEAKDWAND-ENLLFYEVSAKTGYNVKEVFQKIG 168

>KLLA0D02376g Chr4 (201512..202135) [624 bp, 207 aa] {ON} similar to
           uniprot|P36018 Saccharomyces cerevisiae YKR014C YPT52
           rab5-like GTPase involved in vacuolar protein sorting
           and endocytosis probable purine nucleotide- binding
           protein
          Length = 207

 Score =  115 bits (287), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 101/179 (56%), Gaps = 10/179 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTID---DDKVATMQVWDT 65
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +    D++V   ++WDT
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63

Query: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILG 125
           AGQER++SL   +YR A+  ++VYDVT   S    K W DE     N    +     ++G
Sbjct: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVN---DDKLIICLVG 120

Query: 126 NKVDI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           NK+D+    E+  +V    A+E A+   N      SAK   N+   F++I      QN+
Sbjct: 121 NKLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYLQNK 178

>Skud_15.253 Chr15 complement(446672..447301) [630 bp, 209 aa] {ON}
           YOR089C (REAL)
          Length = 209

 Score =  114 bits (286), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 102/163 (62%), Gaps = 8/163 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ VTI++  V   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTV-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KDIIIALVGNKI 122

Query: 129 DI--DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAF 169
           D+  D  ++ V+    ++LA+  G    F TSAK   N++N F
Sbjct: 123 DVLQDGGERKVAKEEGEKLAEEKG-LLFFETSAKTGENVNNVF 164

>KLLA0B00671g Chr2 complement(50393..51006,51417..51462) [660 bp,
           219 aa] {ON} highly similar to uniprot|P51996
           Saccharomyces cerevisiae YGL210W YPT32 probably involved
           in intra-Golgi transport or in the formation of
           transport vesicles at the most distal Golgi compartment;
           ras-like GTPase, highly homologous to YPT31
          Length = 219

 Score =  114 bits (286), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 105/172 (61%), Gaps = 9/172 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++   K TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTANEFNLDSKTTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YR A   ++VYD+T + S+EN   W  E   +A+    E     ++GNK
Sbjct: 72  QERYRAITTAYYRAAVGALIVYDITKSSSYENCNHWLAELKQNAD----ENVAVGLIGNK 127

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+D  K+ V  + A+  A+   N  LF  TSA ++ N+D AF  +  +  Q
Sbjct: 128 SDLDH-KRAVPTDEARNYAQE--NQLLFTETSALNADNVDEAFRALITAIYQ 176

>NCAS0E00600 Chr5 (102956..103615) [660 bp, 219 aa] {ON} Anc_3.521
          Length = 219

 Score =  114 bits (286), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 107/172 (62%), Gaps = 9/172 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLKELRDNAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+   + V +A A    ++   N  LF  TSA +S N+D AF E+  +  Q
Sbjct: 128 SDLAHLRAVPTAEAKNFASE---NELLFTETSALNSENVDQAFRELITAIYQ 176

>NDAI0I02910 Chr9 complement(688721..689380) [660 bp, 219 aa] {ON}
           Anc_3.521
          Length = 219

 Score =  114 bits (286), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 107/172 (62%), Gaps = 9/172 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSTYENCNHWLTELKENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+    + V  + A+  A  L N  LF  TSA +S N+D AF E+  +  Q
Sbjct: 128 SDLAHL-RAVPTDEAKNFA--LENQLLFTETSALNSENVDQAFRELITAIYQ 176

>KNAG0B00580 Chr2 (94797..95474) [678 bp, 225 aa] {ON} Anc_3.521
           YER031C
          Length = 225

 Score =  114 bits (285), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 61/175 (34%), Positives = 107/175 (61%), Gaps = 15/175 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSTYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVS---ANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+   + V +    N AQE      N  LF  TSA +S N+D AF E+  +  Q
Sbjct: 128 SDLAHLRAVPTDEAKNFAQE------NQLLFTETSALNSENVDQAFRELITAIYQ 176

>KNAG0C01840 Chr3 (363258..363896) [639 bp, 212 aa] {ON} Anc_1.338
           YBR264C
          Length = 212

 Score =  114 bits (284), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 96/176 (54%), Gaps = 7/176 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           KV++LG S VGK+S++ R V  K+ +   ATIGA F  KEV ++D K   + VWDTAGQE
Sbjct: 12  KVVLLGGSSVGKSSIVTRLVTGKFMKN-SATIGAAFSWKEVFLEDKKAVKLSVWDTAGQE 70

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           R+++L   +YR  D  ++VYDVTN+ S E  KSW +E   + N          ++GNK+D
Sbjct: 71  RYRALTPMYYRNTDVALIVYDVTNSTSIEGAKSWIEELHNYVNEDRRNKISIWLVGNKID 130

Query: 130 IDETKKVVSANAAQE--LAKSLGNTP----LFMTSAKDSINIDNAFEEIARSALQQ 179
           +  T +        E  L   + + P    L   SAK    I+  F EI+R   ++
Sbjct: 131 LLPTAQDSDTTYPHEDVLRGIMHDIPNPNELAYVSAKTGAGIEEMFNEISRQVPEE 186

>TPHA0P00950 Chr16 complement(193256..193897) [642 bp, 213 aa] {ON}
           Anc_2.196 YNL093W
          Length = 213

 Score =  113 bits (282), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 97/165 (58%), Gaps = 10/165 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V IDD  +   ++WDTAGQ
Sbjct: 8   VKLVLLGEAAVGKSSIVVRFVSNDFSENKEPTIGAAFLTQRVNIDDHTI-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S        + GNKV
Sbjct: 67  ERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWVKE--LHEQASG--DIVIALAGNKV 122

Query: 129 DI----DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAF 169
           D+     E ++ V+    Q+LA    N   F TSAK   N++  F
Sbjct: 123 DLIEENGENERKVATEEGQKLADE-ENLLFFETSAKTGYNVNEIF 166

>CAGL0K09394g Chr11 complement(930063..930728) [666 bp, 221 aa] {ON}
           highly similar to uniprot|P51996 Saccharomyces
           cerevisiae YGL210w YPT32 or uniprot|P38555 Saccharomyces
           cerevisiae YER031c YPT31
          Length = 221

 Score =  113 bits (282), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 104/167 (62%), Gaps = 11/167 (6%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++D K+   Q+WDTAG
Sbjct: 14  LFKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIKVEDKKIKA-QIWDTAG 72

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    +     ++GNK
Sbjct: 73  QERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLTELKENAD----DNVAIGLIGNK 128

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFM--TSAKDSINIDNAFEEI 172
            D++  + V +    +E         LF   TSA +S N+D AF E+
Sbjct: 129 SDLEHLRAVPT----EEARGFASENQLFFTETSALNSENVDLAFREL 171

>Kpol_1029.16 s1029 (30724..31359) [636 bp, 211 aa] {ON}
           (30724..31359) [636 nt, 212 aa]
          Length = 211

 Score =  112 bits (281), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/167 (38%), Positives = 97/167 (58%), Gaps = 8/167 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V IDD  V   ++WDTAGQ
Sbjct: 8   VKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNIDDHTV-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDV+  +SF   + W  E    A+          + GNKV
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVSKPQSFIKARHWVKELQERAS----SDIIIALAGNKV 122

Query: 129 DI--DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA 173
           DI  D  ++ V+    Q+LA   G    F TSAK   N++  F  I 
Sbjct: 123 DIVEDGGERKVATEEGQKLADEEG-LLFFETSAKTGQNVNEVFLAIG 168

>Suva_8.142 Chr8 complement(247554..248183) [630 bp, 209 aa] {ON}
           YOR089C (REAL)
          Length = 209

 Score =  112 bits (281), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 103/163 (63%), Gaps = 8/163 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ VTI++  V   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTV-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KDIIIALVGNKI 122

Query: 129 DI--DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAF 169
           D+  ++ ++ V+    ++LA+  G    F TSAK   N++N F
Sbjct: 123 DMLQEDGERKVAREEGEKLAEENG-LLFFETSAKTGENVNNVF 164

>KAFR0F04160 Chr6 complement(819022..819759) [738 bp, 245 aa] {ON}
           Anc_3.521 YER031C
          Length = 245

 Score =  113 bits (283), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 107/172 (62%), Gaps = 9/172 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAG 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEMEGKKIKA-QIWDTAG 71

Query: 68  QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK 127
           QER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    +     ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSTYENCNHWLSELRENAD----DNVAVGLIGNK 127

Query: 128 VDIDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
            D+    + V  + A+  A  L N  LF  TSA +S N+D AF E+  +  Q
Sbjct: 128 SDLAHL-RAVPTDEAKNFA--LENQLLFTETSALNSENVDQAFRELITAIYQ 176

>KLTH0H09768g Chr8 (840625..841314) [690 bp, 229 aa] {ON} similar to
           uniprot|P36018 Saccharomyces cerevisiae YKR014C YPT52
           rab5-like GTPase involved in vacuolar protein sorting
           and endocytosis probable purine nucleotide- binding
           protein
          Length = 229

 Score =  113 bits (282), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 98/176 (55%), Gaps = 9/176 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDD--DKVATMQVWDTA 66
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++   D     ++WDTA
Sbjct: 26  FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHPDVTIKFEIWDTA 85

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E     N    +     + GN
Sbjct: 86  GQERYKSLAPMYYRNANAALIVYDVTQPGSLVKAQSWVEEL---KNKVGDQDLVICLAGN 142

Query: 127 KVDI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQ 179
           KVDI   D T + V    AQ  A+  G    + TSAK    +   F+EI     Q+
Sbjct: 143 KVDICDEDATAREVQREDAQLYAQEQG-LLFYETSAKTGAGVSAIFQEIGERVYQK 197

>CAGL0J08635g Chr10 complement(856102..856728) [627 bp, 208 aa] {ON}
           highly similar to uniprot|P36017 Saccharomyces
           cerevisiae YOR089c VPS21 GTP-binding protein
          Length = 208

 Score =  111 bits (278), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 65/167 (38%), Positives = 98/167 (58%), Gaps = 8/167 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           LK+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ VTI++  V   ++WDTAGQ
Sbjct: 8   LKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVTINEHTV-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQAS----KDIIIALVGNKI 122

Query: 129 DIDE--TKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA 173
           D+ E  T++ VS     E      N   F TSAK   NI + F  I 
Sbjct: 123 DVLENGTERSVS-REEAEKLAEEENLLFFETSAKSGENITDVFLAIG 168

>TDEL0D05890 Chr4 complement(1067167..1067856) [690 bp, 229 aa] {ON}
           Anc_3.521 YER031C
          Length = 229

 Score =  112 bits (279), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 63/176 (35%), Positives = 105/176 (59%), Gaps = 15/176 (8%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTA 66
           N + V+++GDSGVGK++L+ R+  + ++ + K+TIG +F T+ + ++  K+   Q+WDTA
Sbjct: 24  NWVIVVLIGDSGVGKSNLLSRFTTNDFNMESKSTIGVEFATRTIEVEGKKIKA-QIWDTA 82

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQER++++  A+YRGA   ++VYD++   S+EN   W  E   +A+    +     ++GN
Sbjct: 83  GQERYRAITSAYYRGAVGALIVYDISKPSSYENCNHWLTELRENAD----DNVAVGLIGN 138

Query: 127 KVDIDETKKVVS---ANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQ 178
           K D+D  + V +    N AQE      N  LF  TSA  S N++ AF E+  +  Q
Sbjct: 139 KSDLDHLRAVPTDEARNFAQE------NQLLFTETSALKSENVELAFRELITAIYQ 188

>NCAS0B06720 Chr2 complement(1278798..1279436) [639 bp, 212 aa] {ON}
           Anc_2.196
          Length = 212

 Score =  111 bits (277), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 102/168 (60%), Gaps = 9/168 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V I+D+ V   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNINDNTV-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    AN    +     ++GNKV
Sbjct: 67  ERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWIKELHEQAN----KDMIIALVGNKV 122

Query: 129 DI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA 173
           D+   +E ++ V+    ++LA+  G    F TSAK  +N+   F  I 
Sbjct: 123 DVLENNEDERKVAREEGEKLAEEEG-LLFFETSAKTGLNVTETFVAIG 169

>Suva_14.247 Chr14 (448490..449146) [657 bp, 218 aa] {ON} YNL093W
           (REAL)
          Length = 218

 Score =  111 bits (277), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 100/168 (59%), Gaps = 9/168 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +KV++LG+S VGK+S++ R+V++ ++Q  + TIGA FLTK ++ +D+ +   ++WDTAGQ
Sbjct: 13  IKVVLLGESAVGKSSIVLRFVSNDFTQSREPTIGAAFLTKRISRNDEAIK-FEIWDTAGQ 71

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF  L   +YR A   ++V+D+TN +SF   ++W ++  +H  V +       ++GNK+
Sbjct: 72  ERFAPLAPMYYRNAQAALVVFDITNEQSFHKAQNWVEQ--LHERVGN--HIIIALVGNKI 127

Query: 129 DI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA 173
           D+       + V     ++L +   N   F TSAK   NI   F+ I 
Sbjct: 128 DLLSMQNVNRAVRIEVVEDLCQR-ENLLYFETSAKTGENIHEVFQAIG 174

>AAL176C Chr1 complement(31588..32205) [618 bp, 205 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKR014C
           (YPT52)
          Length = 205

 Score =  110 bits (276), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 104/178 (58%), Gaps = 9/178 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTI--DDDKVATMQVWDTA 66
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +   DD +   ++WDTA
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E  + + V   +   F++ GN
Sbjct: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNE--LKSKVGDEDLVIFLV-GN 120

Query: 127 KVDI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           K+D+   D   +V+ +  AQ  A++ G       SAK    I + F+ I     +Q +
Sbjct: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVFQGIGGKLYEQRR 177

>YOR089C Chr15 complement(490196..490828) [633 bp, 210 aa] {ON}
           VPS21Rab family GTPase required for endocytic transport
           and for sorting of vacuolar hydrolases; localized in
           endocytic intermediates; detected in mitochondria;
           geranylgeranylation required for membrane association;
           mammalian Rab5 homolog
          Length = 210

 Score =  110 bits (276), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 110/181 (60%), Gaps = 13/181 (7%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ VTI++  V   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTV-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KDIIIALVGNKI 122

Query: 129 DI--DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA-----RSALQQNQ 181
           D+  +  ++ V+    ++LA+  G    F TSAK   N+++ F  I      ++A +QN 
Sbjct: 123 DMLQEGGERKVAREEGEKLAEEKG-LLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNS 181

Query: 182 S 182
           +
Sbjct: 182 A 182

>Smik_14.234 Chr14 (430086..430748) [663 bp, 220 aa] {ON} YNL093W
           (REAL)
          Length = 220

 Score =  110 bits (276), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/171 (36%), Positives = 98/171 (57%), Gaps = 11/171 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG+S VGK+S++ R+V+D + +  + TIGA FLTK + I DDKV   ++WDTAGQ
Sbjct: 13  IKLVLLGESAVGKSSIVLRFVSDDFRESREPTIGAAFLTKRI-IRDDKVIKFEIWDTAGQ 71

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF  L   +YR A   ++V+DVT+  SF   + W  E  +H  V   +     ++GNK+
Sbjct: 72  ERFAPLAPMYYRNAQAALVVFDVTDDGSFHKAQDWIQE--LHEKVG--DNIVIALVGNKI 127

Query: 129 DI-----DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+     + + + V     Q L K   N   F  SAK   NI   F+++ +
Sbjct: 128 DLLNIQGENSNRAVKEAELQNLCKR-ENLLYFEASAKTGENIHEIFQKLGQ 177

>KNAG0I01080 Chr9 (207327..208088) [762 bp, 253 aa] {ON} Anc_2.196
           YNL093W
          Length = 253

 Score =  111 bits (278), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 102/168 (60%), Gaps = 9/168 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG+  VGK+S++ R+V++ +++  + TIGA FLT+ V I++  +   ++WDTAGQ
Sbjct: 8   IKLVLLGEVAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNINEHTI-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KDIIIALVGNKI 122

Query: 129 DI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA 173
           D+   D T++ V+    ++LA+   N   F TSAK   N++  F +I 
Sbjct: 123 DMLDEDPTERKVAREEGEKLAQE-ENLLFFETSAKTGANVNEVFLKIG 169

>KNAG0C01600 Chr3 (317298..317942) [645 bp, 214 aa] {ON} Anc_1.289
           YKR014C
          Length = 214

 Score =  110 bits (276), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 102/176 (57%), Gaps = 15/176 (8%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDK----VATMQVWD 64
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++ +     V   ++WD
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTIKVESEDQQEVVIKFEIWD 63

Query: 65  TAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVIL 124
           TAGQER++SL   +YR A+  ++VYDVT   S    K+W +E     N    E     ++
Sbjct: 64  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLNKAKAWVEEL---KNKVGDEDLVIFLV 120

Query: 125 GNKVDI-----DETKKVVSANAAQELAKSLGNTPLF-MTSAKDSINIDNAFEEIAR 174
           GNKVD+     +E K+ V+A  A++ A+  G   +F   SAK    +   F+ I +
Sbjct: 121 GNKVDLCEGSDNEDKRAVAATLAKQYAEDQG--LMFDEVSAKTGHGVKEVFQAIGQ 174

>KLTH0G08206g Chr7 (666127..666765) [639 bp, 212 aa] {ON} highly
           similar to uniprot|P36017 Saccharomyces cerevisiae
           YOR089C VPS21 Rab5-like GTPase involved in vacuolar
           protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 212

 Score =  110 bits (275), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 100/168 (59%), Gaps = 8/168 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D  +   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDHTI-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQAS----KDIIIALVGNKL 122

Query: 129 DIDET--KKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ ET  ++ V+   A+ LA   G    F TSAK   N++  F  I +
Sbjct: 123 DMVETGAERKVALEEAENLASQEG-LLFFETSAKTGSNVNEVFLAIGQ 169

>Smik_15.269 Chr15 complement(451402..452034) [633 bp, 210 aa] {ON}
           YOR089C (REAL)
          Length = 210

 Score =  110 bits (275), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 102/163 (62%), Gaps = 8/163 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ VTI++  V   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTV-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KDIIIALVGNKI 122

Query: 129 DI--DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAF 169
           D+  +  ++ V+    ++LA+  G    F TSAK   N+++ F
Sbjct: 123 DMLQEGGERKVAREEGEKLAEEKG-LLFFETSAKTGENVNDVF 164

>Ecym_5362 Chr5 (735204..735833) [630 bp, 209 aa] {ON} similar to
           Ashbya gossypii ACL084C
          Length = 209

 Score =  110 bits (274), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 101/167 (60%), Gaps = 16/167 (9%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V + +  +   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNMGNQTI-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYD+T  +SF   + W  E  +H   S  ++    ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKE--LHEQAS--KSIIIALVGNKL 122

Query: 129 DI---DETKKVVSANAAQELAKSLGNTP---LFMTSAKDSINIDNAF 169
           D+   DE +KV     A+E A+SL        F TSAK   N++  F
Sbjct: 123 DLLESDEERKV-----AREEAESLAQEEGLLFFETSAKTGDNVNEVF 164

>SAKL0D05940g Chr4 (485575..486198) [624 bp, 207 aa] {ON} highly
           similar to uniprot|Q75F92 Ashbya gossypii AAL176C
           AAL176Cp and similar to YKR014C uniprot|P36018
           Saccharomyces cerevisiae YKR014C YPT52 rab5-like GTPase
           involved in vacuolar protein sorting and endocytosis
           probable purine nucleotide-binding protein
          Length = 207

 Score =  109 bits (273), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 101/179 (56%), Gaps = 11/179 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDD--DKVATMQVWDTA 66
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + + D  D V   ++WDTA
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQER++SL   +YR A+  ++VYDVT   S    ++W DE     +    E     ++GN
Sbjct: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDEL---KSKVGDEDLVICLVGN 120

Query: 127 KVDIDE---TKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQQNQ 181
           K+D+ E    ++ V  + AQ  A   G   LF   SAK    + N F+EI      Q +
Sbjct: 121 KLDLCEEEGQERGVDKDDAQSYASDKG--LLFHEVSAKTGKGVSNIFQEIGEKLYLQKK 177

>YNL093W Chr14 (449868..450530) [663 bp, 220 aa] {ON}  YPT53Rab
           family GTPase, similar to Ypt51p and Ypt52p and to
           mammalian rab5; required for vacuolar protein sorting
           and endocytosis
          Length = 220

 Score =  110 bits (274), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/170 (38%), Positives = 99/170 (58%), Gaps = 11/170 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +KV++LG+S VGK+S++ R+V+D + +  + TIGA FLTK +T  D KV   ++WDTAGQ
Sbjct: 13  IKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRIT-RDGKVIKFEIWDTAGQ 71

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF  L   +YR A   ++V+DVTN  SF   ++W +E  +H  V         ++GNK+
Sbjct: 72  ERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEE--LHEKVG--HDIVIALVGNKM 127

Query: 129 DI----DETK-KVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA 173
           D+    DE + + + A A Q L +   N   F  SAK   NI   F+ + 
Sbjct: 128 DLLNNDDENENRAMKAPAVQNLCER-ENLLYFEASAKTGENIYQIFQTLG 176

>Kwal_14.2394 s14 (738645..739268) [624 bp, 207 aa] {ON} YKR014C
           (YPT52) - probable purine nucleotide-binding protein
           [contig 225] FULL
          Length = 207

 Score =  109 bits (272), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 102/177 (57%), Gaps = 11/177 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTID--DDKVATMQVWDTA 66
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++  +D     ++WDTA
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQER++SL   +YR A+  ++VYDVT A S    +SW +E     N    +     ++GN
Sbjct: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL---KNKVGDQDLVICLVGN 120

Query: 127 KVDI---DETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQQ 179
           K+D+   +E  + V    AQ  A+  G   LF   SAK    +   F+EI  +  Q+
Sbjct: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQG--LLFHEVSAKTGSGVAAIFQEIGENVYQK 175

>KAFR0J01850 Chr10 complement(356911..357540) [630 bp, 209 aa] {ON}
           Anc_2.196 YNL093W
          Length = 209

 Score =  108 bits (271), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 101/168 (60%), Gaps = 9/168 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V I+++ +   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNINNNTI-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYD+T  +SF   + W  E  +H   S  +     ++GNKV
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKE--LHEQAS--KDIIIALVGNKV 122

Query: 129 DI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA 173
           DI   DE+++ V A    E          F TSAK + N+++ F  I 
Sbjct: 123 DIIENDESERKV-AREEGERLAEEEGLIFFETSAKTAENVNDVFLNIG 169

>Kwal_23.2978 s23 (97956..98591) [636 bp, 211 aa] {ON} YOR089C
           (VPS21) - small GTP-binding protein; geranylgeranylated;
           geranylgeranylation required for membrane association;
           also involved in endocytosis post vesicle
           internalization [contig 247] FULL
          Length = 211

 Score =  108 bits (271), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 106/180 (58%), Gaps = 12/180 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D  +   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDHTI-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQAS----KDIVIALVGNKL 122

Query: 129 DIDET--KKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAF----EEIARSALQQNQS 182
           DI E+  ++ V+   A+ LA +      F TSAK   N++  F    ++I   + QQ Q+
Sbjct: 123 DIVESGGERKVAREEAENLA-AQEQLLFFETSAKTGSNVNEVFLGIGQKIPLKSPQQQQA 181

>KAFR0C04310 Chr3 (855871..856470) [600 bp, 199 aa] {ON} Anc_1.338
           YBR264C
          Length = 199

 Score =  108 bits (270), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 79/122 (64%), Gaps = 1/122 (0%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           LK+++LG+S VGK+S++ R+V  K+ Q+  ATIGA F +K + +DD K   +++WDTAGQ
Sbjct: 11  LKLVLLGESSVGKSSIVTRFVTGKF-QKNNATIGAAFTSKSIKLDDYKEVNLEIWDTAGQ 69

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ER++SL   +YR  D  ++V+DVTN +S E  +SW DE   +           +++ NK 
Sbjct: 70  ERYRSLAPMYYRETDVALVVFDVTNKRSLERAQSWIDELNFYIVSERQHAVKIMLVANKA 129

Query: 129 DI 130
           D+
Sbjct: 130 DL 131

>NCAS0B07360 Chr2 complement(1389230..1389907) [678 bp, 225 aa] {ON}
           Anc_1.338
          Length = 225

 Score =  108 bits (271), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 99/171 (57%), Gaps = 16/171 (9%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT-IDDDKV--ATMQVWDT 65
           LK+++LG+S VGKTS++ R+   K+ Q+  ATIGA FL K +  +D+D +    +++WDT
Sbjct: 23  LKLVLLGESSVGKTSIVTRFTTGKF-QRNNATIGAAFLNKNIRWVDEDNIYEVDLEIWDT 81

Query: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILG 125
           AGQER++SL   +YR  D  ++V+DVT++ +F+  +SW DE   + +    +     ++G
Sbjct: 82  AGQERYRSLAPIYYRNTDVALIVFDVTSSNTFQKARSWVDELRSYLDNEQGKEIQLYLIG 141

Query: 126 NKVDIDETKKVVSANAAQELAKS--LGNTPLFMTSAKDSINIDNAFEEIAR 174
           NK D++           + +AK+  L        SAK    I   FEEIAR
Sbjct: 142 NKCDLEH----------ESIAKTAILDMCTFKEVSAKRDEGIQELFEEIAR 182

>KLLA0C13728g Chr3 (1173329..1173955) [627 bp, 208 aa] {ON} highly
           similar to uniprot|P36017 Saccharomyces cerevisiae
           YOR089C VPS21 Rab5-like GTPase involved in vacuolar
           protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 208

 Score =  108 bits (269), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 111/207 (53%), Gaps = 13/207 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D  +   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMADHTI-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KGIVIALVGNKM 122

Query: 129 DIDETK--KVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQSXXXX 186
           D+ E++  + V+   A++L++   N   F TSAK   N++  F  I      +       
Sbjct: 123 DLLESEEDRKVAKEEAEKLSQE-ENLLFFETSAKTGDNVNEVFLAIGEKIPLKKSDGSNT 181

Query: 187 XXXXXXXXXXXQL---DD--EPNSCSC 208
                       L   DD   PNSC C
Sbjct: 182 DGLRGTEDGRIDLNKPDDTSNPNSCGC 208

>Ecym_6328 Chr6 complement(629586..630203) [618 bp, 205 aa] {ON}
           similar to Ashbya gossypii AAL176C
          Length = 205

 Score =  108 bits (269), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 102/180 (56%), Gaps = 10/180 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTID--DDKVATMQVWDTA 66
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +   DD +   ++WDTA
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLAEYDDTMIKFEIWDTA 63

Query: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E     +    +     ++GN
Sbjct: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNEL---KSKVGDDDLVICLVGN 120

Query: 127 KVDI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA-RSALQQNQS 182
           KVD+   D   KV+  + A++ A+  G       SAK    +   F+ I  R  LQ+  S
Sbjct: 121 KVDLAEEDSKSKVIDEDDAKDYAEQHG-LIFHEVSAKSGRGVIEVFQNIGERLYLQRKDS 179

>Skud_14.238 Chr14 (440139..440801) [663 bp, 220 aa] {ON} YNL093W
           (REAL)
          Length = 220

 Score =  108 bits (269), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 100/170 (58%), Gaps = 11/170 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG+S VGK+S++ R++++ +++  + TIGA FLTK +T  DDK    ++WDTAGQ
Sbjct: 13  IKLVLLGESAVGKSSIVLRFISNDFTESREPTIGAAFLTKRIT-RDDKAIKFEIWDTAGQ 71

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF  L   +YR A   ++V+D+TN +SF   + W +E  +H  +   +     ++GNK+
Sbjct: 72  ERFAPLAPMYYRNAQAALVVFDITNEQSFRKAQDWVEE--LHEKLG--DNIIIALVGNKM 127

Query: 129 DI-----DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA 173
           D+     + + + V+ +  Q L +   N   F  SAK   NI   F+ + 
Sbjct: 128 DLLTMQGEISNRAVNEDEIQNLCQQ-ENLLYFEVSAKTGKNIHEVFQAVG 176

>Skud_11.247 Chr11 complement(445982..446686) [705 bp, 234 aa] {ON}
           YKR014C (REAL)
          Length = 234

 Score =  108 bits (270), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 102/192 (53%), Gaps = 32/192 (16%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTID-------DDKVATMQ 61
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ +TI         D V   +
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNGAKDVVIKFE 63

Query: 62  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPF 121
           +WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +    
Sbjct: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVI 120

Query: 122 VILGNKVDI------------------DETK-KVVSANAAQELAKSLGNTPLFM-TSAKD 161
            +LGNKVD+                  DE K + +S   A++ A+  G   LF   SAK 
Sbjct: 121 YLLGNKVDLCQDMPGSETIPELNEGEDDEQKVRAISTEEAKQYAQEQG--LLFREVSAKT 178

Query: 162 SINIDNAFEEIA 173
              I   F+EI 
Sbjct: 179 GDGIKEIFQEIG 190

>Smik_11.271 Chr11 complement(452840..453544) [705 bp, 234 aa] {ON}
           YKR014C (REAL)
          Length = 234

 Score =  108 bits (269), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 103/192 (53%), Gaps = 32/192 (16%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTID-------DDKVATMQ 61
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ +TI         D +   +
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGGEVKDVIIKFE 63

Query: 62  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPF 121
           +WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +    
Sbjct: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVI 120

Query: 122 VILGNKVDI------------------DETK-KVVSANAAQELAKSLGNTPLFM-TSAKD 161
            +LGNKVD+                  DE K +V+S   A++ A+  G   LF   SAK 
Sbjct: 121 YLLGNKVDLCQESASTEPSPESNKGEDDEQKVRVISTEEAKQYAQEQG--LLFREVSAKT 178

Query: 162 SINIDNAFEEIA 173
              +   F++I 
Sbjct: 179 GEGVKEIFQDIG 190

>YKR014C Chr11 complement(465367..466071) [705 bp, 234 aa] {ON}
           YPT52Rab family GTPase, similar to Ypt51p and Ypt53p and
           to mammalian rab5; required for vacuolar protein sorting
           and endocytosis
          Length = 234

 Score =  107 bits (268), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 103/192 (53%), Gaps = 32/192 (16%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTID-------DDKVATMQ 61
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ +TI         D V   +
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63

Query: 62  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPF 121
           +WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +    
Sbjct: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVI 120

Query: 122 VILGNKVDI-----------------DETKKV--VSANAAQELAKSLGNTPLFM-TSAKD 161
            +LGNKVD+                 DE +KV  +S   A++ A+  G   LF   SAK 
Sbjct: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG--LLFREVSAKT 178

Query: 162 SINIDNAFEEIA 173
              +   F++I 
Sbjct: 179 GEGVKEIFQDIG 190

>TDEL0C04660 Chr3 complement(845203..845838) [636 bp, 211 aa] {ON}
           Anc_2.196 YNL093W
          Length = 211

 Score =  106 bits (265), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 98/168 (58%), Gaps = 10/168 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V I D+ V   ++WDTAGQ
Sbjct: 8   VKLVLLGEAAVGKSSIVLRFVSNDFTENKEPTIGAAFLTQRVNIGDETV-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KGIIIALVGNKI 122

Query: 129 DI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA 173
           D+    E +KV    A +   +   N   F TSAK   N++  F  I 
Sbjct: 123 DVLESGEERKVAREEAEKLAEEE--NLLYFETSAKTGENVNEVFLAIG 168

>TPHA0I02590 Chr9 complement(571327..572004) [678 bp, 225 aa] {ON}
           Anc_1.338 YBR264C
          Length = 225

 Score =  105 bits (263), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/171 (36%), Positives = 101/171 (59%), Gaps = 6/171 (3%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTI----DDDKVATMQVWD 64
           LK+++LG+S VGK+S++ RYV  K+++   ATIGA F+TKE+       + +V  +++WD
Sbjct: 15  LKLVLLGESSVGKSSVVSRYVTGKFNKT-NATIGAAFITKEIKFVSEEGEHRVVNLEIWD 73

Query: 65  TAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVIL 124
           TAGQER++SL   +YR  D  V+V+D+T   S     +W DE L +      E     ++
Sbjct: 74  TAGQERYRSLAPMYYRNTDVAVIVFDLTVPDSAAKALAWVDELLSYVEKERREEIVITVV 133

Query: 125 GNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARS 175
           GNK D+ E    + +   Q++A +L   P++  SAK    I+  F++I RS
Sbjct: 134 GNKNDLIEGDDKIDSAMEQDIA-TLAKRPIWRVSAKTGEGIEELFQDIVRS 183

>TBLA0B01820 Chr2 complement(415800..416438) [639 bp, 212 aa] {ON}
           Anc_2.196 YNL093W
          Length = 212

 Score =  105 bits (262), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/176 (36%), Positives = 102/176 (57%), Gaps = 8/176 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V I +  +   ++WDTAGQ
Sbjct: 8   VKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNIGNHTI-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    AN    +     ++GNK 
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQAN----KGIIIALVGNKA 122

Query: 129 DI--DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQS 182
           DI  D  ++ V+   A++LA+  G    F TSAK   N++  F  I      +N S
Sbjct: 123 DIIEDGEERKVAREEAEKLAEEEG-LLFFETSAKTGNNVNETFLAIGEKIPLKNSS 177

>NCAS0B07630 Chr2 complement(1443664..1444314) [651 bp, 216 aa] {ON}
           Anc_1.289
          Length = 216

 Score =  105 bits (262), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 96/173 (55%), Gaps = 12/173 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTI-----DDDKVATMQVW 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + I     ++D V   ++W
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63

Query: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123
           DTAGQER++SL   +YR A+  ++VYD+T   S    +SW +E     N    E     +
Sbjct: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEEL---KNKVGDEDLVIFL 120

Query: 124 LGNKVDI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA 173
           +GNK+D+   +E  + V  + A+  A+   N      SAK    +   F  I 
Sbjct: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVFRSIG 172

>Suva_11.246 Chr11 complement(449412..450122) [711 bp, 236 aa] {ON}
           YKR014C (REAL)
          Length = 236

 Score =  106 bits (264), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 101/194 (52%), Gaps = 34/194 (17%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTID---------DDKVAT 59
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ +TI           D V  
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNEANAKDVVIK 63

Query: 60  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETF 119
            ++WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +  
Sbjct: 64  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDL 120

Query: 120 PFVILGNKVDI-------------------DETKKVVSANAAQELAKSLGNTPLFM-TSA 159
              +LGNKVD+                   +  ++ +S   A++ A+  G   LF   SA
Sbjct: 121 VIYLLGNKVDLCLGTPGAEIGQESKEDGDNEPKERAISTEEARQYAQEQG--LLFREVSA 178

Query: 160 KDSINIDNAFEEIA 173
           K    + + F EI 
Sbjct: 179 KTGEGVKDIFREIG 192

>ZYRO0B09152g Chr2 complement(714608..715279) [672 bp, 223 aa] {ON}
           similar to uniprot|P36019 Saccharomyces cerevisiae
           YNL093W YPT53 Involved in vacuolar protein sorting and
           endocytosis GTP-binding protein of the rab family
          Length = 223

 Score =  105 bits (263), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 67/217 (30%), Positives = 106/217 (48%), Gaps = 25/217 (11%)

Query: 1   MSSRKKNI----LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDD- 55
           MSS  + +    LK+++LG+S VGKTS++ RY    Y Q+  ATIGA F TK + +  + 
Sbjct: 23  MSSEAQEVYVANLKLVLLGESSVGKTSIVTRYTTGNY-QKTNATIGAAFFTKAINVPSED 81

Query: 56  ---KVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHAN 112
              +   +++WDTAGQER++SL   +YR  D   +V+DVT  +S E   SW +E   + +
Sbjct: 82  GVVRKVNVEIWDTAGQERYRSLTPVYYRNTDAAFIVFDVTKPESLEKAHSWIEELNEYCS 141

Query: 113 VSSPET-FPFVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEE 171
              PE     +++GNK+D+D                   +    + SAK    I   FE+
Sbjct: 142 SDRPENEINTIVVGNKIDLDH-------------GPFETDLQYVLVSAKTGEGIVKLFEK 188

Query: 172 IARSALQQNQSXXXXXXXXXXXXXXXQLDDEPNSCSC 208
           +A+S L  N+                ++     +CSC
Sbjct: 189 LAQSVL--NEKYVREETLEDLPKDPFKMKRRKETCSC 223

>TDEL0D01570 Chr4 (310454..311107) [654 bp, 217 aa] {ON} Anc_1.289
           YKR014C
          Length = 217

 Score =  105 bits (261), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 100/180 (55%), Gaps = 14/180 (7%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTI---DD--DKVATMQVW 63
            K+++LGDS VGK+S+++R+V + + +  ++TIGA FL++ + +   DD  + V   ++W
Sbjct: 4   FKLVLLGDSSVGKSSIVYRFVKNSFDEFRESTIGAAFLSQTIKVKESDDGEETVIKFEIW 63

Query: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123
           DTAGQER++SL   +YR A+  ++VYDVT   S    +SW +E     N    +     +
Sbjct: 64  DTAGQERYKSLAPMYYRNANAALVVYDVTQQDSLVKAQSWVNEL---KNKVGDDDLVICL 120

Query: 124 LGNKVDI-----DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           +GNKVD+     ++ K+ V    A+  A    N   +  SAK  +N+   F+ I     +
Sbjct: 121 VGNKVDLCDEDAEDNKRAVGTEEARSYANE-QNLLFYEVSAKTGLNVQQIFQSIGEKLFE 179

>SAKL0E09922g Chr5 complement(829249..829890) [642 bp, 213 aa] {ON}
           similar to uniprot|P36017 Saccharomyces cerevisiae
           YOR089C VPS21 Rab5-like GTPase involved in vacuolar
           protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 213

 Score =  104 bits (260), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 101/192 (52%), Gaps = 17/192 (8%)

Query: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60
           M+S     +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D  +   
Sbjct: 1   MNSSSVTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDHTI-KF 59

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120
           ++WDTAGQERF SL   +YR A   ++VYDVT  +SF   + W  E    AN    +   
Sbjct: 60  EIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQAN----KGII 115

Query: 121 FVILGNKVDIDET---KKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR--- 174
             ++GNK+D+ E    +KV  A    E          F TSAK   N++  F  I     
Sbjct: 116 IALVGNKLDLLENGGERKV--AKEEGEKLAEEEGLLFFETSAKTGDNVNEVFLAIGEKIP 173

Query: 175 ----SALQQNQS 182
                 LQQ Q 
Sbjct: 174 LHTPEELQQQQG 185

>NDAI0B04980 Chr2 complement(1216833..1217516) [684 bp, 227 aa] {ON}
           Anc_1.289
          Length = 227

 Score =  104 bits (260), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 95/185 (51%), Gaps = 25/185 (13%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVA-----TMQVW 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL + + I D +         ++W
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLAQTIKIKDTETQEDIDIKFEIW 63

Query: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123
           DTAGQER++SL   +YR A+  ++VYD+T   S     SW DE          E     +
Sbjct: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKNSLSKAMSWVDELKSKV---GDEDLVIYL 120

Query: 124 LGNKVDI--------------DETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNA 168
           +GNK+D+              +E K+VV+   A   AK  G   LF   SAK    +   
Sbjct: 121 VGNKLDLCDNVENRGGKEQEEEENKRVVTTQEADSYAKDQG--LLFAEISAKTGQGVKEV 178

Query: 169 FEEIA 173
           F+ I 
Sbjct: 179 FQTIG 183

>AEL187C Chr5 complement(284984..285610) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR264C
           (YPT10)
          Length = 208

 Score =  103 bits (257), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 98/176 (55%), Gaps = 22/176 (12%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDD----------KVA 58
           +K+++LG+S VGK+S++ R+   ++ +  +ATIGA F T+ V  ++D          +  
Sbjct: 9   VKLVLLGESSVGKSSIVTRFTTGEFRKN-QATIGAAFTTRSVQWEEDAGDGSDAKEVRSV 67

Query: 59  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPET 118
           T ++WDTAGQER++SL   +YR  D  ++VYDVT  +SF+N +SW DE   +   +    
Sbjct: 68  TFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTEQQSFQNARSWIDELNTYIGEAQRND 127

Query: 119 FPFVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
               I+GNK+D+         +A  +L + L +      SAK    I+  F +IA+
Sbjct: 128 VVVRIVGNKIDL---------HAGGQLEQPLPSATF--VSAKTGEGIEELFMDIAK 172

>ACL084C Chr3 complement(199020..199643) [624 bp, 207 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR089C
           (VPS21) and YNL093W (YPT53)
          Length = 207

 Score =  103 bits (256), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 106/205 (51%), Gaps = 10/205 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V +D  K    ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNMDS-KTIKFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYD+T  +SF   + W  E  +H   S  +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKE--LHEQAS--KGIVIALVGNKL 122

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAF----EEIARSALQQNQSX 183
           D+ E  +    +  +    +     LF  TSAK    I+  F    E+I  + + +  + 
Sbjct: 123 DLLENGEARKVSREEAEKLAEEEGLLFFETSAKTGDKINEVFLAIGEKIPLAKVGEQPAS 182

Query: 184 XXXXXXXXXXXXXXQLDDEPNSCSC 208
                           +   NSC+C
Sbjct: 183 GPSVDNARLDLNAVSSNQHANSCNC 207

>ZYRO0C15554g Chr3 complement(1218190..1218825) [636 bp, 211 aa]
           {ON} highly similar to uniprot|P36017 Saccharomyces
           cerevisiae YOR089C VPS21 Rab5-like GTPase involved in
           vacuolar protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 211

 Score =  102 bits (254), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 101/167 (60%), Gaps = 8/167 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V I +  V   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNIGEQTV-KFEIWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           ERF SL   +YR A   ++VYD+T  +SF   + W  E  +H   S  +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKE--LHEQAS--KGIVIALVGNKL 122

Query: 129 DIDET--KKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIA 173
           D+ E   ++ V+   A++LA+  G    F TSAK   N++  F  I 
Sbjct: 123 DMIENGGERKVAKEEAEKLAEEEG-LLFFETSAKSGENVNEVFLGIG 168

>TDEL0D02060 Chr4 (403098..403706) [609 bp, 202 aa] {ON} Anc_1.338
           YBR264C
          Length = 202

 Score = 99.8 bits (247), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/168 (33%), Positives = 91/168 (54%), Gaps = 16/168 (9%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK--EVTIDDDKVA--TMQVWD 64
           LK+++LG+S VGK+S++ RYV   + Q+  ATIGA F T+  EV   D  +    +++WD
Sbjct: 13  LKLVLLGESSVGKSSIVMRYVTGSF-QKTNATIGAAFTTRTFEVPQCDGSIKRINLEIWD 71

Query: 65  TAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVIL 124
           TAGQER++SL   ++R  D  ++V+DVT  +S    +SW +E   +      +     ++
Sbjct: 72  TAGQERYRSLAPMYFRNTDIALVVFDVTKPESLRKAQSWIEELNSYVEEDRRDDLRIKVI 131

Query: 125 GNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEI 172
           GNK D++            +   ++   PLF  SAK    ID  FE +
Sbjct: 132 GNKKDLE-----------HDPVGTIEGLPLFTVSAKTGEGIDELFESL 168

>ZYRO0G21384g Chr7 complement(1763055..1763711) [657 bp, 218 aa]
           {ON} highly similar to uniprot|Q75F92 Ashbya gossypii
           AAL176C AAL176Cp and similar to YKR014C uniprot|P36018
           Saccharomyces cerevisiae YKR014C YPT52 rab5-like GTPase
           involved in vacuolar protein sorting and endocytosis
           probable purine nucleotide-binding protein
          Length = 218

 Score = 99.8 bits (247), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 95/178 (53%), Gaps = 18/178 (10%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDD-----DKVATMQVW 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + I+D     + V   ++W
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKIEDKGSQQEVVIKFEIW 63

Query: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123
           DTAGQER++SL   +YR A+  ++VYDVT   S    + W +E          +     +
Sbjct: 64  DTAGQERYKSLAPMYYRNANAALVVYDVTQQDSLAKAQGWVNELKTKVG---EDDLVICL 120

Query: 124 LGNKVDI-------DETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIA 173
           +GNK+D+           K V ++ A+  A   G   LF   SAK    +   F+ I 
Sbjct: 121 VGNKLDLCTEEGESSSKPKAVESSDAEGYANEQG--LLFHEVSAKTGEGVKQVFQSIG 176

>Suva_4.526 Chr4 complement(909423..910019) [597 bp, 198 aa] {ON}
           YBR264C (REAL)
          Length = 198

 Score = 99.0 bits (245), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 99/178 (55%), Gaps = 15/178 (8%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVAT-----MQVW 63
           +KV++LGDS VGKTS++ R  + K+ +++ ATIGA F+TK + +     +T     M++W
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFPEKHAATIGAAFVTKTIEVPTSDTSTEKRIHMEIW 64

Query: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123
           DTAGQER++SL   +YR A+  +LV+++ NA S +   +W  +    A  +       ++
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALLVFELNNAASLQCAMTWFQDLQDRAQETK-----VIL 119

Query: 124 LGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           +GNK D+   ++    ++  E+   L   P    SAK   N D A  +I  S +  +Q
Sbjct: 120 VGNKHDLVSQEQ----SSEVEIPVELQGVPYVPVSAKTGYNFD-ALNKIIISLIPDDQ 172

>Ecym_6309 Chr6 (585998..586624) [627 bp, 208 aa] {ON} similar to
           Ashbya gossypii AEL187C
          Length = 208

 Score = 99.0 bits (245), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 95/167 (56%), Gaps = 15/167 (8%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDD-----------KV 57
           LK+++LG+S VGK+S++ R+   ++ +  +ATIGA F T+ ++  ++           K 
Sbjct: 9   LKLVLLGESSVGKSSIVTRFTTGEFHKN-QATIGAAFTTRTISWKENPTNRSSEELITKS 67

Query: 58  ATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPE 117
              ++WDTAGQER++SL   +YR  D  ++V+D+T+  S E  +SW DE   + + S  +
Sbjct: 68  VNFEIWDTAGQERYRSLAPMYYRNTDVALIVFDITDESSLEKAQSWIDELNTYVDESRQK 127

Query: 118 TFPFVILGNKVDIDETKKVVSANAAQEL--AKS-LGNTPLFMTSAKD 161
                I+GNK+D+ ++K V        L  AKS  G   LFM  AK+
Sbjct: 128 QIVIKIVGNKMDLKDSKFVKGGWKTVSLVSAKSGEGIEDLFMCIAKE 174

>CAGL0I09306g Chr9 complement(897357..897977) [621 bp, 206 aa] {ON}
           similar to uniprot|P38146 Saccharomyces cerevisiae
           YBR264c GTP-binding protein
          Length = 206

 Score = 98.6 bits (244), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 93/171 (54%), Gaps = 15/171 (8%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT-IDDDKV--ATMQVWDT 65
           LKV++LG+S VGK++++ R+   KY +   ATIGA ++TK++  I D  V    +++WDT
Sbjct: 11  LKVVLLGESAVGKSAIVTRFSTGKYLRN-NATIGAAYVTKDLEYIRDGDVYQVRLEIWDT 69

Query: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILG 125
           AGQER++SL   +YR  D  ++V+DV+N +S      W DE   +      E    V++G
Sbjct: 70  AGQERYRSLTPMYYRNTDVAIVVFDVSNLRSLSMAHKWIDELNTYVENKGRERINIVLVG 129

Query: 126 NKVDI--DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           NK+D+  DE +  +     ++             SAK    I+  F+ I +
Sbjct: 130 NKMDLCSDEERSTLPQRVEEQFQA---------VSAKSGEGIEELFDHIVK 171

>Smik_2.408 Chr2 complement(723817..724416) [600 bp, 199 aa] {ON}
           YBR264C (REAL)
          Length = 199

 Score = 97.8 bits (242), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 90/164 (54%), Gaps = 14/164 (8%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVAT-----MQVW 63
           +KV++LGDS VGKTS++ R  + K+  ++ ATIGA F+TK + I  D   T     M++W
Sbjct: 5   IKVVLLGDSSVGKTSVVTRLKSGKFLAKHAATIGAAFITKTIEIPSDDTTTDKRIHMEIW 64

Query: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123
           DTAGQER++SL   +YR A+  +LV+++ +  S +  K+W  +    A  +       ++
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALLVFELGDISSLQCAKTWFQDLQDRAQGTQ-----VIL 119

Query: 124 LGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDN 167
           +GNK D+   + +       EL     + P  + SAK   N D 
Sbjct: 120 VGNKYDLVREEHLDEVTIPAELQ----DLPYVLVSAKTGYNFDT 159

>SAKL0D06490g Chr4 complement(531028..531684) [657 bp, 218 aa] {ON}
           similar to uniprot|P36019 Saccharomyces cerevisiae
           YNL093W YPT53 Involved in vacuolar protein sorting and
           endocytosis GTP-binding protein of the rab family
          Length = 218

 Score = 97.8 bits (242), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/178 (33%), Positives = 97/178 (54%), Gaps = 18/178 (10%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDD---------DKVAT 59
           LK+++LG+S VGK+S++ R+    + +   ATIGA F TK ++++          DK   
Sbjct: 9   LKLVLLGESSVGKSSIVTRFTTGNFHRS-NATIGAAFTTKTLSLESIVPETGETIDKKIK 67

Query: 60  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETF 119
           +++WDTAGQER++SL   +YR  D  ++V+DVTN  S    +SW DE   + N    E  
Sbjct: 68  LEIWDTAGQERYRSLAPMYYRNTDVALIVFDVTNKDSIARAQSWIDELNRYINEGEHEER 127

Query: 120 PFV--ILGNKVDID-ETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
             +  I+GNK+D++ E ++  +    Q+   +      F  SAK    ID  F+ I +
Sbjct: 128 GILIKIVGNKIDLNPEARETQNLPYIQDQGYN-----WFPVSAKTGDGIDELFDTIVK 180

>NDAI0B04680 Chr2 complement(1157279..1157950) [672 bp, 223 aa] {ON}
           Anc_1.338
          Length = 223

 Score = 95.5 bits (236), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/182 (33%), Positives = 104/182 (57%), Gaps = 22/182 (12%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT---IDDDKV-----ATM 60
           LKV++LG+S VGKTS++ +    K+ Q+  ATIGA F TK++    I+++ V      ++
Sbjct: 13  LKVVLLGESSVGKTSIVTKISTGKF-QKGAATIGAAFTTKQIQFNEIEENGVEQCFKVSI 71

Query: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSP--ET 118
           ++WDTAGQER++SL   +YR  D  ++V+D+T   S +  +SW DE   + + SS   + 
Sbjct: 72  EIWDTAGQERYRSLTPMYYRNTDVALIVFDLTQEASLKKARSWIDELKSYLDSSSRRDKH 131

Query: 119 FPFVILGNKVDIDETKKVVSANAAQELAKSLGN------TPLFMTSAKDSINIDNAFEEI 172
              +++ NKVD+     V   +   ++ + L N       PL + SAK +  I+  F++I
Sbjct: 132 ISMILVANKVDL-----VAKNDGTFDINQYLENWDIPSEYPLKIVSAKTNEGINELFDDI 186

Query: 173 AR 174
            +
Sbjct: 187 IK 188

>YBR264C Chr2 complement(737770..738369) [600 bp, 199 aa] {ON}
           YPT10Rab family GTP-binding protein that contains the
           PEST signal sequence specific for proteolytic enzymes;
           may be involved in vesicular transport; overexpression
           leads to accumulation of Golgi-like cisternae with
           budding vesicles
          Length = 199

 Score = 92.8 bits (229), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 91/164 (55%), Gaps = 16/164 (9%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVAT-----MQVW 63
           +KV++LGDS VGKTS++ R  + K+  ++ ATIGA F+TK + +  +  +T     M++W
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIHMEIW 64

Query: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123
           DTAGQER++SL   +YR A+  ++V+++ +  S +  K+W  +    A  +       +I
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQ-----VII 119

Query: 124 LGNKVDIDETKKVVSANAAQ-ELAKSLGNTPLFMTSAKDSINID 166
           +GNK D+     V   ++ +  +   L   P    SAK   N D
Sbjct: 120 VGNKYDL-----VCEEHSGEVTIPAELQGLPYVAVSAKTGYNFD 158

>KLTH0G14850g Chr7 (1304240..1304884) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P32835 Saccharomyces cerevisiae
           YLR293C GSP1 GTP binding protein (mammalian Ranp
           homolog) involved in the maintenance of nuclear
           organization RNA processing and transport regulated by
           Prp20p Rna1p Yrb1p Yrb2p Yrp4p Yrb30p Cse1p and Kap95p
           yeast Gsp2p homolog
          Length = 214

 Score = 92.8 bits (229), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 88/166 (53%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        D  ++    VWDTAGQ
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTDFGELK-FDVWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 67  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 121

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E K  V A       K   N   +  SAK + N +  F  +AR
Sbjct: 122 DVKERK--VKAKTITFHRKK--NLQYYDISAKSNYNFEKPFLWLAR 163

>Kwal_56.23361 s56 complement(508046..508690) [645 bp, 214 aa] {ON}
           YLR293C (GSP1) - GTP-binding protein [contig 181] FULL
          Length = 214

 Score = 92.4 bits (228), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 88/166 (53%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        D  ++    VWDTAGQ
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTDFGEL-KFDVWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 67  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 121

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E K  V A       K   N   +  SAK + N +  F  +AR
Sbjct: 122 DVKERK--VKAKTITFHRKK--NLQYYDISAKSNYNFEKPFLWLAR 163

>Kpol_1066.11 s1066 complement(18137..18865) [729 bp, 242 aa] {ON}
           complement(18137..18865) [729 nt, 243 aa]
          Length = 242

 Score = 93.2 bits (230), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 90/183 (49%), Gaps = 19/183 (10%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDD------------- 55
           LK+++LGDS VGKTS++ R     +     ATIGA F+T  + +DD+             
Sbjct: 19  LKLVLLGDSSVGKTSIVGRLTTGNFINS-NATIGAAFVTTTIEVDDEEMINGGNNGMSSK 77

Query: 56  ----KVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHA 111
               K    ++WDTAGQER++SL   +YR  D  ++V+D++  +SF+  +SW +E   + 
Sbjct: 78  RSIKKRVNFEIWDTAGQERYRSLAPMYYRNTDVALIVFDLSRPQSFKGAQSWIEELNSYV 137

Query: 112 NVSSPETFPFVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEE 171
             SS      V++G+K DI E  +   A       K      L   SAK    I   FE 
Sbjct: 138 EESSRGEIITVLVGSKKDI-EIGQPSMAPIIDNFDKLKFTKNLQKVSAKTGEGIQELFEN 196

Query: 172 IAR 174
           I R
Sbjct: 197 IVR 199

>YOR185C Chr15 complement(681444..682106) [663 bp, 220 aa] {ON}
           GSP2GTP binding protein (mammalian Ranp homolog)
           involved in the maintenance of nuclear organization, RNA
           processing and transport; interacts with Kap121p,
           Kap123p and Pdr6p (karyophilin betas); Gsp1p homolog
           that is not required for viability
          Length = 220

 Score = 92.4 bits (228), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 90/166 (54%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQ 72

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 73  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 127

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 128 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 169

>Skud_15.352 Chr15 complement(632241..632903) [663 bp, 220 aa] {ON}
           YOR185C (REAL)
          Length = 220

 Score = 92.4 bits (228), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 90/166 (54%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDVWDTAGQ 72

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 73  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 127

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 128 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 169

>Suva_8.241 Chr8 complement(432445..433107) [663 bp, 220 aa] {ON}
           YOR185C (REAL)
          Length = 220

 Score = 92.4 bits (228), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 90/166 (54%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDVWDTAGQ 72

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 73  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 127

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 128 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 169

>Smik_15.370 Chr15 complement(637457..638119) [663 bp, 220 aa] {ON}
           YOR185C (REAL)
          Length = 220

 Score = 92.4 bits (228), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 90/166 (54%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDVWDTAGQ 72

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 73  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 127

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 128 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 169

>Suva_10.389 Chr10 complement(681930..682589) [660 bp, 219 aa] {ON}
           YLR293C (REAL)
          Length = 219

 Score = 92.0 bits (227), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 90/166 (54%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQ 71

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 72  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 126

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 127 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 168

>Skud_12.375 Chr12 complement(661797..662456) [660 bp, 219 aa] {ON}
           YLR293C (REAL)
          Length = 219

 Score = 92.0 bits (227), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 90/166 (54%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQ 71

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 72  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 126

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 127 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 168

>Smik_12.371 Chr12 complement(658971..659630) [660 bp, 219 aa] {ON}
           YLR293C (REAL)
          Length = 219

 Score = 92.0 bits (227), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 90/166 (54%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQ 71

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 72  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 126

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 127 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 168

>YLR293C Chr12 complement(720771..721430) [660 bp, 219 aa] {ON}
           GSP1Ran GTPase, GTP binding protein (mammalian Ranp
           homolog) involved in the maintenance of nuclear
           organization, RNA processing and transport; regulated by
           Srm1p, Rna1p, Yrb1p, Yrb2p, Yrp4p, Yrb30p, Cse1p and
           Kap95p; yeast Gsp2p homolog
          Length = 219

 Score = 92.0 bits (227), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 90/166 (54%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQ 71

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 72  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 126

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 127 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 168

>KAFR0D02040 Chr4 complement(412576..413382,413464..413481) [825 bp,
           274 aa] {ON} Anc_2.182 YNL098C
          Length = 274

 Score = 93.2 bits (230), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 97/164 (59%), Gaps = 7/164 (4%)

Query: 11  VIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQER 70
           + ++G  G+GK+++  R++  +++ +Y  TI  D   K++T+D+ K  T+ + DTAGQE 
Sbjct: 16  IAVVGSGGIGKSAITIRFIQSRFTDEYDPTI-EDSYRKQLTVDNAKY-TIDILDTAGQEE 73

Query: 71  FQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVDI 130
           +  +   + R  D  +LVY +++ +S++ + ++  + L    V   E  P V++GNK D+
Sbjct: 74  YYMMREQYMRNCDGFLLVYSISSMQSYDELLNFYHQIL---RVKEVEYIPIVVIGNKSDL 130

Query: 131 DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            E+++ VS    +++  ++   P F TSAK  +NID AF+ + R
Sbjct: 131 -ESERQVSFKEGEQMGCNISG-PFFETSAKYGLNIDVAFQSLVR 172

>ZYRO0D14784g Chr4 complement(1247520..1248164) [645 bp, 214 aa]
           {ON} highly similar to uniprot|P32836 Saccharomyces
           cerevisiae YOR185C GSP2 GTP binding protein (mammalian
           Ranp homolog) involved in the maintenance of nuclear
           organization RNA processing and transport interacts with
           Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
           homolog that is not required for viability
          Length = 214

 Score = 91.7 bits (226), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 90/166 (54%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDVWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 67  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 121

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 122 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 163

>CAGL0I00594g Chr9 (44835..45479) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P32835 Saccharomyces cerevisiae
           YLR293c GSP1
          Length = 214

 Score = 91.3 bits (225), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 88/166 (53%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFHTNFGEIK-FDVWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 67  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 121

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E K  V A       K   N   +  SAK + N +  F  +AR
Sbjct: 122 DVKERK--VKAKTITFHRKK--NLQYYDISAKSNYNFEKPFLWLAR 163

>TDEL0G03810 Chr7 (699414..700082) [669 bp, 222 aa] {ON} Anc_6.90
           YLR293C
          Length = 222

 Score = 91.7 bits (226), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 90/166 (54%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 16  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQ 74

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 75  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 129

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 130 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 171

>KLLA0A04499g Chr1 complement(404732..405376) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P32836 Saccharomyces
           cerevisiae YOR185C GSP2 GTP binding protein (mammalian
           Ranp homolog) involved in the maintenance of nuclear
           organization RNA processing and transport interacts with
           Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
           homolog that is not required for viability
          Length = 214

 Score = 91.3 bits (225), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 88/166 (53%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIK-FDVWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 67  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 121

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E K  V A       K   N   +  SAK + N +  F  +AR
Sbjct: 122 DVKERK--VKAKTITFHRKK--NLQYYDISAKSNYNFEKPFLWLAR 163

>KLLA0C05126g Chr3 complement(463657..464301) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P32836 Saccharomyces
           cerevisiae YOR185C GSP2 GTP binding protein (mammalian
           Ranp homolog) involved in the maintenance of nuclear
           organization RNA processing and transport interacts with
           Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
           homolog that is not required for viability
          Length = 214

 Score = 91.3 bits (225), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 88/166 (53%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIK-FDVWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 67  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 121

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E K  V A       K   N   +  SAK + N +  F  +AR
Sbjct: 122 DVKERK--VKAKTITFHRKK--NLQYYDISAKSNYNFEKPFLWLAR 163

>Ecym_3097 Chr3 (181482..182126) [645 bp, 214 aa] {ON} similar to
           Ashbya gossypii AGR294C
          Length = 214

 Score = 91.3 bits (225), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 88/166 (53%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEI-KFDVWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 67  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 121

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E K  V A       K   N   +  SAK + N +  F  +AR
Sbjct: 122 DVKERK--VKAKTITFHRKK--NLQYYDISAKSNYNFEKPFLWLAR 163

>AGR294C Chr7 complement(1287036..1287680) [645 bp, 214 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR185C
           (GSP2) and YLR293C (GSP1)
          Length = 214

 Score = 91.3 bits (225), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 88/166 (53%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEI-KFDVWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 67  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 121

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E K  V A       K   N   +  SAK + N +  F  +AR
Sbjct: 122 DVKERK--VKAKTITFHRKK--NLQYYDISAKSNYNFEKPFLWLAR 163

>SAKL0A07744g Chr1 (688406..689050) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P32835 Saccharomyces cerevisiae
           YLR293C GSP1 GTP binding protein (mammalian Ranp
           homolog) involved in the maintenance of nuclear
           organization RNA processing and transport regulated by
           Prp20p Rna1p Yrb1p Yrb2p Yrp4p Yrb30p Cse1p and Kap95p
           yeast Gsp2p homolog
          Length = 214

 Score = 91.3 bits (225), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 88/166 (53%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQ
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEI-KFDVWDTAGQ 66

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 67  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 121

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E K  V A       K   N   +  SAK + N +  F  +AR
Sbjct: 122 DVKERK--VKAKTITFHRKK--NLQYYDISAKSNYNFEKPFLWLAR 163

>CAGL0J05632g Chr10 complement(539466..540032) [567 bp, 188 aa] {ON}
           highly similar to uniprot|P06781 Saccharomyces
           cerevisiae YNL090w RHO2
          Length = 188

 Score = 90.1 bits (222), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 100/177 (56%), Gaps = 12/177 (6%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   K+ +QY  T+  +++T +  +D  KV ++ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVT-DCRVDGIKV-SLALWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y GAD  ++ + V N +S  N ++ W +E   +     P+  P +++G K 
Sbjct: 67  EYERLRPFSYSGADVILIAFSVDNVESLHNARTKWAEEAFRYC----PDA-PVILVGLKE 121

Query: 129 DIDETKK----VVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           D+ ++K+     V+   A+++AK++G       SA     +D+ FE   RS+L  ++
Sbjct: 122 DLRKSKQEGIVFVNREDAEQVAKAIGAKKYLECSALTGEGVDDVFELATRSSLLMHK 178

>KLTH0H10274g Chr8 complement(882443..883048) [606 bp, 201 aa] {ON}
           weakly similar to uniprot|P36018 Saccharomyces
           cerevisiae YKR014C YPT52 rab5-like GTPase involved in
           vacuolar protein sorting and endocytosis; probable
           purine nucleotide-binding protein
          Length = 201

 Score = 90.5 bits (223), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 88/170 (51%), Gaps = 19/170 (11%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDD---KVATMQVWDT 65
           LK+++LG+S VGK++L+ R+    + +   ATIGA F TK V+ + +   K    ++WDT
Sbjct: 10  LKLVLLGESSVGKSALVTRFTTGAFHKN-NATIGAAFTTKVVSWETNEAIKQVKFEIWDT 68

Query: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILG 125
           AGQER++SL   +YR  D   +V+DVT+  +F    SW DE   +            ++G
Sbjct: 69  AGQERYRSLTPMYYRKTDVAFVVFDVTDDATFSKAGSWIDELKGYMQSEDAHDIIIKLVG 128

Query: 126 NKVD-IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           NK D +D                +L  TP+   SAK    + N FE +AR
Sbjct: 129 NKTDLLDHVPDT-----------TLEWTPV---SAKTGEGVANLFESVAR 164

>NCAS0F00440 Chr6 complement(79004..79663) [660 bp, 219 aa] {ON}
           Anc_6.90 YLR293C
          Length = 219

 Score = 90.9 bits (224), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 90/171 (52%), Gaps = 20/171 (11%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGAD-----FLTKEVTIDDDKVATMQVW 63
            K++++GD G GKT+ + R++  ++ ++Y ATIG +     F T    I  D       W
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNYGEIKFD------CW 66

Query: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123
           DTAGQE+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+
Sbjct: 67  DTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVL 121

Query: 124 LGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            GNKVD+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 122 CGNKVDVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 168

>Kwal_47.19055 s47 complement(1078494..1079033) [540 bp, 179 aa]
           {ON} YGL210W (YPT32) - ras-like GTPase, highly
           homologous to YPT31 [contig 188] FULL
          Length = 179

 Score = 89.4 bits (220), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 83/145 (57%), Gaps = 15/145 (10%)

Query: 38  KATIGADFLTKEVTIDDDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSF 97
           K+TIG +F T+ + ++  K+   Q+WDTAGQER++++  A+YRGA   ++VYD++ + S+
Sbjct: 4   KSTIGVEFATRTIEVEGKKIKA-QIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSY 62

Query: 98  ENIKSWRDEFLVHANVSSPETFPFVILGNKVDIDETKKVVS---ANAAQELAKSLGNTPL 154
           EN   W  E   +A+    E     ++GNK D+   + V +    N AQE      N  L
Sbjct: 63  ENCNHWLTELRENAD----ENVAVGLIGNKSDLAHLRAVPTDEAKNFAQE------NQLL 112

Query: 155 FM-TSAKDSINIDNAFEEIARSALQ 178
           F  TSA +S N+D AF E+  +  Q
Sbjct: 113 FTETSALNSENVDQAFRELISAIYQ 137

>NDAI0D02670 Chr4 (618909..619571) [663 bp, 220 aa] {ON} Anc_6.90
          Length = 220

 Score = 90.1 bits (222), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 89/166 (53%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++     WDTAGQ
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNYGEI-KFDCWDTAGQ 72

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 73  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 127

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 128 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 169

>Kpol_1009.9 s1009 complement(23990..24631) [642 bp, 213 aa] {ON}
           complement(23990..24631) [642 nt, 214 aa]
          Length = 213

 Score = 89.7 bits (221), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 88/171 (51%), Gaps = 20/171 (11%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGAD-----FLTKEVTIDDDKVATMQVW 63
            K++++GD G GKT+ + R++  ++ ++Y ATIG +     F T    I  D       W
Sbjct: 7   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNFGEIKFD------CW 60

Query: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123
           DTAGQE+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+
Sbjct: 61  DTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVL 115

Query: 124 LGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            GNKVD+ E K  V A       K   N   +  SAK + N +  F  +AR
Sbjct: 116 CGNKVDVKERK--VKAKTITFHRKK--NLQYYDISAKSNYNFEKPFLWLAR 162

>TPHA0K01060 Chr11 (219078..219719) [642 bp, 213 aa] {ON} Anc_6.90
           YLR293C
          Length = 213

 Score = 89.7 bits (221), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 88/171 (51%), Gaps = 20/171 (11%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGAD-----FLTKEVTIDDDKVATMQVW 63
            K++++GD G GKT+ + R++  ++ ++Y ATIG +     F T    I  D       W
Sbjct: 7   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNFGEIKFD------CW 60

Query: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123
           DTAGQE+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+
Sbjct: 61  DTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVL 115

Query: 124 LGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            GNKVD+ E K  V A       K   N   +  SAK + N +  F  +AR
Sbjct: 116 CGNKVDVKERK--VKAKTITFHRKK--NLQYYDISAKSNYNFEKPFLWLAR 162

>KNAG0F03180 Chr6 complement(598089..598973) [885 bp, 294 aa] {ON}
           Anc_6.90 YLR293C
          Length = 294

 Score = 91.3 bits (225), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 89/166 (53%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++     WDTAGQ
Sbjct: 88  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDCWDTAGQ 146

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 147 EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 201

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 202 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 243

>TBLA0E00980 Chr5 (224289..224954) [666 bp, 221 aa] {ON} Anc_6.90
           YLR293C
          Length = 221

 Score = 89.7 bits (221), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 89/166 (53%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++     WDTAGQ
Sbjct: 15  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDCWDTAGQ 73

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 74  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 128

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 129 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 170

>KAFR0A04800 Chr1 (954630..955289) [660 bp, 219 aa] {ON} Anc_6.90
           YLR293C
          Length = 219

 Score = 89.7 bits (221), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 89/166 (53%), Gaps = 10/166 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++     WDTAGQ
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDCWDTAGQ 71

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E+F  L   +Y  A C ++++DVT+  +++N+ +W  +      V   E  P V+ GNKV
Sbjct: 72  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 126

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           D+ E +KV +        K+L     +  SAK + N +  F  +AR
Sbjct: 127 DVKE-RKVKAKTITFHRKKNLQ---YYDISAKSNYNFEKPFLWLAR 168

>Kwal_14.2484 s14 complement(777938..778549) [612 bp, 203 aa] {ON}
           YOR089C (VPS21) - small GTP-binding protein;
           geranylgeranylated; geranylgeranylation required for
           membrane association; also involved in endocytosis post
           vesicle internalization [contig 224] FULL
          Length = 203

 Score = 89.0 bits (219), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 88/170 (51%), Gaps = 19/170 (11%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDD---KVATMQVWDT 65
           LK+++LG+S VGK++L+ R+    +  +  ATIGA F TK ++ + +   K    ++WDT
Sbjct: 10  LKLVLLGESSVGKSALVTRFTTGSF-HKSNATIGAAFTTKVISWETETARKEVKFEIWDT 68

Query: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILG 125
           AGQER+++L   +YR  D   +V+DVT   +     SW  E   +            ++G
Sbjct: 69  AGQERYRALTPMYYRNTDVAFVVFDVTEESTSLKADSWVQELKSYMEGEEAHNIVIKLIG 128

Query: 126 NKVD-IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           NK+D +DE              + +G TP+   SAK    + + FE +AR
Sbjct: 129 NKIDLLDEVP-----------PRKVGWTPV---SAKTGEGVADLFESVAR 164

>KLTH0G08294g Chr7 (678358..678921) [564 bp, 187 aa] {ON} highly
           similar to uniprot|P06781 Saccharomyces cerevisiae
           YNL090W RHO2 Non-essential small GTPase of the Rho/Rac
           subfamily of Ras-like proteins involved in the
           establishment of cell polarity and in microtubule
           assembly
          Length = 187

 Score = 87.8 bits (216), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 101/176 (57%), Gaps = 11/176 (6%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  +D  KV ++ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFALGKFPKEYHPTVFENYVT-DCRVDGIKV-SLALWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  A+  ++ + + +A+S  N ++ W +E L +     PE  P V++G K 
Sbjct: 67  EYERLRPFSYSKANVILIGFAIDDAESLLNARTKWTEEALRYC----PEA-PIVLVGLKR 121

Query: 129 DI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           D+   + + K V+   A+++A+++G       SA D   +D+ FE   R++L  N+
Sbjct: 122 DLRKSESSHKFVTREEAEQVARAIGAKKYMECSALDGSGVDDVFELATRTSLLVNK 177

>Skud_2.397 Chr2 complement(706771..707370) [600 bp, 199 aa] {ON}
           YBR264C (REAL)
          Length = 199

 Score = 87.8 bits (216), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 96/180 (53%), Gaps = 19/180 (10%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK--EVTIDD---DKVATMQVW 63
           +KV++LGDS VGKTS++ R  + K+  ++ ATIGA F+TK  EV   D   +K   M++W
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFVTKTIEVPCGDAAIEKRIHMEIW 64

Query: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123
           DTAGQER++SL   +YR A+  +LV+++ +  S     +W  +    A  +       ++
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALLVFELGDTASLRCAMTWFQDLQDRAQETQ-----VIL 119

Query: 124 LGNKVDI--DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           +GNK D+  +E  K V      ++   L   P    SAK   N   A  +I    + ++Q
Sbjct: 120 VGNKYDLVGEERSKEV------DIPAELQGLPYVPVSAKTGYNF-GALNDIVIRLVPEDQ 172

>Ecym_5365 Chr5 (743477..744046) [570 bp, 189 aa] {ON} similar to
           Ashbya gossypii ACL087C
          Length = 189

 Score = 87.4 bits (215), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 99/177 (55%), Gaps = 11/177 (6%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL+H +   K+ ++Y+ TI  +++T +  +D  +V  + +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLHVFTLGKFPEEYQPTIFENYVT-DCRVDGIRV-QLALWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
            ++ L    Y  AD  ++ + + +A+S  N    R+++ V A    P   P +++G K D
Sbjct: 67  EYERLRPMSYSKADIILIGFAIDDAESLLNA---REKWTVEALRYCPSA-PIILVGLKKD 122

Query: 130 IDETKKV-----VSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           + ++  +     V+ + AQE+AK++G       SA     +D+ FE   R++L  N+
Sbjct: 123 LRKSNSIDRAEMVNLSQAQEVAKAIGAKKYMECSALTGEGVDDVFELATRTSLLVNR 179

>KLLA0F01232g Chr6 complement(114430..115062) [633 bp, 210 aa] {ON}
           similar to uniprot|P36019 Saccharomyces cerevisiae
           YNL093W YPT53 Involved in vacuolar protein sorting and
           endocytosis GTP-binding protein of the rab family
          Length = 210

 Score = 87.0 bits (214), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 91/165 (55%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDD-----KVATMQVW 63
           +K+++LG+S VGK++++ R+   ++      TIGA F TK +   D      +    ++W
Sbjct: 10  VKLVLLGESSVGKSTIVTRFTTGEFHIN-SPTIGAAFSTKAMEWVDSEDGIKRRVNFEIW 68

Query: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123
           DTAGQER++SL   +YR  D  ++V+DVT   S +  +SW DE   +      +T    +
Sbjct: 69  DTAGQERYRSLAPMYYRNTDVALIVFDVTQLASEKKAQSWIDELNNYLEDYKKDTVQLRV 128

Query: 124 LGNKVDIDETKKVVSANAAQELAKSLGNT--PLFMTSAKDSINID 166
           +GNK+D+ + + + + N A+ ++   G     LF+   KD I ID
Sbjct: 129 VGNKIDLVDEETLQNWNDAELVSAKTGEGIDELFLKIGKD-IPID 172

>KAFR0J01240 Chr10 complement(229638..230201) [564 bp, 187 aa] {ON}
           Anc_2.200 YNL090W
          Length = 187

 Score = 86.3 bits (212), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 95/171 (55%), Gaps = 9/171 (5%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  +D  KV ++ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVT-DCRVDGIKV-SLALWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
            ++ L    Y  AD  ++ + V + +S EN    RD++ V A    PE  P +++G K D
Sbjct: 67  EYERLRPFSYSNADVILIAFAVDDVESLENT---RDKWAVEALRYCPEV-PIILVGLKKD 122

Query: 130 IDET---KKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSAL 177
           + +     ++V     Q++A+++G       SA     +D+ FE   R++L
Sbjct: 123 LRQANNKNRMVRPEDVQKIARAVGAKNYMECSALTGEGVDDVFEVATRTSL 173

>NDAI0F02560 Chr6 complement(629428..630000) [573 bp, 190 aa] {ON} 
          Length = 190

 Score = 85.9 bits (211), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 98/179 (54%), Gaps = 14/179 (7%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   ++ Q+Y  T+  +++T +  +D  KV ++ +WDTAGQE
Sbjct: 9   KLVIVGDGCCGKTSLLYVFTLGEFPQEYHPTVFENYVT-DCRVDGIKV-SLTLWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  AD  ++ + V + +S EN ++ W +E L +     P+  P +++G K 
Sbjct: 67  EYERLRPFSYSNADIILVGFAVDDIESLENARTKWAEEVLRYC----PDA-PIILVGLKG 121

Query: 129 DIDE------TKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           D+ E       KK+V    AQ +A+ +G       SA     +D+ FE   R++L  N+
Sbjct: 122 DLREQGNGTSNKKMVRPEDAQHVARLVGAKKYLECSALTGAGVDDVFELATRTSLLVNK 180

>NDAI0B04180 Chr2 (1055285..1056274) [990 bp, 329 aa] {ON} Anc_2.182
          Length = 329

 Score = 88.2 bits (217), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 100/176 (56%), Gaps = 9/176 (5%)

Query: 1   MSSRKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVA 58
           MS  K NI   K++++G  GVGK++L  + ++  +  +Y  TI  D   K+V IDD KV 
Sbjct: 1   MSLNKSNIREFKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTI-EDSYRKQVVIDD-KVT 58

Query: 59  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPET 118
            + V DTAGQE + ++   + R  +  VLVY +T+  SFE + ++  +      V   + 
Sbjct: 59  VLDVLDTAGQEEYSAMREQYMRTGEGFVLVYSITSKNSFEELMTYYQQI---QRVKDSDY 115

Query: 119 FPFVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            P VI+GNK D+++ ++ VS  A   LAK + N P   TSAK +IN++ AF  + R
Sbjct: 116 IPVVIVGNKSDLEDERQ-VSYQAGVNLAKQM-NAPFLETSAKQAINVEEAFYTLVR 169

>ZYRO0C15466g Chr3 complement(1208350..1208919) [570 bp, 189 aa]
           {ON} highly similar to uniprot|P06781 Saccharomyces
           cerevisiae YNL090W RHO2 Non-essential small GTPase of
           the Rho/Rac subfamily of Ras-like proteins involved in
           the establishment of cell polarity and in microtubule
           assembly
          Length = 189

 Score = 85.5 bits (210), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/178 (30%), Positives = 99/178 (55%), Gaps = 13/178 (7%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   ++ Q+Y  T+  +++T +  +D  KV T+ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFALGQFPQEYHPTVFENYVT-DCRVDGIKV-TLTLWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  AD  ++ + V + +S  N K+ W +E L       P+  P +++G K 
Sbjct: 67  EYERLRPFSYANADILLMGFAVDDPESLLNSKTKWAEEALRFC----PDA-PIILVGLKK 121

Query: 129 DIDETK-----KVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           D+ + K     ++VS + AQ++A+ +G       SA     +D+ FE   R++L  N+
Sbjct: 122 DLRQIKGSLQNELVSIDEAQQVARHIGAKKYLECSALTGDGVDDVFEIATRTSLLVNK 179

>Kpol_1029.8 s1029 complement(15899..16816) [918 bp, 305 aa] {ON}
           complement(15899..16816) [918 nt, 306 aa]
          Length = 305

 Score = 87.4 bits (215), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 85/154 (55%), Gaps = 7/154 (4%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQERFQSLGVAFYR 80
           K++L  + +  ++  +Y  TI  D   K++ +DD  VA + + DTAGQE + ++   + R
Sbjct: 23  KSALTIQLIQSQFVDEYDPTI-EDSYRKQIVLDD-SVAILDILDTAGQEEYSAMREQYMR 80

Query: 81  GADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVDIDETKKVVSAN 140
             +  +LVY VT+  S+E + S+  +      V   E  P V++GNK D+ ET++ VS  
Sbjct: 81  TGEGFLLVYSVTSRNSYEELMSYYQQI---QRVKDTEYIPVVVVGNKSDL-ETERQVSYE 136

Query: 141 AAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
               LAK + N P   TSAK  IN+ +AF  +AR
Sbjct: 137 EGMSLAKQM-NAPFLETSAKQDINVQDAFYNLAR 169

>TDEL0F02770 Chr6 complement(507090..507806) [717 bp, 238 aa] {ON}
           Anc_4.73 YGR152C
          Length = 238

 Score = 86.3 bits (212), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 90/169 (53%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K V ID+ KVA +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDSYDPTI-EDSYRKTVEIDN-KVADLEILDTAGVA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S E +   R++ L    +      P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELLDLREQVL---RIKDMNRVPMVLVGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           + + ++V+S     E++   G  P + TSA    N+D  F ++ R  ++
Sbjct: 120 LKD-ERVISVEEGIEVSSDWGKVPFYETSALLRSNVDEVFIDLVRQIIR 167

>KLLA0C13816g Chr3 (1183412..1183975) [564 bp, 187 aa] {ON} highly
           similar to uniprot|P06781 Saccharomyces cerevisiae
           YNL090W RHO2 Non-essential small GTPase of the Rho/Rac
           subfamily of Ras-like proteins involved in the
           establishment of cell polarity and in microtubule
           assembly
          Length = 187

 Score = 84.7 bits (208), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 99/176 (56%), Gaps = 11/176 (6%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   ++ ++Y  T+  +++T +  +D  KV  + +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPEEYHPTVFENYVT-DCRVDGIKV-QLTLWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  AD  ++ + + + +S  N ++ W +E L +     PE  P V++G K 
Sbjct: 67  EYERLRPFSYSKADIILIGFAIDDPESLVNARNKWSEEVLRYC----PEA-PVVLVGLKK 121

Query: 129 DI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           D+   D   ++V+   A+++A+++G       SA    N+D+ FE   R++L  N+
Sbjct: 122 DLRSPDNEHQMVTREQAEQVARAIGAKKYMECSALTGENVDDVFEVATRTSLLVNK 177

>NCAS0G02730 Chr7 (491357..491920) [564 bp, 187 aa] {ON} 
          Length = 187

 Score = 84.3 bits (207), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 99/176 (56%), Gaps = 11/176 (6%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   K+ Q+Y  T+  +++T +  +D  KV ++ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPQEYHPTVFENYVT-DCRVDGIKV-SLTLWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  AD  ++ + + + +S +N ++ W +E L +     PE  P +++G K 
Sbjct: 67  EYERLRPFSYSKADIILIGFAINDTESLDNARNKWTEEALRYC----PEA-PIILVGLKK 121

Query: 129 DIDETK---KVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           D+ + +   ++V    AQ++A+ +G       SA     +D+ FE   R++L  N+
Sbjct: 122 DLRQKQDGVEMVKPEDAQQVARIIGAKKYVECSALTGEGVDDVFELATRTSLLVNK 177

>CAGL0B04521g Chr2 complement(439732..440751) [1020 bp, 339 aa] {ON}
           similar to uniprot|P01120 Saccharomyces cerevisiae
           YNL098c RAS2 GTP-binding protein or uniprot|P01119
           Saccharomyces cerevisiae YOR101w RAS1
          Length = 339

 Score = 87.0 bits (214), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 86/154 (55%), Gaps = 7/154 (4%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQERFQSLGVAFYR 80
           K++L  + V+  +  +Y  TI  D   K+V IDD KV  + + DTAGQE + ++   + R
Sbjct: 21  KSALTIQLVHSHFVDEYDPTI-EDSYRKQVVIDD-KVTILDILDTAGQEEYSAMREQYMR 78

Query: 81  GADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVDIDETKKVVSAN 140
             +  +LVY VT+  SFE + ++  +      V   E  P V++GNK D+ ET++ VS  
Sbjct: 79  TGEGFLLVYSVTSRTSFEELITYYQQI---QRVKDVEYIPVVVVGNKSDL-ETERQVSFE 134

Query: 141 AAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
               LAK L N P   TSAK +IN+++AF  + R
Sbjct: 135 EGASLAKQL-NAPFLETSAKQAINVEDAFYTLVR 167

>ZYRO0G07018g Chr7 complement(559273..560025) [753 bp, 250 aa] {ON}
           similar to uniprot|P13856 Saccharomyces cerevisiae
           YGR152C RSR1 GTP-binding protein of the ras superfamily
           required for bud site selection, morphological changes
           in response to mating pheromone, and efficient cell
           fusion; localized to the plasma membrane; significantly
           similar to mammalian Rap GTPases
          Length = 250

 Score = 85.5 bits (210), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 91/169 (53%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + ID+ KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDN-KVFDLEILDTAGVA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S E +   R++ L   +VS     P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELLDLREQVLRIKDVSR---VPMVLVGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           + + ++VVS     E++   G  P + TSA    N+D  F ++ R  ++
Sbjct: 120 LGD-ERVVSVEEGIEVSSKWGKVPFYETSALLRSNVDEVFVDLVRQIMR 167

>YOR101W Chr15 (515244..516173) [930 bp, 309 aa] {ON}  RAS1GTPase
           involved in G-protein signaling in the adenylate cyclase
           activating pathway, plays a role in cell proliferation;
           localized to the plasma membrane; homolog of mammalian
           RAS proto-oncogenes
          Length = 309

 Score = 86.3 bits (212), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 86/154 (55%), Gaps = 7/154 (4%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQERFQSLGVAFYR 80
           K++L  +++   +  +Y  TI  D   K+V IDD KV+ + + DTAGQE + ++   + R
Sbjct: 23  KSALTIQFIQSYFVDEYDPTI-EDSYRKQVVIDD-KVSILDILDTAGQEEYSAMREQYMR 80

Query: 81  GADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVDIDETKKVVSAN 140
             +  +LVY VT+  SF+ + S+  +      V   +  P V++GNK+D+ E ++ VS  
Sbjct: 81  TGEGFLLVYSVTSRNSFDELLSYYQQI---QRVKDSDYIPVVVVGNKLDL-ENERQVSYE 136

Query: 141 AAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
               LAK L N P   TSAK +IN+D AF  + R
Sbjct: 137 DGLRLAKQL-NAPFLETSAKQAINVDEAFYSLIR 169

>Suva_14.250 Chr14 (455251..455829) [579 bp, 192 aa] {ON} YNL090W
           (REAL)
          Length = 192

 Score = 84.0 bits (206), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 98/177 (55%), Gaps = 16/177 (9%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   K+ +QY  T+  +++T +  +D  KV ++ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVT-DCRVDGIKV-SLTLWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  AD  ++ + V N++S  N ++ W DE L +     P+  P V++G K 
Sbjct: 67  EYERLRPFSYSKADIILIGFAVDNSESLINARTKWADEALRYC----PDA-PIVLVGLKK 121

Query: 129 DIDE--------TKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSAL 177
           D+ +          ++V A  A+++A+++G       SA     +D+ FE   R++L
Sbjct: 122 DLRQEAHFKENAVDEMVPAEDAKQVARAIGAKKYMECSALTGEGVDDVFEVATRTSL 178

>Suva_7.443 Chr7 complement(764401..765216) [816 bp, 271 aa] {ON}
           YGR152C (REAL)
          Length = 271

 Score = 85.1 bits (209), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 90/169 (53%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + ID+ KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDN-KVFDLEILDTAGIA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S E +   R++ L    +   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLIGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           ++  ++V+S     E++   G  P + TSA    N+D  F ++ R  ++
Sbjct: 120 LN-NERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIR 167

>SAKL0E09834g Chr5 complement(819736..820308) [573 bp, 190 aa] {ON}
           highly similar to uniprot|P06781 Saccharomyces
           cerevisiae YNL090W RHO2 Non-essential small GTPase of
           the Rho/Rac subfamily of Ras-like proteins involved in
           the establishment of cell polarity and in microtubule
           assembly
          Length = 190

 Score = 83.6 bits (205), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 100/177 (56%), Gaps = 12/177 (6%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  +D  KV  + +WDTAGQE
Sbjct: 11  KLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVT-DCRVDGIKV-QLALWDTAGQE 68

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  A+  ++ + + + +S  N ++ W +E L +       T P V++G K 
Sbjct: 69  EYERLRPFSYSKANIILIGFAIDDPESLMNARTKWTEEALRYC-----PTAPIVLVGLKK 123

Query: 129 DIDET----KKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           D+ ++    ++VV+  AA+++A+++G       SA     +D+ FE   R++L  N+
Sbjct: 124 DLRKSVGNGEEVVTREAAEQVARAIGAKRYMECSALTGEGVDDIFEVATRTSLLVNK 180

>TDEL0C04630 Chr3 complement(837302..837877) [576 bp, 191 aa] {ON}
           Anc_2.200 YNL090W
          Length = 191

 Score = 83.2 bits (204), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 98/180 (54%), Gaps = 15/180 (8%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  +D  KV ++ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVT-DCRVDGIKV-SLTLWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  AD  ++ + V + +S  N ++ W +E L +     P+  P +++G K 
Sbjct: 67  EYERLRPFSYSKADIILIGFAVDDPESLINARTKWAEEALRYC----PDA-PIILVGLKK 121

Query: 129 DIDET-------KKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           D+  +       +K VS   AQ++AK +G       SA     +D+ FE   R++L  N+
Sbjct: 122 DLRRSHEENAQGEKFVSLADAQQIAKQIGAKKYLECSALSGEGVDDVFELATRTSLLVNK 181

>KNAG0M01830 Chr13 complement(339904..340464) [561 bp, 186 aa] {ON} 
          Length = 186

 Score = 82.8 bits (203), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 93/171 (54%), Gaps = 10/171 (5%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   ++ Q+Y+ T+  +++T +  +D  KV  + +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPQEYQPTVFENYVT-DCRVDGIKV-MLALWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIK-SWRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  AD  V+ + V +  S EN +  W  E   +     P+  P V++G K 
Sbjct: 67  EYERLRPFSYSKADIIVIGFAVDDEDSLENARDKWAQEVFRYC----PDA-PIVLVGLKN 121

Query: 129 DIDET--KKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSAL 177
           D+      K+VS   A+++A+++G       SA     +D+ FE   R++L
Sbjct: 122 DLRNNVDAKLVSPQMAEQVARAIGAKKYMECSALTGEGVDDVFEVATRTSL 172

>Skud_15.266 Chr15 (471563..472504) [942 bp, 313 aa] {ON} YOR101W
           (REAL)
          Length = 313

 Score = 85.1 bits (209), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 85/154 (55%), Gaps = 7/154 (4%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQERFQSLGVAFYR 80
           K++L  + +   +  +Y  TI  D   K+V IDD KV+ + + DTAGQE + ++   + R
Sbjct: 23  KSALTIQLIQSYFVDEYDPTI-EDSYRKQVVIDD-KVSILDILDTAGQEEYSAMREQYMR 80

Query: 81  GADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVDIDETKKVVSAN 140
             +  +LVY VT+  SF+ + S+  +      V   +  P V++GNK+D+ E ++ VS  
Sbjct: 81  TGEGFLLVYSVTSRNSFDELLSYYQQI---QRVKDSDYIPVVVVGNKLDL-ENERQVSYE 136

Query: 141 AAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
               LAK L N P   TSAK +IN+D AF  + R
Sbjct: 137 DGLRLAKQL-NAPFLETSAKQAINVDEAFYSLIR 169

>NDAI0D03820 Chr4 complement(908209..909015) [807 bp, 268 aa] {ON}
           Anc_4.73
          Length = 268

 Score = 84.3 bits (207), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 91/169 (53%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + ID+ KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDN-KVFDLEILDTAGVA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S + +   R++ L    +      P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLDELMELREQVL---RIKDSSKVPMVLVGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           +++ ++V+S     E++ + G  P + TSA    N+D  F ++ R  ++
Sbjct: 120 LND-ERVISVEEGIEVSSTWGKVPFYETSALLRSNVDEVFVDLVRQIMR 167

>Kwal_14.2244 s14 (671441..672175) [735 bp, 244 aa] {ON} YGR152C
           (RSR1) - GTP-binding protein, ras superfamily [contig
           227] FULL
          Length = 244

 Score = 84.0 bits (206), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 89/169 (52%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + ID+ KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTMEIDN-KVFDLEILDTAGVA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S E +   R++ L    +      P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVL---RIKDNSRVPMVLVGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           + + ++V+S     E++   G  P + TSA    N+D  F ++ R  ++
Sbjct: 120 LQD-ERVISVEEGIEMSSKWGKVPFYETSALLRSNVDEVFVDVVRQIIR 167

>YNL090W Chr14 (456565..457143) [579 bp, 192 aa] {ON}
           RHO2Non-essential small GTPase of the Rho/Rac subfamily
           of Ras-like proteins, involved in the establishment of
           cell polarity and in microtubule assembly
          Length = 192

 Score = 82.4 bits (202), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 97/177 (54%), Gaps = 16/177 (9%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   K+ +QY  T+  +++T +  +D  KV ++ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVT-DCRVDGIKV-SLTLWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  AD  ++ + V N +S  N ++ W DE L +     P+  P V++G K 
Sbjct: 67  EYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYC----PDA-PIVLVGLKK 121

Query: 129 DIDE--------TKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSAL 177
           D+ +        T ++V    A+++A+++G       SA     +D+ FE   R++L
Sbjct: 122 DLRQEAHFKENATDEMVPIEDAKQVARAIGAKKYMECSALTGEGVDDVFEVATRTSL 178

>KAFR0F03670 Chr6 complement(726736..727527) [792 bp, 263 aa] {ON}
           Anc_4.73 YGR152C
          Length = 263

 Score = 84.0 bits (206), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 90/169 (53%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + ID+ KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDN-KVFDLEILDTAGVA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S + +   R++ L    +   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDQRSLDELMELREQVL---RIKDSDKVPMVLVGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           + + ++V+S     E++   G  P + TSA    N+D  F ++ R  ++
Sbjct: 120 LTD-ERVISVEDGIEISSKWGKVPFYETSALLRSNVDEVFVDVVRQIIR 167

>ACL087C Chr3 complement(191573..192136) [564 bp, 187 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL090W
           (RHO2)
          Length = 187

 Score = 82.0 bits (201), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 93/175 (53%), Gaps = 9/175 (5%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL+H +   K+ ++Y  T+  +++T +  +D  KV  + +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLHVFTLGKFPEEYLPTVFENYVT-DCRVDGIKV-QLALWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
            ++ L    Y  AD  ++ + + +  S  N    R+++ V A    P   P +++G K D
Sbjct: 67  EYERLRPMSYSKADIILIGFAIDDPGSLSNA---REKWTVEALRYCPNA-PIILVGLKKD 122

Query: 130 IDETK---KVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181
           +        +V+ + AQE+ +++G       SA     +D+ FE   R++L  N+
Sbjct: 123 LRRPGTQCAMVAPSQAQEVVRAIGAKKYMECSALTGEGVDDVFELATRTSLLVNK 177

>Smik_15.281 Chr15 (476294..477232) [939 bp, 312 aa] {ON} YOR101W
           (REAL)
          Length = 312

 Score = 84.3 bits (207), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 85/154 (55%), Gaps = 7/154 (4%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQERFQSLGVAFYR 80
           K++L  + +   +  +Y  TI  D   K+V IDD KV+ + + DTAGQE + ++   + R
Sbjct: 23  KSALTIQLIQSYFVDEYDPTI-EDSYRKQVVIDD-KVSILDILDTAGQEEYSAMREQYMR 80

Query: 81  GADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVDIDETKKVVSAN 140
             +  +LVY VT+  SF+ + S+  +      V   +  P V++GNK+D+ E ++ VS  
Sbjct: 81  TGEGFLLVYSVTSRNSFDELLSYYQQI---QRVKDSDYIPVVVVGNKLDL-ENERQVSYE 136

Query: 141 AAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
               LAK L N P   TSAK +IN+D AF  + R
Sbjct: 137 DGLRLAKQL-NAPFLETSAKQAINVDEAFYSLIR 169

>Smik_6.257 Chr6 complement(414005..414820) [816 bp, 271 aa] {ON}
           YGR152C (REAL)
          Length = 271

 Score = 83.6 bits (205), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 89/169 (52%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + ID+ KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDN-KVFDLEILDTAGIA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S E +   R++ L    +   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLIGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           +   ++V+S     E++   G  P + TSA    N+D  F ++ R  ++
Sbjct: 120 LI-NERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIR 167

>NCAS0A01890 Chr1 complement(364746..365561) [816 bp, 271 aa] {ON}
           Anc_4.73
          Length = 271

 Score = 83.6 bits (205), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 89/169 (52%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + ID+ KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGIYLDTYDPTI-EDSYRKTIEIDN-KVFDLEILDTAGVA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S + +   R++ L    +   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDPQSLDELMELREQVL---RIKDTDRVPMVLVGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           + E  +V+S     E++   G  P + TSA    N+D  F ++ R  ++
Sbjct: 120 LTE-DRVISVEEGIEVSSKWGKVPFYETSALLRSNVDEVFVDLVRQIIR 167

>Smik_14.237 Chr14 (436872..437450) [579 bp, 192 aa] {ON} YNL090W
           (REAL)
          Length = 192

 Score = 81.6 bits (200), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 96/177 (54%), Gaps = 16/177 (9%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   K+ +QY  T+  +++T +  +D  KV ++ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVT-DCRVDGIKV-SLTLWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  AD  ++ + V N +S  N ++ W DE L +     P+  P V++G K 
Sbjct: 67  EYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYC----PDA-PIVLVGLKK 121

Query: 129 DI--------DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSAL 177
           D+        D   ++V  + A+++A ++G       SA     +D+ FE   R++L
Sbjct: 122 DLRQEAHFKEDAVDEMVPIDDAKQVASAIGAKKYMECSALTGEGVDDVFEVATRTSL 178

>YGR152C Chr7 complement(794674..795492) [819 bp, 272 aa] {ON}
           RSR1GTP-binding protein of the ras superfamily required
           for bud site selection, morphological changes in
           response to mating pheromone, and efficient cell fusion;
           localized to the plasma membrane; significantly similar
           to mammalian Rap GTPases
          Length = 272

 Score = 83.6 bits (205), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 89/169 (52%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + ID+ KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDN-KVFDLEILDTAGIA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S E +   R++ L    +   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLIGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           +   ++V+S     E++   G  P + TSA    N+D  F ++ R  ++
Sbjct: 120 LI-NERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIR 167

>Skud_7.476 Chr7 complement(778308..779126) [819 bp, 272 aa] {ON}
           YGR152C (REAL)
          Length = 272

 Score = 83.2 bits (204), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 89/169 (52%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + ID+ KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDN-KVFDLEILDTAGIA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S E +   R++ L    +   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLIGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           +   ++++S     E++   G  P + TSA    N+D  F ++ R  ++
Sbjct: 120 LI-NERIISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIR 167

>Suva_8.155 Chr8 (272370..273320) [951 bp, 316 aa] {ON} YOR101W
           (REAL)
          Length = 316

 Score = 83.6 bits (205), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 85/154 (55%), Gaps = 7/154 (4%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQERFQSLGVAFYR 80
           K++L  + +   +  +Y  TI  D   K+V IDD KV+ + + DTAGQE + ++   + R
Sbjct: 23  KSALTIQLIQSYFVDEYDPTI-EDSYRKQVVIDD-KVSILDILDTAGQEEYSAMREQYMR 80

Query: 81  GADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVDIDETKKVVSAN 140
             +  +LVY VT+  SF+ + S+  +      V   +  P V++GNK+D+ E ++ VS  
Sbjct: 81  TGEGFLLVYSVTSRNSFDELLSYYQQI---QRVKDSDYIPVVVVGNKLDL-ENERQVSYE 136

Query: 141 AAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
               LAK L N P   TSAK +IN+D AF  + R
Sbjct: 137 DGLRLAKQL-NAPFLETSAKQAINVDEAFYGLIR 169

>TPHA0P00920 Chr16 complement(185904..186470) [567 bp, 188 aa] {ON}
           Anc_2.200 YNL090W
          Length = 188

 Score = 81.3 bits (199), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 95/174 (54%), Gaps = 13/174 (7%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++++   K+ +QY  T+  +++T +  +D  KV+ + +WDTAGQE
Sbjct: 8   KLVIIGDGACGKTSLLYKFTLGKFPEQYHPTVFENYVT-DCFVDGIKVS-LTLWDTAGQE 65

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  AD  ++ + V + +S  N ++ W +E L +     P+T   +++G K 
Sbjct: 66  EYERLRPFSYSKADIILIGFAVDDVESLHNARTKWTEEVLRYC----PDT-KIILVGLKS 120

Query: 129 DIDETKK-----VVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSAL 177
           D+ +T +      V    A+++A+ +G       SA     +D  FE   R++L
Sbjct: 121 DLRKTAQDYEEGFVKREDAEQVARQIGAKKYLECSALTGQGVDTVFELATRTSL 174

>KLTH0H09042g Chr8 (776732..777460) [729 bp, 242 aa] {ON} similar to
           uniprot|P13856 Saccharomyces cerevisiae YGR152C RSR1
           GTP-binding protein of the ras superfamily required for
           bud site selection, morphological changes in response to
           mating pheromone, and efficient cell fusion; localized
           to the plasma membrane; significantly similar to
           mammalian Rap GTPases
          Length = 242

 Score = 82.4 bits (202), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 89/169 (52%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + ID+ KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTMEIDN-KVFDLEILDTAGVA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S E +   R++ L    +      P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVL---RIKDSTRVPMVLVGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           + + ++V+S     E++ + G  P + TSA    N+D  F +  R  ++
Sbjct: 120 LQD-ERVISVEEGIEMSSNWGKVPFYETSALLRSNVDEVFVDAVRQIIR 167

>NCAS0B06850 Chr2 (1305199..1306173) [975 bp, 324 aa] {ON} Anc_2.182
          Length = 324

 Score = 83.6 bits (205), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 99/176 (56%), Gaps = 9/176 (5%)

Query: 1   MSSRKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVA 58
           MS  K NI   K++++G  GVGK++L  + ++  +  +Y  TI  D   K+V IDD KV 
Sbjct: 1   MSLNKSNIREYKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTI-EDSYRKQVVIDD-KVT 58

Query: 59  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPET 118
            + V DTAGQE + ++   + R  +  +LVY VT+  SFE + ++  +      V   + 
Sbjct: 59  VLDVLDTAGQEEYSAMREQYMRTGEGFLLVYSVTSKNSFEELLTYYQQI---QRVKDSDY 115

Query: 119 FPFVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            P VI+GNK D+++ ++V   +    LAK + N P   TSAK +IN++ AF  + R
Sbjct: 116 IPVVIVGNKSDLEDERQVPYQSGV-NLAKQM-NAPFLETSAKQAINVEEAFYTLVR 169

>YKR055W Chr11 (548216..549091) [876 bp, 291 aa] {ON}
           RHO4Non-essential small GTPase of the Rho/Rac subfamily
           of Ras-like proteins, likely to be involved in the
           establishment of cell polarity
          Length = 291

 Score = 82.8 bits (203), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 86/172 (50%), Gaps = 8/172 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           LK++++GD  VGKT L+  YV   +   Y  TI  +++T  +   + ++  + +WDTAGQ
Sbjct: 73  LKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTN-IEGPNGQIIELALWDTAGQ 131

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E +  L    Y  AD  ++ Y V +  S +N++   D +        P T P +++G K 
Sbjct: 132 EEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVE---DLWFPEVKHFCPST-PIMLVGLKS 187

Query: 129 DI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSAL 177
           D+   D    +V  ++A+ LAK LG       SA+   NID  FE    + L
Sbjct: 188 DLYEADNLSDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLL 239

>TPHA0B03000 Chr2 complement(683258..684175) [918 bp, 305 aa] {ON}
           Anc_2.182 YNL098C
          Length = 305

 Score = 82.8 bits (203), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 86/154 (55%), Gaps = 7/154 (4%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQERFQSLGVAFYR 80
           K++L  + +   +  +Y  TI  D   K++ +D+D V+ + + DTAGQE + ++   + R
Sbjct: 22  KSALTIQLIQSHFVDEYDPTI-EDSYRKQIVLDND-VSILDILDTAGQEEYSAMREQYMR 79

Query: 81  GADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVDIDETKKVVSAN 140
             +  +LVY VT+  S+E + ++  +      V   +  P V++GNK D+ ET++ VS  
Sbjct: 80  TGEGFLLVYSVTSRNSYEELLNYYQQI---QRVKDADYIPIVVVGNKSDL-ETERQVSYE 135

Query: 141 AAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
               LAK +   P F TSAK  IN+ +AF E++R
Sbjct: 136 EGMNLAKHM-TAPFFETSAKQDINVQDAFYELSR 168

>ZYRO0E03608g Chr5 complement(279670..280272) [603 bp, 200 aa] {ON}
           similar to uniprot|P25378 Saccharomyces cerevisiae
           YCR027C RHB1 Putative Rheb-related GTPase involved in
           regulating canavanine resistance and arginine uptake
           member of the Ras superfamily of G-proteins
          Length = 200

 Score = 80.9 bits (198), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 91/179 (50%), Gaps = 14/179 (7%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+ +LG   VGKT+L  R+V + + + Y  TI  DF TK V    +   T+++ DTAGQ+
Sbjct: 11  KIAVLGARNVGKTTLTVRFVEEHFVESYYPTIENDF-TKIVQFKGNNY-TLEILDTAGQD 68

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
            F  L      G    VL Y V+N  SFE I    D+ +   +    +  P V++ NK+D
Sbjct: 69  EFSLLNAKSLIGVKGIVLCYSVSNRPSFELIPVVWDKLV---DQLGRDDLPCVVVANKID 125

Query: 130 IDE---TKKVVSANAAQELAKSLGNT------PLFMTSAKDSINIDNAFEEIARSALQQ 179
           + +   + + +S+   +ELAK++G+T           SAK  +N++ A+  +     QQ
Sbjct: 126 VRDSASSTEFISSQEGRELAKTIGSTDGKHKAGFVECSAKQDVNVEGAYRAVLEKMRQQ 184

>TBLA0B01750 Chr2 complement(392769..393890) [1122 bp, 373 aa] {ON}
           Anc_2.182 YNL098C
          Length = 373

 Score = 83.2 bits (204), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 86/154 (55%), Gaps = 7/154 (4%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQERFQSLGVAFYR 80
           K++L  R +   +  +Y  TI  D   K+V IDD KV  + + DTAGQE + ++   + R
Sbjct: 23  KSALTIRLIQSHFVDEYDPTI-EDSYRKQVVIDD-KVTILDILDTAGQEEYSAMREQYMR 80

Query: 81  GADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVDIDETKKVVSAN 140
             +  +LVY VT+  SFE + ++  +      V   +  P +++GNK D+ E ++ V+  
Sbjct: 81  TGEGFLLVYSVTSRNSFEELMNYYQQI---QRVKDTDYVPIMVVGNKSDL-EIERQVTFE 136

Query: 141 AAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
               +AK + N+P   TSAK++IN+++AF  + R
Sbjct: 137 EGMTMAKQM-NSPFLETSAKEAINVEDAFYNLVR 169

>SAKL0H20746g Chr8 (1817259..1818014) [756 bp, 251 aa] {ON} similar
           to uniprot|P13856 Saccharomyces cerevisiae YGR152C RSR1
           GTP-binding protein of the ras superfamily required for
           bud site selection, morphological changes in response to
           mating pheromone, and efficient cell fusion; localized
           to the plasma membrane; significantly similar to
           mammalian Rap GTPases
          Length = 251

 Score = 81.3 bits (199), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 88/165 (53%), Gaps = 6/165 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + ID+ KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTMEIDN-KVFDLEILDTAGVA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S E +   R++ L    +   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLVGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
           + + ++ +S N    ++ + G  P + TSA    N+D  F ++ R
Sbjct: 120 LQD-ERSISVNEGIGVSSNWGKVPFYETSALLRSNVDEVFIDLVR 163

>KAFR0J01970 Chr10 (379033..379989) [957 bp, 318 aa] {ON} Anc_2.182
           YNL098C
          Length = 318

 Score = 82.4 bits (202), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 99/176 (56%), Gaps = 9/176 (5%)

Query: 1   MSSRKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVA 58
           MS  K NI   K++++G  GVGK++L  + ++  +  +Y  TI  D   K+V ID+ KV 
Sbjct: 1   MSLNKSNIREYKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTI-EDSYRKQVVIDN-KVT 58

Query: 59  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPET 118
            + + DTAGQE + ++   + R  +  +LVY VT+  SFE + ++  +      V   + 
Sbjct: 59  ILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQI---QRVKDSDY 115

Query: 119 FPFVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            P VI+GNK D+++ ++ VS    Q +A  + N P   TSAK +IN++ AF  + R
Sbjct: 116 IPVVIVGNKSDLEDERQ-VSYEDGQHIATQM-NAPFLETSAKQAINVEEAFYSLVR 169

>Skud_14.241 Chr14 (446886..447464) [579 bp, 192 aa] {ON} YNL090W
           (REAL)
          Length = 192

 Score = 79.7 bits (195), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 96/181 (53%), Gaps = 16/181 (8%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  +D  KV ++ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPERYHPTVFENYVT-DCRVDGIKV-SLTLWDTAGQE 66

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  AD  ++ + V N +S  N ++ W DE L +     P+  P V++G K 
Sbjct: 67  EYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYC----PDA-PIVLVGLKR 121

Query: 129 DIDE--------TKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180
           D+ E           +V    A+++A+++G       SA     +D+ FE   R++L   
Sbjct: 122 DLREELHFKESAVDDMVPIEDAKQVARAIGAKKYMECSALTGEGVDDVFEVATRTSLLMK 181

Query: 181 Q 181
           +
Sbjct: 182 K 182

>TBLA0B01800 Chr2 complement(408546..409136) [591 bp, 196 aa] {ON}
           Anc_2.200 YNL090W
          Length = 196

 Score = 79.7 bits (195), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 91/173 (52%), Gaps = 12/173 (6%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K++I+GD   GKTSL+H +    + + Y  T+  +++T +  +D  KV ++ +WDTAGQE
Sbjct: 17  KLVIIGDGACGKTSLLHVFTLGTFPENYHPTVFENYVT-DCRVDGIKV-SLTLWDTAGQE 74

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNKV 128
            ++ L    Y  AD  ++ + V + +S EN K  W DE L +   +       +++G K 
Sbjct: 75  EYERLRPYSYTNADIILIGFAVNDQESLENAKGKWIDEVLRYCPGAR-----ILLVGLKK 129

Query: 129 DIDE----TKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSAL 177
           D+ +      ++V    AQ++AK +G       SA     +D+ FE   RS+L
Sbjct: 130 DLRKDVMNKDQLVKIEDAQQVAKIIGAKKYLECSALTGEGVDDVFELATRSSL 182

>Kpol_1026.12 s1026 complement(27073..28062) [990 bp, 329 aa] {ON}
           complement(27073..28062) [990 nt, 330 aa]
          Length = 329

 Score = 81.6 bits (200), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 90/169 (53%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + ID+ KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDN-KVFDLEILDTAGVA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S + +   R++ L    +      P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDKQSLDELLELREQVL---KIKDSSKVPMVLVGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           + + ++V+S     E++ + G  P + TSA    N+D  F ++ R  ++
Sbjct: 120 L-KNERVISVEDGIEVSSTWGKVPFYETSALLRSNVDEVFIDLVRQIIR 167

>AFR464W Chr6 (1274600..1275394) [795 bp, 264 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR152C (RSR1)
          Length = 264

 Score = 80.5 bits (197), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 88/169 (52%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V  +Y   Y  TI  D   K + IDD K   +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGEYLDTYDPTI-EDSYRKSMEIDD-KAFDLEILDTAGVA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S   +   R++ L    +   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLAELMELREQIL---RIKDSKRVPMVLVGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           + + ++ +S     +++   G  P + TSA    N+D  F ++ R  ++
Sbjct: 120 L-QNERAISVEEGIDVSSRWGKVPFYETSALLKSNVDEVFIDLVRQIMR 167

>YNL098C Chr14 complement(439602..440570) [969 bp, 322 aa] {ON}
           RAS2GTP-binding protein that regulates the nitrogen
           starvation response, sporulation, and filamentous
           growth; farnesylation and palmitoylation required for
           activity and localization to plasma membrane; homolog of
           mammalian Ras proto-oncogenes
          Length = 322

 Score = 80.5 bits (197), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 84/154 (54%), Gaps = 7/154 (4%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQERFQSLGVAFYR 80
           K++L  +     +  +Y  TI  D   K+V IDD+ V+ + + DTAGQE + ++   + R
Sbjct: 23  KSALTIQLTQSHFVDEYDPTI-EDSYRKQVVIDDE-VSILDILDTAGQEEYSAMREQYMR 80

Query: 81  GADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVDIDETKKVVSAN 140
             +  +LVY +T+  S + + ++  + L    V   +  P V++GNK D+ E +K VS  
Sbjct: 81  NGEGFLLVYSITSKSSLDELMTYYQQIL---RVKDTDYVPIVVVGNKSDL-ENEKQVSYQ 136

Query: 141 AAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
               +AK + N P   TSAK +IN++ AF  +AR
Sbjct: 137 DGLNMAKQM-NAPFLETSAKQAINVEEAFYTLAR 169

>Skud_11.291 Chr11 (529726..530601) [876 bp, 291 aa] {ON} YKR055W
           (REAL)
          Length = 291

 Score = 80.1 bits (196), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 81/172 (47%), Gaps = 8/172 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           LK++++GD  VGKT L+  YV   +   Y  TI  +++T  +     +V  + +WDTAGQ
Sbjct: 73  LKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTN-IEGPRGQVIELALWDTAGQ 131

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E +  L    Y  AD  ++ Y V N  S  N +   D +        P T P +++G K 
Sbjct: 132 EEYSRLRPLSYTNADVLMICYSVGNKTSLRNAE---DLWFPEVKHFCPST-PIMLVGLKS 187

Query: 129 DI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSAL 177
           D+   D    +V    A+ LAK LG       SA+   N++  FE    S L
Sbjct: 188 DLYEADNLSDLVEPTVAESLAKRLGAFSHVQCSARLKENVNEVFETAIHSLL 239

>Skud_14.232 Chr14 complement(429739..430710) [972 bp, 323 aa] {ON}
           YNL098C (REAL)
          Length = 323

 Score = 80.5 bits (197), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 84/154 (54%), Gaps = 7/154 (4%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQERFQSLGVAFYR 80
           K++L  +     +  +Y  TI  D   K+V IDD+ V+ + + DTAGQE + ++   + R
Sbjct: 23  KSALTIQLTQSHFVDEYDPTI-EDSYRKQVVIDDE-VSILDILDTAGQEEYSAMREQYMR 80

Query: 81  GADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVDIDETKKVVSAN 140
             +  +LVY +T+  S + + ++  + L    V   +  P V++GNK D+ E +K VS  
Sbjct: 81  NGEGFLLVYSITSKSSLDELMTYYQQIL---RVKDTDYVPIVVVGNKSDL-ENEKQVSYQ 136

Query: 141 AAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
               +AK + N P   TSAK +IN++ AF  +AR
Sbjct: 137 DGLNMAKQM-NAPFLETSAKQAINVEEAFYTLAR 169

>Ecym_1407 Chr1 (846135..846941) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AFR464W
          Length = 268

 Score = 79.7 bits (195), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 88/169 (52%), Gaps = 6/169 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQE 69
           K+++LG  GVGK+ L  ++V  +Y   Y  TI  D   K + IDD K   +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGEYLDTYDPTI-EDSYRKSMEIDD-KAFDLEILDTAGVA 62

Query: 70  RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVD 129
           +F ++   + +     +LVY VT+ +S   +   R++ L    +   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLGELMELREQIL---RIKDSKRVPMVLVGNKAD 119

Query: 130 IDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           + + ++V+S     +++   G  P + TSA    N+   F ++ R  ++
Sbjct: 120 LQQ-ERVISVEEGIDVSSRWGKVPFYETSALLKSNVHEVFIDLVRQIMR 167

>KLLA0C13387g Chr3 complement(1142002..1142841,1143162..1143176)
           [855 bp, 284 aa] {ON} similar to uniprot|P01120
           Saccharomyces cerevisiae YNL098C RAS2 GTP-binding
           protein that regulates the nitrogen starvation response,
           sporulation, and filamentous growth; farnesylation and
           palmitoylation required for activity and localization to
           plasma membrane; homolog of mammalian Ras
           proto-oncogenes
          Length = 284

 Score = 79.7 bits (195), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 98/176 (55%), Gaps = 9/176 (5%)

Query: 1   MSSRKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVA 58
           MS  K NI   K++++G  GVGK++L  + +   +  +Y  TI  D   K+  IDD KV+
Sbjct: 1   MSLNKSNIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKQAVIDD-KVS 58

Query: 59  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPET 118
            + + DTAGQE + ++   + R  +  +LVY VT+  SFE + ++  + L    V   + 
Sbjct: 59  ILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSKTSFEELMTYYQQIL---RVKDSDY 115

Query: 119 FPFVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
            P  ++GNK D+++ ++ VS    Q LAK   + P   TSAK +IN++ +F  + R
Sbjct: 116 VPVFVIGNKSDLEDERQ-VSYEEGQTLAKQF-DAPFLETSAKQNINVEESFYGLVR 169

>NDAI0B05400 Chr2 (1326549..1327436) [888 bp, 295 aa] {ON} Anc_1.215
          Length = 295

 Score = 80.1 bits (196), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 85/165 (51%), Gaps = 10/165 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           LK++++GD  VGKT L+  YVN+++   Y  T+  +++T  V + + +V  + +WDTAGQ
Sbjct: 73  LKIVVVGDGNVGKTCLLISYVNNEFPTDYIPTVFENYVT-SVNMPNREVIELALWDTAGQ 131

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WRDEFLVHANVSSPETFPFVILGNK 127
           E +  L    Y   D  ++ Y V N  S E+++  W  E       +     P +++G K
Sbjct: 132 EEYNRLRPLSYTDVDVLMVCYSVDNKTSLEHVEELWFPEVRHFCGKT-----PVMLIGLK 186

Query: 128 VDI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAF 169
            D+   D+ + +V    A+ +AK +G       SAK   N++  F
Sbjct: 187 SDLYAEDKGEGLVETKHAELIAKKMGAFVHLQCSAKSRDNVEEVF 231

>Kpol_520.36 s520 complement(90395..91072) [678 bp, 225 aa] {ON}
           complement(90395..91072) [678 nt, 226 aa]
          Length = 225

 Score = 78.6 bits (192), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 89/162 (54%), Gaps = 11/162 (6%)

Query: 13  ILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQERFQ 72
           ++GD+ VGKTSLM +YV + ++ +Y  T+G +FL ++V++    +    + D  GQ+ F 
Sbjct: 19  LVGDAQVGKTSLMVKYVQNIFNDEYTQTLGVNFLKRKVSVRSTDIV-FSILDLGGQKEFI 77

Query: 73  SLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNK----V 128
           ++      G+   + ++D+T  ++  +IK W  +    AN  + +  P +++G K    +
Sbjct: 78  NMLPIASIGSSAIIFLFDLTRPETLNSIKEWYRQ----ANGLNDQAIP-ILVGTKYDLFI 132

Query: 129 DIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFE 170
           D+D++ +   +  A + A+ + N PL  TS   SIN+   F+
Sbjct: 133 DLDQSTQEKISRIAMQYAQVM-NAPLIFTSTAKSINVQKIFK 173

>Suva_14.241 Chr14 complement(437053..438021) [969 bp, 322 aa] {ON}
           YNL098C (REAL)
          Length = 322

 Score = 80.1 bits (196), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 84/154 (54%), Gaps = 7/154 (4%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQERFQSLGVAFYR 80
           K++L  +     +  +Y  TI  D   K+V IDD+ V+ + + DTAGQE + ++   + R
Sbjct: 23  KSALTIQLTQSHFVDEYDPTI-EDSYRKQVVIDDE-VSILDILDTAGQEEYSAMREQYMR 80

Query: 81  GADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKVDIDETKKVVSAN 140
             +  +LVY +T+  S + + ++  + L    V   +  P V++GNK D+ E +K VS  
Sbjct: 81  NGEGFLLVYSITSKSSLDELMTYYQQIL---RVKDTDYVPIVVVGNKSDL-ENEKQVSYQ 136

Query: 141 AAQELAKSLGNTPLFMTSAKDSINIDNAFEEIAR 174
               +AK + N P   TSAK +IN++ AF  +AR
Sbjct: 137 DGLNMAKQM-NAPFLETSAKQAINVEEAFYTLAR 169

>ZYRO0D03146g Chr4 complement(244206..245039) [834 bp, 277 aa] {ON}
           similar to uniprot|Q00246 Saccharomyces cerevisiae
           YKR055W RHO4 Non-essential small GTPase of the Rho/Rac
           subfamily of Ras-like proteins likely to be involved in
           the establishment of cell polarity
          Length = 277

 Score = 79.3 bits (194), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 84/173 (48%), Gaps = 8/173 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68
           LK++++GD  VGKT L+  YV  ++   Y  T+  +++T+ +    +K+  + +WDTAGQ
Sbjct: 73  LKIVVVGDGAVGKTCLLISYVQRRFPTDYVPTVFENYVTR-IQGPQNKIIELALWDTAGQ 131

Query: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128
           E +  L    Y   D  ++ Y   N  S +N+    D +        P+  P +++G K 
Sbjct: 132 EEYSRLRPLSYSEVDILLVCYAANNPTSLQNVD---DLWFPEVTHFCPDV-PIMLVGLKS 187

Query: 129 DI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQ 178
           D+   D+T  +V    A+ LA  LG       SAK   N++  F     +AL 
Sbjct: 188 DLYANDDTSNLVDPREAESLALKLGAFSHIQCSAKTRNNVELVFTTAMDTALH 240

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.129    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,887,937
Number of extensions: 785224
Number of successful extensions: 4666
Number of sequences better than 10.0: 625
Number of HSP's gapped: 3964
Number of HSP's successfully gapped: 649
Length of query: 208
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 103
Effective length of database: 41,441,469
Effective search space: 4268471307
Effective search space used: 4268471307
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)