Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H008406.23ON36035017960.0
KNAG0D02240singletonON35931511251e-153
NDAI0D008306.23ON37431111181e-152
ZYRO0C07722g6.23ON37330811131e-151
KAFR0A050806.23ON31130110831e-148
CAGL0I08151gsingletonON38229810821e-147
CAGL0F01815gsingletonON31429610731e-146
TPHA0M002806.23ON30329810661e-145
TDEL0G044606.23ON36931310691e-145
SAKL0E01342g6.23ON34129810551e-143
NCAS0D021706.23ON31029610501e-143
KNAG0M011906.23ON38029210551e-143
Kpol_385.5singletonON30630010391e-141
KNAG0K01400singletonON30929210221e-139
Kpol_1061.27singletonON30630010191e-138
KAFR0G026806.23ON38331410231e-138
NDAI0C026206.23ON31129310151e-137
KLLA0D01243g6.23ON31129910101e-137
Kwal_56.224396.23ON3202949721e-131
KLTH0C11154g6.23ON3052919551e-128
TPHA0G012108.774ON49429731.7
TBLA0H028002.593ON48446703.4
Smik_14.1582.83ON50152677.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H00840
         (360 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   696   0.0  
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   437   e-153
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   435   e-152
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   433   e-151
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   421   e-148
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   421   e-147
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   417   e-146
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   415   e-145
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              416   e-145
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   410   e-143
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   409   e-143
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   410   e-143
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   404   e-141
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   398   e-139
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   397   e-138
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     398   e-138
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      395   e-137
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   393   e-137
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   379   e-131
KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   372   e-128
TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {O...    33   1.7  
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    32   3.4  
Smik_14.158 Chr14 complement(295273..296778) [1506 bp, 501 aa] {...    30   7.8  

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/350 (96%), Positives = 337/350 (96%)

Query: 11  VPPTGTFSVSLGKYXXXXXXXXXXXXXFQFKSPTVMDQVNEDSATAESQKERSILKHFIA 70
           VPPTGTFSVSLGKY             FQFKSPTVMDQVNEDSATAESQKERSILKHFIA
Sbjct: 11  VPPTGTFSVSLGKYILIAALVLVLTVVFQFKSPTVMDQVNEDSATAESQKERSILKHFIA 70

Query: 71  EEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQETITYVTGGILA 130
           EEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQETITYVTGGILA
Sbjct: 71  EEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQETITYVTGGILA 130

Query: 131 HEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDLPADLKNCEPRY 190
           HEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDLPADLKNCEPRY
Sbjct: 131 HEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDLPADLKNCEPRY 190

Query: 191 RNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNKAGTEFAQEIPP 250
           RNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNKAGTEFAQEIPP
Sbjct: 191 RNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNKAGTEFAQEIPP 250

Query: 251 DFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVIGGKILDQQVVQ 310
           DFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVIGGKILDQQVVQ
Sbjct: 251 DFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVIGGKILDQQVVQ 310

Query: 311 HGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQTAREWYS 360
           HGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQTAREWYS
Sbjct: 311 HGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQTAREWYS 360

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  437 bits (1125), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 244/315 (77%)

Query: 43  PTVMDQVNEDSATAESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDF 102
           PT  +  N D       K RSI  HFI  E +EG GA V+RSVGS Q  RF+PFLMLDDF
Sbjct: 42  PTRTNTTNNDYTMPSLFKLRSIANHFIPREVAEGVGARVKRSVGSMQQRRFTPFLMLDDF 101

Query: 103 KVTPPEGFPDHPHHGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPV 162
            V  P GFPDHPHHGQETITYV  G++AHEDFTGSKGVL PGDLQFMTAGKGIVH EMPV
Sbjct: 102 TVKSPSGFPDHPHHGQETITYVIDGLIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPV 161

Query: 163 TMNDSAVSTGLQFWVDLPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESV 222
            M D   + GLQ WVDLP DLKNCEPRYRNLR++ IPVV+ ++NL V+VISGKSY  ESV
Sbjct: 162 EMEDGRPARGLQLWVDLPKDLKNCEPRYRNLRSEDIPVVKPHENLEVRVISGKSYGTESV 221

Query: 223 KDLAYTPIDFYYFISNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDG 282
           KDLAYTPIDFYY +++KAGTEFAQEIP DFNAF+YV KG++ I E+VFK ++++FF TDG
Sbjct: 222 KDLAYTPIDFYYMLASKAGTEFAQEIPSDFNAFLYVMKGSVVINEKVFKQNTAIFFDTDG 281

Query: 283 NFIRGFTASDNTEFAVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGW 342
             + G   SD+TEFA+IGGKILDQ +VQHGPFVET +EKL E F NY     GFE+A GW
Sbjct: 282 EGVAGQAGSDDTEFAIIGGKILDQPLVQHGPFVETDQEKLYEAFMNYEGYTKGFERAKGW 341

Query: 343 KSSISNGIDEQTARE 357
           +S I++GI+E  A++
Sbjct: 342 RSDIASGINESEAKQ 356

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  435 bits (1118), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 206/311 (66%), Positives = 254/311 (81%), Gaps = 4/311 (1%)

Query: 49  VNEDSA-TAESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPP 107
           VNED A  A +   R+ILK+FI +EQSEG GA VRR++G+ +M RF PFLMLD FKVTPP
Sbjct: 59  VNEDIARIATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPP 118

Query: 108 E-GFPDHPHHGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMND 166
           E GFPDHPHHGQETITY+  G++AHEDFTGSKGVL PGDLQFMTAGKGIVH EMPV M D
Sbjct: 119 EQGFPDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKD 178

Query: 167 SAVSTGLQFWVDLPADLKNCEPRYRNLRADTIPVVQVND--NLNVKVISGKSYDVESVKD 224
                GLQ WVDLP +LKNCEPRYRNLR + IP+V  +D  ++ VKVISG +Y V+SV+D
Sbjct: 179 GRPGIGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRD 238

Query: 225 LAYTPIDFYYFISNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNF 284
           LAYTPI FY++IS+KAG EF Q +P DFN F+YV KGA+ I +++FK +++VFF  DG+ 
Sbjct: 239 LAYTPIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHS 298

Query: 285 IRGFTASDNTEFAVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKS 344
           I+G +A+++TEFA+IGGKILDQ +VQHGPFVETTRE L +VF+NY+ GINGFE+A+ W+S
Sbjct: 299 IKGQSATNDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRS 358

Query: 345 SISNGIDEQTA 355
           SI++GIDE TA
Sbjct: 359 SIADGIDEDTA 369

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  433 bits (1113), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 199/308 (64%), Positives = 245/308 (79%)

Query: 52  DSATAESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFP 111
           D   ++S   RS+LK+FIA EQ EG GA VRRS+G+ +M RF PFLMLDDF V PP GFP
Sbjct: 64  DGIMSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFP 123

Query: 112 DHPHHGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVST 171
           DHPHHGQETITY   G++AHEDFTGSKGVL+PGDLQFMTAGKGIVH E+PV++ D + S 
Sbjct: 124 DHPHHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASN 183

Query: 172 GLQFWVDLPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPID 231
           GLQ WVDLPA+LKNCEPRYR+LR    P V+VNDNL V+VISGKSY V+SV++LAYTP+ 
Sbjct: 184 GLQLWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVH 243

Query: 232 FYYFISNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTAS 291
           FY+FI++K GTEFAQE P DFN F Y+ KG++ + ++VF  HS+VFF TDG  + G + S
Sbjct: 244 FYHFITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVS 303

Query: 292 DNTEFAVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGID 351
           D+ EF +IGGKILDQ+V+QHGPFVET+RE++I+VF NY+ G+NGFE A  W S I+ GI 
Sbjct: 304 DDAEFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGIS 363

Query: 352 EQTAREWY 359
           E  AR+ Y
Sbjct: 364 EAEARKLY 371

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  421 bits (1083), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 194/301 (64%), Positives = 241/301 (80%)

Query: 53  SATAESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPD 112
           + T  +   R+I KHF+A EQ EG GA VRRSVGS +   F+PFL+LD F V+ P GFPD
Sbjct: 2   ATTENATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPD 61

Query: 113 HPHHGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTG 172
           HPHHGQETITYV  G++AHEDFTGSKG+L PGDLQFMTAGKGI+H E+PV M +     G
Sbjct: 62  HPHHGQETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVG 121

Query: 173 LQFWVDLPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDF 232
           LQ WVDLP ++K+CEPRYRNLR   IP+V+ N++L VKVISG+SY VESVK+LAYTP+DF
Sbjct: 122 LQLWVDLPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDF 181

Query: 233 YYFISNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASD 292
           Y+FISNK GT+F Q+ P +FN F+YV KG++ IG+E F  +S++FF  DGN I+G  + D
Sbjct: 182 YHFISNKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDD 241

Query: 293 NTEFAVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDE 352
           +TEFA+IGG ILDQ V+QHGPF+E+TREKLIEVF N++ GINGFE+A+GWKSSI NGI E
Sbjct: 242 DTEFAIIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILE 301

Query: 353 Q 353
           +
Sbjct: 302 K 302

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  421 bits (1082), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 196/298 (65%), Positives = 230/298 (77%)

Query: 62  RSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQETI 121
           RSIL HFIA EQ EG GA VRRSVG+YQM RF+PFLMLDDF V PP GFPDHPHHGQETI
Sbjct: 83  RSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDHPHHGQETI 142

Query: 122 TYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDLPA 181
           TYVT G++AHED TGSKGVL  GDLQFMTAGKGIVH E+PVT  D     GLQ WVDLP+
Sbjct: 143 TYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVDLPS 202

Query: 182 DLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNKAG 241
           D+KN +PRYRNLR +  PV   N+NL V+VISGKSY VES++DLAYTP+  Y+F++NK G
Sbjct: 203 DMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLYHFLANKTG 262

Query: 242 TEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVIGG 301
           TEF Q+IP DFN FIYV KG+I + +      SS FF  DGN IRG   S++ +FA+I G
Sbjct: 263 TEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSEDAQFAIIAG 322

Query: 302 KILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQTAREWY 359
           +ILDQ+V+QHGPFVET REKL+EVF NY+   NGFE A  W+SSI +GI E+ A + Y
Sbjct: 323 RILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEEALKLY 380

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  417 bits (1073), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 194/296 (65%), Positives = 237/296 (80%)

Query: 62  RSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQETI 121
           RSI KHF+  EQ EG GA VRRSVG+ +   FSPFLMLDDF V  P GFPDHPHHGQETI
Sbjct: 5   RSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHGQETI 64

Query: 122 TYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDLPA 181
           TYV  G++AHEDFTG+KGVL  GDLQFMTAGKGIVH E+PV M       GLQFWVDLP 
Sbjct: 65  TYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWVDLPK 124

Query: 182 DLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNKAG 241
           DLK CEPRYRNLR D IPVV+ N+NL VKVISGKSY V+SV+DLAYTPI  Y++++NKAG
Sbjct: 125 DLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLTNKAG 184

Query: 242 TEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVIGG 301
           T++ QE P +FN F+YV KG +++G++VF  H++VFF TDG+ ++G  A+D+ +FA++GG
Sbjct: 185 TQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFAIMGG 244

Query: 302 KILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQTARE 357
           +ILDQQ +QHGPFVET RE L++VF NY+ GINGFE+A GW+SSI +GI E+  RE
Sbjct: 245 QILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITEKQVRE 300

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  415 bits (1066), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 233/298 (78%)

Query: 58  SQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHG 117
           SQ  RSILKHFIA+EQ+EG GA VRRS+G+ +M +FSPFLMLD F V PP GFPDHPHHG
Sbjct: 2   SQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHG 61

Query: 118 QETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWV 177
           QETITYV  G++AHEDFTGSKG+L PGDLQFMTAGK + H EMPV M +  +  GLQ WV
Sbjct: 62  QETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWV 121

Query: 178 DLPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFIS 237
           DLP +LKN EPRYR+L  + IP+ + ++NL ++VISGKSY +ESVKDLAYTP+DFY + +
Sbjct: 122 DLPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKA 181

Query: 238 NKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFA 297
            K G+ F Q+   D+N F+Y+ KG++ IG EVF  HSS+FF TDG+ ++G   SD+TEFA
Sbjct: 182 RKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFA 241

Query: 298 VIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQTA 355
           +IGG+IL Q+ VQHGPFVE T EKL++VF NY +   GFE+AL W+SSI NGIDE  A
Sbjct: 242 IIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQA 299

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  416 bits (1069), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 245/313 (78%)

Query: 45  VMDQVNEDSATAESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKV 104
           + D +++    +++ + RSI+K+F+A +Q EG GATVRRS+G+ QM RFSPFLMLD F V
Sbjct: 48  ITDFISQSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTV 107

Query: 105 TPPEGFPDHPHHGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTM 164
           +PP GFPDHPHHGQETITY+ GG+LAHEDF+ SKG+L PGDLQFMTAGK I+H E+PV M
Sbjct: 108 SPPAGFPDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKM 167

Query: 165 NDSAVSTGLQFWVDLPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKD 224
           +    + GLQ WVDLP  LKNCEPRYR+L+A  IPV++ +++L V VISG SY V+S +D
Sbjct: 168 DSGQPAVGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARD 227

Query: 225 LAYTPIDFYYFISNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNF 284
           LAYTP+ +Y+F ++K GTEF QE P  FNAF+Y+ KG+I IGE++F   S+VFF TDG+ 
Sbjct: 228 LAYTPVHYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDA 287

Query: 285 IRGFTASDNTEFAVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKS 344
           + GF+ASDN EF +IGG+IL Q VVQHGPFVET RE+LIEVF NY+  INGF++   W+S
Sbjct: 288 VEGFSASDNAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRS 347

Query: 345 SISNGIDEQTARE 357
           +I+ GI E  A++
Sbjct: 348 TIAGGITESEAKK 360

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  410 bits (1055), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 187/298 (62%), Positives = 235/298 (78%)

Query: 60  KERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQE 119
           K R+I KHF+A EQSEG GA VRRS+G+ Q+  F+PFLMLD F VTPP GFPDHPHHGQE
Sbjct: 39  KVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQE 98

Query: 120 TITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDL 179
           TITYV GG++AHEDFTGSKGVL PGDLQFMTAGKGIVH E+PV M     + GLQ WVDL
Sbjct: 99  TITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDL 158

Query: 180 PADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNK 239
           P  LKNCEPRYR+LR    P+ + + NL V+VISG+SY V+S  +LAYTP+ FY+FIS+K
Sbjct: 159 PERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSK 218

Query: 240 AGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVI 299
            GT F Q+ P DFN F+YV KG++T+  + F  +S++FF+ DG  + G  ASD+TEFA++
Sbjct: 219 KGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALV 278

Query: 300 GGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQTARE 357
           GG IL+Q VVQHGPFVET++E++I+VF +Y+ G+NGFE+A  WKSSIS+GI +Q A +
Sbjct: 279 GGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEK 336

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  409 bits (1050), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 185/296 (62%), Positives = 236/296 (79%)

Query: 57  ESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHH 116
           +S + RS+LK F+A EQ EG GA VRRS+GS +   FSPFL++D+F V+ P GFPDHPHH
Sbjct: 3   KSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHH 62

Query: 117 GQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFW 176
           GQETITYV  G++AHEDFTGS+GVL PGDLQFMTAGK I+H E+PV MN+     G+Q W
Sbjct: 63  GQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLW 122

Query: 177 VDLPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFI 236
           VDLP  LKNCEPRYRNLRA  IP+V+ ND+L V+V+SGKSY VESVKDLAYTPID+Y+  
Sbjct: 123 VDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMN 182

Query: 237 SNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEF 296
           + K GTEF QE P DFN F+Y+ KG++ I + V   +S++FF+TDG+ I+G +AS++TEF
Sbjct: 183 TKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEF 242

Query: 297 AVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDE 352
            ++GG+ILDQ ++QHGPFVE+ RE L+EVF NY+  INGFE+A GW+S I++GI E
Sbjct: 243 VLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHE 298

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  410 bits (1055), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 190/292 (65%), Positives = 233/292 (79%)

Query: 62  RSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQETI 121
           R+I KHFIA EQ EG GA VRRSVGS +   FSPFL+LD F V+ P GFPDHPHHGQETI
Sbjct: 76  RTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQETI 135

Query: 122 TYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDLPA 181
           TYV  G++AHEDF GSKGVL PGDLQFMTAGKGI+H E+PV M +     GLQ WVDLP 
Sbjct: 136 TYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPK 195

Query: 182 DLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNKAG 241
           D+K+C PRYRNLR   IP+ + N++L +KVISGKS+ ++SVK+LAYTP+DFY++IS+K G
Sbjct: 196 DMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKKG 255

Query: 242 TEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVIGG 301
           T F QE+P +FN F+YV KGA+ I  +VF  +S+VF+  +G+ IRG    D+TEFA+IGG
Sbjct: 256 TGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIGG 315

Query: 302 KILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQ 353
            ILDQ V+QHGPFVETTREK+IEVF N++ GINGFE+A+GWKSSI NGI E+
Sbjct: 316 LILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEK 367

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  404 bits (1039), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 195/300 (65%), Positives = 227/300 (75%)

Query: 56  AESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPH 115
           ++ Q  RSI KHFIA EQ+EG GA VRRS+G+  + +FSPFLMLD F V P  GFPDHPH
Sbjct: 2   SKQQNLRSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPH 61

Query: 116 HGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQF 175
           HGQETITYV  G++AHEDFTG KGVLY GDLQFMTAGK I H EMPV  N      GLQ 
Sbjct: 62  HGQETITYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQL 121

Query: 176 WVDLPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYF 235
           WVDLP D+KN EPRYR+L+   IP     D+L V+VISG SY V+SVKDLAYTPIDFY +
Sbjct: 122 WVDLPTDMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYMY 181

Query: 236 ISNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTE 295
              KAGTEF Q    DFN FIYV +GAITIG++VF  +SS+FF TDG+ + G  A+DNTE
Sbjct: 182 RGKKAGTEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAADNTE 241

Query: 296 FAVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQTA 355
           FA+IGGKILDQQ VQHGPFVE T+EKLI+VF +Y++  NGFE+A  WKSSI +GI E  A
Sbjct: 242 FAIIGGKILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKENDA 301

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  398 bits (1022), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 182/292 (62%), Positives = 229/292 (78%)

Query: 62  RSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQETI 121
           RS+ K F A EQ+EG GA VRRS+G  +   FSPFL+LD F V+ P GFPDHPHHGQETI
Sbjct: 6   RSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHHGQETI 65

Query: 122 TYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDLPA 181
           TY+  G++AHEDFTGSKG+L PGDLQFMTAGKGIVH E+PV   D+  + GLQ WVDLP 
Sbjct: 66  TYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLWVDLPK 125

Query: 182 DLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNKAG 241
           ++K+C PRYRNLRA  IP+ Q N++L VKVISGKSY VESVK+LAYTP+DFY++IS+K G
Sbjct: 126 NMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYISDKEG 185

Query: 242 TEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVIGG 301
             F QEIP ++NAF+YV +G++ +  + +  +S++F+  +GN I+G T   NTEFA+I G
Sbjct: 186 INFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEFAIIAG 245

Query: 302 KILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQ 353
            ILDQ +VQHGPFVET+ EK+ EVF NY+ GINGFEKA+ W+SSI NGI E+
Sbjct: 246 LILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEK 297

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  397 bits (1019), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 190/300 (63%), Positives = 226/300 (75%)

Query: 56  AESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPH 115
           ++ Q  RSI KHFI+ EQSEG GA VRRS+G+  + +FSPFLMLD F V P  GFPDHPH
Sbjct: 2   SKQQNLRSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPH 61

Query: 116 HGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQF 175
           HGQETITYV  G++AHEDFTG KGVL  GDLQFMTAGK I H EMPV  N      GLQ 
Sbjct: 62  HGQETITYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQL 121

Query: 176 WVDLPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYF 235
           WVDLP D+KN EPRYR+LR   IP     D+L ++VISG SY V+SVKDLAYTPIDFY +
Sbjct: 122 WVDLPTDMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYMY 181

Query: 236 ISNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTE 295
              KAGTEF Q+   DFN FIYV KGA+ IG++VF  +SS+FF TDG+ + G  A+D+TE
Sbjct: 182 RGKKAGTEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAADDTE 241

Query: 296 FAVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQTA 355
           FA+IGGKILDQ+ VQHGPFVE T+EKLI+VF +Y++  NGFE+A  W+SSI +GI E  A
Sbjct: 242 FAIIGGKILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKEDDA 301

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  398 bits (1023), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 187/314 (59%), Positives = 235/314 (74%), Gaps = 3/314 (0%)

Query: 47  DQVNEDSATAESQK---ERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFK 103
           +  NE+    E  +   +RSI+ HFI  E  EGDGA V+RS+GS++  RF+PFLMLDDF 
Sbjct: 67  NNFNEEKQEDEMSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFD 126

Query: 104 VTPPEGFPDHPHHGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVT 163
           VTPP GFPDHPHHGQETITYV  G++AHEDFTG  G+L PGDLQFMTAG+GIVH E+PVT
Sbjct: 127 VTPPAGFPDHPHHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVT 186

Query: 164 MNDSAVSTGLQFWVDLPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVK 223
           M +     GLQ WVDLP DLK  EPRYRNLRA  IP+    +NL V VISGKSYDVES+ 
Sbjct: 187 MENGGSCRGLQLWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLN 246

Query: 224 DLAYTPIDFYYFISNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGN 283
           DLAYTP+  Y+F++ KAGT F QE P DFN F+YV KGA+ I E++FK ++++FF  DG 
Sbjct: 247 DLAYTPVHLYHFVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGE 306

Query: 284 FIRGFTASDNTEFAVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWK 343
            I G  A+D++EF ++GG+IL+Q VVQ GPFVET ++KL++VFD++ +  NGFE+A  W+
Sbjct: 307 SIEGQFATDDSEFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWE 366

Query: 344 SSISNGIDEQTARE 357
           S+I  GI E  ARE
Sbjct: 367 SNIRKGIKEAEARE 380

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  395 bits (1015), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 188/293 (64%), Positives = 229/293 (78%), Gaps = 1/293 (0%)

Query: 62  RSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQETI 121
           RS+ K+FIA EQ EG GA VRRS+GS +   FSPFL++D F V+ P GFPDHPHHGQETI
Sbjct: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHGQETI 67

Query: 122 TYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDLPA 181
           TYV  G++AHEDFTGSKGVL PGDLQFMTAGK I+H E+PV M +     G+Q WV LP 
Sbjct: 68  TYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALPI 127

Query: 182 DLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNKAG 241
           DLKN EPRYRNLR D IP+++ N+NL V+VISGKSY  ESVKDLAYTPID+Y F  NK G
Sbjct: 128 DLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNMNKKG 187

Query: 242 TEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASD-NTEFAVIG 300
            EF QE P +FN F+Y+TKGA+ I   V+  +S+VFF TDG+ I+G +A+D  TEFA+IG
Sbjct: 188 VEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFAIIG 247

Query: 301 GKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQ 353
           G ILDQ ++QHGPFVET RE L++VF NY+  INGFE+A GW+SSI++GI E+
Sbjct: 248 GLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  393 bits (1010), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 179/299 (59%), Positives = 233/299 (77%)

Query: 60  KERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQE 119
           K RS+LKHF+A EQSEG GA V+RS+G+ QM  F PFLMLD+F V+PP GFP+HPHHGQE
Sbjct: 8   KVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQE 67

Query: 120 TITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDL 179
           TITYV  G++AHEDFTGSKGVL  GDLQFMTAGK IVH E+PV M++   + GLQ WVDL
Sbjct: 68  TITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDL 127

Query: 180 PADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNK 239
           P D+KN EPRYR+LR + IP+   +DNL VKVISG+SY V+S+ +LAYTP++FY+FI+NK
Sbjct: 128 PNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANK 187

Query: 240 AGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVI 299
             TEFAQ    DF++FIY+ KG+I+I ++ +   S++FF+ DG+ IRGFT SDN EFA+I
Sbjct: 188 KNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAII 247

Query: 300 GGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQTAREW 358
            GK  +Q+VVQ+GPFVE++RE +++V  NY+ G+NGFE A  W   I NG+ E   +++
Sbjct: 248 AGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQY 306

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  379 bits (972), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 226/294 (76%)

Query: 59  QKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQ 118
           +K RSILK+F A EQSEG GA VRRS+G+ ++  F+PFLMLD F + PP GFPDHPHHGQ
Sbjct: 16  KKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQ 75

Query: 119 ETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVD 178
           ET+T++  G +AHEDFTGSKGVL  GDLQFMTAGKG VH E+PV +     + G+Q WVD
Sbjct: 76  ETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVD 135

Query: 179 LPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISN 238
           LPA LK+C+PRYR+L+ D IP  +  + LN+ VISG+SY V+S+++LAYT + +Y+++ +
Sbjct: 136 LPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFS 195

Query: 239 KAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAV 298
           +A   F Q  P DFN F+YV KG + I  + F  HSS+FF+TDG+ + GF+ S++ EF +
Sbjct: 196 EANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFIL 255

Query: 299 IGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDE 352
            GG+ILDQ +VQ+GPFVET++E+++EVF NY++G NGFEKA GW SSI+NGI E
Sbjct: 256 AGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVE 309

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  372 bits (955), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 174/291 (59%), Positives = 224/291 (76%)

Query: 60  KERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQE 119
           K RSILK+F A EQSEG GA VRRS+GS ++  F+PFLMLD F V+PP GFPDHPHHGQE
Sbjct: 3   KPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQE 62

Query: 120 TITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDL 179
           TITYV GG++AHEDFTGS+GVL PGDLQFMTAGKGI+H E+PV +   A S GLQ WVDL
Sbjct: 63  TITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDL 122

Query: 180 PADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNK 239
           P  LK+CEPRYR+L  + IP VQ    L V+VISG+SY V S+ +LAYTP+ FY++I+ K
Sbjct: 123 PMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRK 182

Query: 240 AGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVI 299
            GT F Q  P +FN F+YV KG++ +  + F  +SSVFF TDG+ + G  +S+ +EF +I
Sbjct: 183 PGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESEFILI 242

Query: 300 GGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGI 350
           GG++LDQ ++Q+GPFVET+++ + EV  NY++G NGFE+A GW SSI+ G+
Sbjct: 243 GGEVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGV 293

>TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {ON}
           Anc_8.774 YOR301W
          Length = 494

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 173 LQFWVDLPADLKNCEPRYRNLRADTIPVV 201
           L+FW+DL A ++ C+    N+R+  I VV
Sbjct: 47  LEFWIDLMAHIRLCKDYLENIRSSVIEVV 75

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%)

Query: 107 PEGFPDHPHHGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAG 152
           PE FP+   HG   I ++ G I+A + FT SK   Y    ++   G
Sbjct: 430 PEYFPEWKKHGYGDIVFLGGQIVAKQIFTHSKDTFYTTKHKYERHG 475

>Smik_14.158 Chr14 complement(295273..296778) [1506 bp, 501 aa] {ON}
           YNL169C (REAL)
          Length = 501

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 9/52 (17%)

Query: 190 YRNLRADTIPVVQVNDN---------LNVKVISGKSYDVESVKDLAYTPIDF 232
           YRN++ DT PV Q  D          L V +I+ ++ ++E VK + Y+  +F
Sbjct: 189 YRNIKPDTRPVAQGEDVIASPSDGKILQVGIINSETGEIEQVKGMTYSIKEF 240

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,913,331
Number of extensions: 1610256
Number of successful extensions: 3469
Number of sequences better than 10.0: 25
Number of HSP's gapped: 3538
Number of HSP's successfully gapped: 25
Length of query: 360
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 249
Effective length of database: 40,753,473
Effective search space: 10147614777
Effective search space used: 10147614777
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)