Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H008306.21ON33833815890.0
NDAI0D008106.21ON34934510401e-141
Skud_15.1686.21ON3483429511e-127
YOR007C (SGT2)6.21ON3463419351e-125
Smik_15.1766.21ON3453429321e-125
Kpol_1037.266.21ON3423399271e-124
SAKL0E01210g6.21ON3233379181e-123
KNAG0M011706.21ON3393409171e-122
Kwal_56.224336.21ON3223349081e-121
KAFR0L004106.21ON3313399051e-121
TBLA0G010506.21ON3503368851e-117
TPHA0J003406.21ON3383438731e-116
CAGL0E02739g6.21ON3433328701e-115
TDEL0G044806.21ON3433488691e-115
ZYRO0C07788g6.21ON3343348641e-115
Suva_15.1826.21ON3463428631e-114
KLTH0C11220g6.21ON3273348461e-112
KLLA0D01155g6.21ON3353358151e-107
Ecym_30256.21ON3183347516e-98
ACR005W6.21ON3273477197e-93
Kpol_1032.86.21ON3433375721e-70
NCAS0D026706.21ON3512393804e-42
TBLA0A072706.21ON3733493808e-42
TPHA0M002706.21ON3773803764e-41
NDAI0I022406.21ON3502173692e-40
CAGL0H08195g5.617ON5831022261e-19
NDAI0F009105.617ON5831032215e-19
Kwal_55.199355.617ON5931012162e-18
ZYRO0A05676g5.617ON5721012162e-18
KAFR0C058905.617ON5751052153e-18
SAKL0G07084g5.617ON5851012144e-18
Kpol_1018.695.617ON5902442144e-18
AEL224W5.617ON5801022135e-18
YOR027W (STI1)5.617ON5891022127e-18
Smik_15.2055.617ON5891012101e-17
KLTH0E02178g5.617ON5931022101e-17
TPHA0D028805.617ON5851022082e-17
NCAS0G008105.617ON5842452073e-17
KLLA0A07062g5.617ON5811022073e-17
TDEL0A048405.617ON5761272064e-17
Ecym_55825.617ON5841022039e-17
TBLA0E033005.617ON5821012031e-16
Skud_15.1925.617ON5891042002e-16
Suva_8.805.617ON5861031993e-16
KNAG0B032005.617ON5792221852e-14
NCAS0A00490singletonON6201031666e-12
AAR083C3.481ON538921584e-11
TBLA0C039503.481ON512841568e-11
KAFR0B066103.481ON511911532e-10
Skud_7.4323.481ON513921522e-10
YGR123C (PPT1)3.481ON513851496e-10
Smik_6.2153.481ON513761488e-10
Ecym_44133.481ON510821489e-10
Suva_7.4083.481ON513851461e-09
NCAS0F034903.481ON512941452e-09
CAGL0H07425g8.506ON3801011433e-09
CAGL0D05060g3.481ON510821417e-09
SAKL0F03102g3.481ON513961391e-08
KNAG0A079003.481ON5121251391e-08
NCAS0B070102.152ON6251121381e-08
YBR155W (CNS1)8.506ON385991371e-08
TPHA0D032203.481ON513761363e-08
KLLA0F24046g2.152ON604811354e-08
TDEL0D055003.481ON512851328e-08
NCAS0B024008.506ON3801011291e-07
Smik_2.2958.506ON385991292e-07
NDAI0B057903.481ON523821302e-07
Kpol_505.413.481ON513881292e-07
KNAG0A039508.506ON386991272e-07
Kwal_27.118908.506ON3341011263e-07
Suva_15.3142.152ON6441041256e-07
Suva_4.4058.506ON385991211e-06
YHR117W (TOM71)2.152ON6391041221e-06
KAFR0E029808.506ON3801091211e-06
ZYRO0F08624g8.506ON3791041212e-06
Kwal_55.211753.481ON511991222e-06
KLLA0B10912g3.481ON512911212e-06
CAGL0L12936g2.152ON6001771202e-06
Skud_2.2828.506ON385991193e-06
Skud_8.1782.152ON6381321203e-06
SAKL0H10934g8.506ON3801011184e-06
KLTH0F14542g3.481ON513991184e-06
Skud_14.2112.152ON6171761184e-06
NDAI0C052908.506ON3791021175e-06
ZYRO0G06512g2.152ON6041001176e-06
TPHA0L014208.506ON3741011166e-06
NDAI0B043402.152ON6641011168e-06
KAFR0F007202.152ON6081461141e-05
YNL121C (TOM70)2.152ON6171261141e-05
TBLA0H019705.352ON8401721142e-05
TDEL0B051402.152ON5991141122e-05
Smik_8.1952.152ON6351011122e-05
TDEL0B013108.506ON3801141113e-05
KLTH0E11748g8.506ON378991104e-05
NCAS0G024802.152ON596761114e-05
ZYRO0B04224g3.481ON5131101104e-05
CAGL0L04048g2.152ON587781104e-05
AGL268C8.506ON3791451094e-05
Kpol_513.28.506ON3741011095e-05
NDAI0F028102.152ON609821096e-05
TBLA0C055302.152ON610991088e-05
Ecym_25598.506ON3701451061e-04
Ecym_82042.152ON597821071e-04
CAGL0H07095g5.352ON6611791071e-04
Smik_14.2072.152ON6171701071e-04
Suva_14.2192.152ON6171371062e-04
TDEL0E027505.352ON564811042e-04
KLTH0B05170g2.152ON593891043e-04
KAFR0C018505.352ON646811025e-04
Kwal_33.147672.152ON594891015e-04
NCAS0F028705.352ON700811007e-04
KNAG0I025206.328ON11792930.001
CAGL0K09240g6.328ON14269940.001
TBLA0H033808.506ON375101980.001
ABR131W2.152ON59489980.001
Kpol_1048.212.152ON597120980.001
Ecym_40315.689ON688113980.002
YDR320C (SWA2)5.352ON668171980.002
NDAI0C043205.352ON70681960.003
TPHA0D038606.328ON12082890.003
Smik_4.5795.352ON667127950.003
CAGL0C01903g7.412ON76993950.003
TBLA0I023106.328ON11663870.005
Skud_4.5865.352ON642159930.005
TPHA0E007407.412ON74693930.006
KNAG0H035302.152ON61476930.006
NCAS0E024907.412ON80999930.006
ADR230W5.689ON68570920.008
Kpol_1043.605.689ON70698910.009
SAKL0E14542g5.689ON69059910.010
Ecym_20906.328ON17292850.019
Smik_3.1596.328ON11572820.021
KNAG0B022407.412ON739135880.022
KLLA0E20857g7.412ON71087870.028
KLTH0H14872g5.352ON623104870.028
KNAG0F040107.546ON1418160880.028
SAKL0E10956g2.152ON60089870.031
YCR060W (TAH1)6.328ON11161810.032
NDAI0E040407.412ON78399860.035
KNAG0C055005.352ON585101860.041
YBL084C (CDC27)7.412ON75893860.044
Suva_2.347.412ON76393850.046
Kpol_339.135.352ON68690850.046
Smik_2.367.412ON75193850.048
KLTH0F18150g5.689ON68982850.052
NCAS0D045006.328ON12158800.054
KLLA0C08910g6.328ON11561790.054
Suva_16.5217.546ON1424101840.070
KAFR0E028208.470ON56287830.081
KLLA0B09966g8.506ON370141820.091
ZYRO0D10186g5.352ON635109830.091
KAFR0J025706.328ON12191780.096
Ecym_81815.352ON661111830.10
Kpol_1018.1067.412ON75393820.12
TPHA0I015102.152ON60376810.14
NDAI0C051308.470ON59084810.17
Ecym_50925.72ON626105800.18
Suva_2.4895.352ON65981800.19
ZYRO0B03828g7.412ON72748790.26
NCAS0I008703.395ON58557790.27
Smik_16.4537.546ON1417101790.30
SAKL0A01672g6.328ON12863740.31
Suva_2.4108.470ON611178780.38
ABR206W5.72ON614105780.40
Smik_4.4918.470ON612177770.48
Ecym_13968.470ON573116770.52
SAKL0H11946g8.470ON57394760.55
Kpol_1028.516.328ON11777720.56
Kpol_1050.1127.546ON1360141770.58
KLTH0C06204g7.412ON62793760.59
TDEL0C027207.412ON700109760.66
Skud_2.247.412ON76993750.83
NDAI0F004005.689ON76457750.96
Skud_4.5068.470ON61184741.0
Skud_3.1356.328ON11859701.0
Suva_3.956.328ON11163691.1
Kwal_27.117378.470ON57584741.1
SAKL0H02244g5.72ON628131741.2
TBLA0B086803.32ON914103741.2
TDEL0A074306.328ON12462691.3
Kwal_27.107407.412ON62893731.4
AAR054C6.328ON13364701.4
NDAI0I004406.328ON12867691.5
NCAS0B025608.470ON57858731.5
AFR453W8.470ON56991731.5
Kwal_55.218395.689ON690112731.5
SAKL0G08822g5.352ON582131731.6
NCAS0G003505.689ON69862731.6
AGL294W7.412ON65687712.2
AEL281C7.546ON139078722.2
Kwal_23.54087.546ON141065722.3
Ecym_71427.412ON67595712.4
Kwal_34.159775.352ON59767712.4
KLLA0E11573g5.268ON49276712.4
TPHA0E011105.352ON693155712.5
TBLA0B079705.72ON687140712.7
TPHA0A045901.205ON292168702.7
KLTH0E10934g8.470ON56884702.8
CAGL0K11209g8.470ON590123702.9
Ecym_13661.456ON392126703.0
CAGL0M08030g1.456ON387123703.2
KLLA0E22705g1.456ON389116703.2
Kpol_1067.251.456ON391117703.2
TDEL0B016608.470ON549176703.7
KLLA0C02453g1.88ON102889704.0
NCAS0A153007.546ON139862704.0
NCAS0C044903.32ON918103694.6
TBLA0D004607.412ON835106694.8
CAGL0K05599g5.689ON71072685.7
SAKL0F12936g7.412ON63297677.3
YIL073C (SPO22)7.272ON975166678.3
KNAG0A041208.470ON602164669.2
TBLA0A091705.689ON72635669.6
Suva_16.4173.395ON53997669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H00830
         (338 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   616   0.0  
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   405   e-141
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   370   e-127
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   364   e-125
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   363   e-125
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   361   e-124
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   358   e-123
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   357   e-122
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   354   e-121
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   353   e-121
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   345   e-117
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   340   e-116
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   339   e-115
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   339   e-115
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   337   e-115
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   337   e-114
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   330   e-112
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   318   e-107
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   293   6e-98
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   281   7e-93
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   224   1e-70
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   150   4e-42
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   150   8e-42
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   149   4e-41
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   146   2e-40
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    92   1e-19
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     90   5e-19
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    88   2e-18
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    88   2e-18
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    87   3e-18
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    87   4e-18
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    87   4e-18
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    87   5e-18
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    86   7e-18
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    86   1e-17
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    86   1e-17
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    85   2e-17
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    84   3e-17
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    84   3e-17
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    84   4e-17
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    83   9e-17
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    83   1e-16
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    82   2e-16
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    81   3e-16
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    76   2e-14
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       69   6e-12
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    65   4e-11
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    65   8e-11
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    64   2e-10
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    63   2e-10
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    62   6e-10
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    62   8e-10
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    62   9e-10
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    61   1e-09
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    60   2e-09
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    60   3e-09
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    59   7e-09
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    58   1e-08
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    58   1e-08
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    58   1e-08
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    57   1e-08
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    57   3e-08
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    57   4e-08
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    55   8e-08
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    54   1e-07
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    54   2e-07
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    55   2e-07
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    54   2e-07
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    54   2e-07
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    53   3e-07
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    53   6e-07
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    51   1e-06
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    52   1e-06
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    51   1e-06
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    51   2e-06
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    52   2e-06
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    51   2e-06
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    51   2e-06
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    50   3e-06
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    51   3e-06
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    50   4e-06
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    50   4e-06
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    50   4e-06
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    50   5e-06
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    50   6e-06
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    49   6e-06
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    49   8e-06
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    49   1e-05
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    49   1e-05
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    49   2e-05
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    48   2e-05
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    48   2e-05
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    47   3e-05
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    47   4e-05
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    47   4e-05
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    47   4e-05
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    47   4e-05
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    47   4e-05
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    47   5e-05
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    47   6e-05
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    46   8e-05
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    45   1e-04
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    46   1e-04
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    46   1e-04
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    46   1e-04
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    45   2e-04
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    45   2e-04
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    45   3e-04
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    44   5e-04
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    44   5e-04
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    43   7e-04
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    40   0.001
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    41   0.001
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    42   0.001
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    42   0.001
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    42   0.001
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    42   0.002
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    42   0.002
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    42   0.003
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    39   0.003
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    41   0.003
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    41   0.003
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    38   0.005
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...    40   0.005
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    40   0.006
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    40   0.006
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    40   0.006
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    40   0.008
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    40   0.009
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    40   0.010
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    37   0.019
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    36   0.021
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    39   0.022
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    38   0.028
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    38   0.028
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    39   0.028
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    38   0.031
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    36   0.032
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    38   0.035
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    38   0.041
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    38   0.044
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    37   0.046
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    37   0.046
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    37   0.048
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    37   0.052
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    35   0.054
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    35   0.054
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    37   0.070
KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.4...    37   0.081
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    36   0.091
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...    37   0.091
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    35   0.096
Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar t...    37   0.10 
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    36   0.12 
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    36   0.14 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    36   0.17 
Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}...    35   0.18 
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...    35   0.19 
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    35   0.26 
NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.3...    35   0.27 
Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR18...    35   0.30 
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    33   0.31 
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    35   0.38 
ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic ho...    35   0.40 
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    34   0.48 
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    34   0.52 
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    34   0.55 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    32   0.56 
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    34   0.58 
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    34   0.59 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    34   0.66 
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    33   0.83 
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    33   0.96 
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    33   1.0  
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    32   1.0  
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    31   1.1  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    33   1.1  
SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} simila...    33   1.2  
TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3...    33   1.2  
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    31   1.3  
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    33   1.4  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    32   1.4  
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    31   1.5  
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    33   1.5  
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    33   1.5  
Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR08...    33   1.5  
SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} simila...    33   1.6  
NCAS0G00350 Chr7 complement(60735..62831) [2097 bp, 698 aa] {ON}...    33   1.6  
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    32   2.2  
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    32   2.2  
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    32   2.3  
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    32   2.4  
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...    32   2.4  
KLLA0E11573g Chr5 (1017355..1018833) [1479 bp, 492 aa] {ON} simi...    32   2.4  
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    32   2.5  
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    32   2.7  
TPHA0A04590 Chr1 complement(1041662..1042540) [879 bp, 292 aa] {...    32   2.7  
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    32   2.8  
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    32   2.9  
Ecym_1366 Chr1 (753035..754213) [1179 bp, 392 aa] {ON} similar t...    32   3.0  
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    32   3.2  
KLLA0E22705g Chr5 complement(2027229..2028398) [1170 bp, 389 aa]...    32   3.2  
Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON} (57301....    32   3.2  
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    32   3.7  
KLLA0C02453g Chr3 complement(216740..219826) [3087 bp, 1028 aa] ...    32   4.0  
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            32   4.0  
NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {O...    31   4.6  
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    31   4.8  
CAGL0K05599g Chr11 (545761..547893) [2133 bp, 710 aa] {ON} simil...    31   5.7  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    30   7.3  
YIL073C Chr9 complement(222937..225809,225900..225954) [2928 bp,...    30   8.3  
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    30   9.2  
TBLA0A09170 Chr1 complement(2276263..2278443) [2181 bp, 726 aa] ...    30   9.6  
Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {...    30   9.9  

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/338 (94%), Positives = 318/338 (94%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120
           GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE
Sbjct: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120

Query: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180
           KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL
Sbjct: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180

Query: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQP 240
           NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQP
Sbjct: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQP 240

Query: 241 ANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQNPNL 300
           ANPFAGSGMPD                    PQVMQAAQQMMSDPNSMQKMQEMMQNPNL
Sbjct: 241 ANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQNPNL 300

Query: 301 REMAQNLASGDANLDDLMNNPSVKDMANNLFGPNGAPK 338
           REMAQNLASGDANLDDLMNNPSVKDMANNLFGPNGAPK
Sbjct: 301 REMAQNLASGDANLDDLMNNPSVKDMANNLFGPNGAPK 338

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  405 bits (1040), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 204/345 (59%), Positives = 263/345 (76%), Gaps = 16/345 (4%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           MSL+NK++G+LIVDFLST+I+  E+SED+ADSLNVA+DCI+E+ EF+R+ V +T+++KF+
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 61  GKTLKEILSSASATSTGS--EKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLA 118
           GKTL +IL++ S  +  +  EKEESV+VNIPVEDAEIKA AE+FKLEGNKAMA KD+ LA
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 119 IEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKY 178
           +EKY+EAIK LPTN IYYANRAAA+SS+KE++ AIKDAE AI+IDP+YSKGYSRLAFAKY
Sbjct: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180

Query: 179 ALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQ 238
            L K EEALE YKKVLD+EGD AT  MKRD+E AK RVE SMN+EKS T    P +  GQ
Sbjct: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKT----PEQGQGQ 236

Query: 239 QPA---------NPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQ 289
           Q           NPFAG GMPD                    P  M  AQ++MSDPN+MQ
Sbjct: 237 QQTNESAQGNAPNPFAG-GMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQ 295

Query: 290 KMQEMMQNPNLREMAQNLASGDANLDDLMNNPSVKDMANNLFGPN 334
           ++Q MM +P++R++A N  +G+ +++D+MNNP++++MA+NLF  N
Sbjct: 296 QVQSMMSDPSMRDLANNFKNGNTDMNDIMNNPAIRNMASNLFKGN 340

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  370 bits (951), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 195/342 (57%), Positives = 245/342 (71%), Gaps = 11/342 (3%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQD-KF 59
           MS S  E+ SLIV++ S++++ KEISEDSADSLNVA+DCI+E+F FER+ V   L++ +F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 60  SGKTLKEILSSASATSTGSEKEES--VKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRL 117
            G+ L ++L+S S  S  ++K+++  V+VNIP EDAEIKA AE  K++GNKAMA KDY L
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 118 AIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAK 177
           AI KY+EAIK LPTN IYYANRAAA+SS+K YD A++DAE AI IDP Y +GYSRL FAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 178 YALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAG 237
           YA  KPEEALE YKKVLD+EGD AT AMKRD+E AK +VE S+NLEK   T PE SR A 
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK---TVPEQSRDA- 236

Query: 238 QQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQN 297
              AN  A  G                       PQ+MQAAQ+MMS+P +MQ +Q+MMQ+
Sbjct: 237 --DANADASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQD 294

Query: 298 PNLREMAQNLASGDA--NLDDLMNNPSVKDMANNLFGPNGAP 337
           PN+++MA+   SG    NL DLMNNP+++ MA NLFG  GAP
Sbjct: 295 PNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAP 336

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  364 bits (935), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 192/341 (56%), Positives = 246/341 (72%), Gaps = 13/341 (3%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTL-QDKF 59
           MS S +E+ +LIV++ S++++ KEISED ADSLNVA+DCI+E+F FER+ V+  L + +F
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 60  SGKTLKEILSSASATSTGSEKE--ESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRL 117
            G+ L +IL+SAS     ++K+  E+V++NIP +DAE KA AE  K++GNKAMA KDY L
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 118 AIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAK 177
           AI KY+EAIK LPTN IYYANRAAA+SS+KEYD A+KDAE AI IDP+Y +GYSRL FAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 178 YALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAG 237
           YA  KPEEALE YKKVLD+EGD AT AMKRD+E AK +VE S+NLEK   T PE SR   
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK---TVPEQSRD-- 235

Query: 238 QQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQN 297
              A+  A  G                       PQ+MQAAQ+MMS+P +MQ +Q+MMQ+
Sbjct: 236 ---ADVDASQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQD 292

Query: 298 PNLREMAQNLASGDA--NLDDLMNNPSVKDMANNLFGPNGA 336
           P++R+MA+  ASG    NL DLMNNP++++MA NLFG  GA
Sbjct: 293 PSIRQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGGAGA 333

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  363 bits (932), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 191/342 (55%), Positives = 247/342 (72%), Gaps = 13/342 (3%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTL-QDKF 59
           M  S +E+ +LIV++ S++++ KEISED ADSLNVA+DCI+E+F FERD  +  L + +F
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 60  SGKTLKEILSSASATSTGSEKEES--VKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRL 117
            GK+L ++L+SAS  S  +EK+++  V+VNIP EDAE KA AE  K++GNKAMA KDY L
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 118 AIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAK 177
           AI KY+EAI+ LPTN IYYANRAAA+SS++EYD A+KDAE +I IDP+Y +GYSRL FAK
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 178 YALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAG 237
           YA  KPEEALE YKKVLD+EGD AT AMKRD+E AK +VE S+NLEK+    PE SR A 
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKA---VPEQSRDA- 236

Query: 238 QQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQN 297
              AN   G+G                       PQ+MQAAQ+MMS+P +MQ +Q+MMQ+
Sbjct: 237 --DANASQGAG--SSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQD 292

Query: 298 PNLREMAQNLASGDA--NLDDLMNNPSVKDMANNLFGPNGAP 337
           P++R+MA+   SG    NL DLMNNP++++MA NLFG   AP
Sbjct: 293 PSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAP 334

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  361 bits (927), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 184/339 (54%), Positives = 244/339 (71%), Gaps = 8/339 (2%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           MS+SNK++ +LI+DFLSTV+   E+SED+ADSLNVA+DCI E+FEFERD+VA  ++  F 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 61  GKTLKEILSSASATSTGSEK-EESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAI 119
           G +L   L+ +++ S  +   +E+VKVN+  +D E    AE+ KLEGNKAMA KDY LAI
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELAI 120

Query: 120 EKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYA 179
           +KY+EAI TLPTN +Y+ANRAAAYSS+K+YD A++DA  AI+I+P YSKGYSRL FAK+A
Sbjct: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180

Query: 180 LNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQ 239
             K E+ALE YKKVLD+EGDKAT  MKRD+E AK +VE S+NLEKS+ +    + S    
Sbjct: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSAS 240

Query: 240 PANPFAG-SGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQNP 298
            A+PFAG  GMPD                    PQ+MQAAQQMM DP +M++++ MMQNP
Sbjct: 241 AADPFAGMGGMPD----FSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNP 296

Query: 299 NLREMAQNLASGDANLD--DLMNNPSVKDMANNLFGPNG 335
           ++++MA   +SG+   D   LMN+PS++DMA N+FG  G
Sbjct: 297 SVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGG 335

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  358 bits (918), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 242/337 (71%), Gaps = 17/337 (5%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           M+ SNKE+ +LIVDFLS+ ++   +SED ADSLNVAIDCI+E+FEFERD V++ +++ F 
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 61  GKTLKEIL-SSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAI 119
            + L E+L S+A+A  T SE    VKVNIP EDA  KA AE  KL+GNKAMA+KD+  AI
Sbjct: 61  NRKLDELLKSAATALPTQSE---PVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAI 117

Query: 120 EKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYA 179
           +KY+EAI+ LP+N +YYANRAAAYSS+K+Y+ +++DAE AI+++P+YSKGYSRL FAKYA
Sbjct: 118 KKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYA 177

Query: 180 LNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQ 239
           L KPEEALE YK VLD+EGDKAT  MKRD+E AK +VE S+NLEKS  T  +   S+   
Sbjct: 178 LGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDA 237

Query: 240 PANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQNPN 299
            A     SG PD                    PQVM AAQ++M +P +   M EMM+NP 
Sbjct: 238 GA---GASGFPD-----MASLLGGGLGGLLNNPQVMSAAQKLMQNPGA---MDEMMKNPA 286

Query: 300 LREMAQNLASGDA--NLDDLMNNPSVKDMANNLFGPN 334
           +R+MA+N +SG    NL DLM+NP++KDMA NLFGPN
Sbjct: 287 VRQMAENFSSGGGTPNLGDLMSNPAIKDMAKNLFGPN 323

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  357 bits (917), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 186/340 (54%), Positives = 244/340 (71%), Gaps = 14/340 (4%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           M+ SNKEV SLI+D+L+ V+   E+S D  DSLNVAIDC+TE F  E+DT++ T++ KF+
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 61  GKTLKEILSSAS--ATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLA 118
           GK+L E+L +AS  A +T   K E+VK+NIP EDAE KA AE+ KLEGNKA+A+KDY LA
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLA 120

Query: 119 IEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKY 178
           +EKY+EAIK LPTN +Y+ANRAAAY++ + YD A+KDAE+AI++DPAYSKGYSRLA+AKY
Sbjct: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180

Query: 179 ALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQ 238
                EE+LE YKKVL++EGD AT   KR +E AK RVE S+NLEKS      P+ SAG 
Sbjct: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSV-----PTESAGG 235

Query: 239 QPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQNP 298
           Q  NP AG G PD                    PQ+MQAAQ MMS+P +M+K+Q MMQNP
Sbjct: 236 Q-TNPAAGGGFPD-----FSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNP 289

Query: 299 NLREMAQNLASGDA-NLDDLMNNPSVKDMANNLFGPNGAP 337
            +++MA+    G+  +  ++MNNP+V++MA++LF   G P
Sbjct: 290 AIQQMAEQFKGGNTPDFSEMMNNPAVRNMASSLFSGAGEP 329

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  354 bits (908), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 187/334 (55%), Positives = 244/334 (73%), Gaps = 18/334 (5%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           MS SNK++ +LIVDFLS  ++NKE+SED  DSLNVAIDCITE+FEF+R++VA TL+  F+
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120
           G++LK+++ +AS  S  S  +ESVKVNIPVEDAE KA AES KLEGNKAMAAKD+  A+ 
Sbjct: 61  GRSLKQVVEAASVGS--SSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVL 118

Query: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180
           KYSEAI+ LPTN +YYANRAAA+SS+K+Y+ A+KDAE AI+++P+YSKGYSRL FA+YAL
Sbjct: 119 KYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYAL 178

Query: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQP 240
            KPEEAL+ YKKVLD+EG+ AT AMKRD++ A  +V  S+N+EKS+   P  +R      
Sbjct: 179 GKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSA---PAATRDGAGSA 235

Query: 241 ANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQNPNL 300
                  G+PD                    PQ+MQAAQQMM +PN+   MQE+M NP +
Sbjct: 236 T---GSGGLPD-----ISSMLGGGLGGLLNNPQLMQAAQQMMQNPNA---MQEVMNNPAV 284

Query: 301 REMAQNLASGDA--NLDDLMNNPSVKDMANNLFG 332
           ++MA+   SG    ++ DLMNNP++ DMA N+FG
Sbjct: 285 KQMAEKFQSGGGTPSMADLMNNPALMDMAKNMFG 318

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  353 bits (905), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 191/339 (56%), Positives = 233/339 (68%), Gaps = 17/339 (5%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           M LSNKE+ +LIVD+L  V +  ++SED  DSLNVAIDCIT+SFEFERD+ +  ++ KF 
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVE----DAEIKATAESFKLEGNKAMAAKDYR 116
             +L E+L  A   S     +E+V VN+P +    D E K  AE  KLEGNKAMA KD+ 
Sbjct: 61  NLSLPELLEVAMENSA----KENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFD 116

Query: 117 LAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFA 176
           LAI KYSEAI   P N IYYANRAAAYSS+K+++ A +DAE AI +DP YSKGYSRL FA
Sbjct: 117 LAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFA 176

Query: 177 KYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSA 236
           KYALNKPEEALE YKKVLD+EGDKAT  MKRD+E AK RVE S+NLEK  +T  E   S 
Sbjct: 177 KYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKE--ESV 234

Query: 237 GQQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQ 296
            +  AN  AG G PD                    PQ+MQAAQQMMSDPN+M K+Q MMQ
Sbjct: 235 TESAANAAAG-GFPD-----MSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQ 288

Query: 297 NPNLREMAQNLASGDA-NLDDLMNNPSVKDMANNLFGPN 334
           NP++R+MA+N  +G+  +   LMN+P++KDMA N FG N
Sbjct: 289 NPSIRQMAENFQNGNTPDFSQLMNDPNIKDMAKNFFGGN 327

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  345 bits (885), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 184/336 (54%), Positives = 240/336 (71%), Gaps = 18/336 (5%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           MS SNK++ +L+VDFLST I+ K +S D+ADSLNVAIDCITE+FEFE+D V  TL  KF 
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 61  GKTLKEILSSASATSTGSEKEESVKVNIP----VEDAEIKATAESFKLEGNKAMAAKDYR 116
           GK+L E+L +A+     S   E +KV+I      ED E+ A AE+ KLEGNKAMAAKDY 
Sbjct: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDYN 120

Query: 117 LAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFA 176
           LA+EKY+ AIK +PT  +YYANRAAAYSS ++YD AIKDAE AI+++P +SKGYSRL FA
Sbjct: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180

Query: 177 KYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSA 236
           K+A  K +EALE YKK L+++GDKAT  MKRD+E AK +VE S+N+EKS+T +   S SA
Sbjct: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSASASASA 240

Query: 237 GQQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQ 296
                      GMPD                    PQ+MQAAQQMMS+P +M++M+ MMQ
Sbjct: 241 SA--------GGMPD-----MASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQ 287

Query: 297 NPNLREMAQNLASGDA-NLDDLMNNPSVKDMANNLF 331
           NP++R+MA+NL+SG +  + D MNNP++++MA+NLF
Sbjct: 288 NPSIRQMAENLSSGSSEGMGDFMNNPAIREMASNLF 323

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  340 bits (873), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/343 (54%), Positives = 236/343 (68%), Gaps = 15/343 (4%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           M+ SNKE+ +LIVD+L+ V+  KE+S D+ADSLNVA+DCI E+FEFERD+V  T++  F+
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 61  GKTLKEILSSASATSTGSEKEESVKVNIP--VEDAEIKATAESFKLEGNKAMAAKDYRLA 118
           G  L   LS  SAT+        ++VNI     D E KATAE  KLEGNKAMA KDY  A
Sbjct: 61  GNGLTSFLS-GSATN-------DIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESA 112

Query: 119 IEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKY 178
           I+KYSEAI+ LPTN +YYANRAAAYSS+K+YD+A+ DAE AI+++P YSKGYSRL FAK+
Sbjct: 113 IKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKF 172

Query: 179 ALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSA-- 236
           A  K E+AL+ YKKVLD+EGDKAT  MKRD+E AK +VE S+NLEK +    E   +A  
Sbjct: 173 AQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADA 232

Query: 237 GQQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQ 296
           G   A      G PD                    PQ+MQAAQQMM +PN+MQ+M+ MMQ
Sbjct: 233 GTGAAGMGGMGGFPD-LSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMMQ 291

Query: 297 NPNLREMAQNLASGDA--NLDDLMNNPSVKDMANNLFGPNGAP 337
           NP +R+MA+N ASG+   +L  +MNNP +KDMA N+FG  G P
Sbjct: 292 NPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFP 334

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  339 bits (870), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 227/332 (68%), Gaps = 19/332 (5%)

Query: 5   NKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFSGKTL 64
           +KEV ++I+ +L  V+  K + ED  DS+NVAIDCI ESFE ER  V   L+     K L
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 65  KEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSE 124
           +E L        G+ K E VKVNIP EDAE KA AE+ KLEGNKAMA KD+ LAI KYSE
Sbjct: 62  EECLE---CMKGGAVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSE 118

Query: 125 AIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPE 184
           AI+ LPTN IYYANRAAA+SS+K+YD A+ DAEKAIEIDPAYSKGYSRL FAKYA NKPE
Sbjct: 119 AIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPE 178

Query: 185 EALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKS---STTTPEPSRSAGQQPA 241
           EALE YKKV+D+EGDKAT  MKRD+E AK +VE S+NLEK+             AG   A
Sbjct: 179 EALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAGGA 238

Query: 242 NPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQNPNLR 301
             F  S M                      PQ+MQAAQQMMS+P ++Q+MQ MMQ+P++R
Sbjct: 239 GGFDFSSM-----------LSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIR 287

Query: 302 EMAQNLASGDA--NLDDLMNNPSVKDMANNLF 331
           +MA+   SG+   N+DDLM+NP++++MA+++F
Sbjct: 288 QMAEQFTSGNGTPNMDDLMSNPALRNMASSMF 319

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  339 bits (869), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 233/348 (66%), Gaps = 22/348 (6%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           MS SNKEV SLIVD+LS +++ K +SE++ DSLNVAIDCI ESFE ++          F 
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56

Query: 61  GKTLKEILS--SASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLA 118
           GK L E+L   S S++ T + + ES+KVNIP EDAE KA AE+ KLEGNKAMA KD+ LA
Sbjct: 57  GKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLA 116

Query: 119 IEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKY 178
           I+KYS+AI+ LPTN +YYANRAAA+SS+K Y+ AIKDAE AI+ DP YSKGYSRL +AK+
Sbjct: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176

Query: 179 ALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQ 238
           AL + E+ALE YKKVLD+EGDKA+  MKRD+E AK +VE S++LEK   T    + +   
Sbjct: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAGAG 236

Query: 239 QPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQNP 298
                                            PQ+MQAAQQMM +P +M +M+ MMQNP
Sbjct: 237 GAGG--------SGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNP 288

Query: 299 NLREMAQNLASGDA--NLDDLMNNPSVKDMANNLFG------PNGAPK 338
            +R+MA+N A G+   N+ DLMNNP+++DMA +LFG      PN  PK
Sbjct: 289 GVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDVPK 336

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  337 bits (864), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 180/334 (53%), Positives = 229/334 (68%), Gaps = 28/334 (8%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           M+ SNK++ SLIVD+L+ V+  K +SEDS DSLNVAI+CITE+F  E+ + +      F 
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAA----FG 56

Query: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120
           GK L E+LS+ +     S + E+VKVNIP EDAE+K+ AES KLEGNKAMA KDY LAI+
Sbjct: 57  GKNLAELLSAGAGAP--SSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIK 114

Query: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180
           KYSEAI  +PTN +YYANRAAA+SS+K YD AIKDAE A+++D +YSKGYSRL +AK+A 
Sbjct: 115 KYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQ 174

Query: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTT------TPEPSR 234
            K EEALE YKKVLD+EGD AT  MKRD+E AK +VE ++ L K+  T      T EP  
Sbjct: 175 GKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEP-- 232

Query: 235 SAGQQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEM 294
            AG  P   F  S M                      PQVMQAAQQMM +P +M +M+ M
Sbjct: 233 -AGANPGGGFDLSSM-----------LGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETM 280

Query: 295 MQNPNLREMAQNLASGDA--NLDDLMNNPSVKDM 326
           MQNPN+R+MA+  A G+   NL+D+MNNP+++DM
Sbjct: 281 MQNPNVRQMAEKFAGGNGTPNLNDIMNNPALRDM 314

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  337 bits (863), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 188/342 (54%), Positives = 239/342 (69%), Gaps = 13/342 (3%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTL-QDKF 59
           MS S +E+ SLIV++ S++++ KE+SEDSADSLNVA+DCI+E+F FERD V+  L +  F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 60  SGKTLKEILSSASATSTGSEKEES--VKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRL 117
            G++L  +LSS+S      +K+++  V+VNIP EDAE KA AE  K++GNKAMA K+Y L
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 118 AIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAK 177
           AI+KY+EAI  LPTN IYYANRAAA+SS+KEYD AIKDAE AI +DP+Y +GYSRL FAK
Sbjct: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180

Query: 178 YALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAG 237
           YA  KPEEALE YKKVLD+EGD AT AMKRD+E AK RVE S+NLEK   T PE  R AG
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEK---TAPEQPRDAG 237

Query: 238 QQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQN 297
                                             PQ+MQAAQ+MMS+P +MQ +Q MMQ+
Sbjct: 238 ANAGQGAGAG-----GLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQD 292

Query: 298 PNLREMAQNLASGDA--NLDDLMNNPSVKDMANNLFGPNGAP 337
           P++R+MA+   SG    NL DLM NP++++MA +LFG   AP
Sbjct: 293 PSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAP 334

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  330 bits (846), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 176/334 (52%), Positives = 238/334 (71%), Gaps = 13/334 (3%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           M+ + KE+ SLI+D+L    + KEI ED  DSLNVAIDC+TE+FE E+++ +  ++  F 
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120
           G++L++I+ ++S   T ++ +E VKVNIPVEDAEIKA AE+ KLEGNKAMA KD+  AI 
Sbjct: 61  GQSLEQIVGASSKGPTATQ-QEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAIS 119

Query: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180
           KYSEAI+TLP+N +Y+ANRAAAYSS+K+Y  A++DAE AI+++P+YSKGYSRL FA+YAL
Sbjct: 120 KYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYAL 179

Query: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQP 240
            +PEEAL+ YKKVLD+EG  AT AMKRD++ A  +VE S+N+E+S+     P+ S  + P
Sbjct: 180 GRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSA-----PAASNAESP 234

Query: 241 ANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQNPNL 300
            +   GSG PD                    PQVMQAAQQMM +PN+   MQEMM NP +
Sbjct: 235 -DAAGGSGFPD-IASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNA---MQEMMSNPAI 289

Query: 301 REMAQNLASGDA--NLDDLMNNPSVKDMANNLFG 332
           ++MA    SG    ++ DLMNNP++ DMA N+FG
Sbjct: 290 KQMADKFQSGGGTPSMADLMNNPALMDMAKNMFG 323

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  318 bits (815), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 183/335 (54%), Positives = 233/335 (69%), Gaps = 10/335 (2%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           MSLSNKE+ +LIVDFLS+   +  ++ED  DSLNVAIDCITE+F+FERD     +   F+
Sbjct: 1   MSLSNKEIAALIVDFLSS--SSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120
           GK L E+L  ASA S+G    E VKV+IPVEDA  KA AE  KL+GNKAMAAK +  AIE
Sbjct: 59  GKKLPELL--ASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEAIE 116

Query: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180
           KY+ AI+  P+N +YY+NRAAAYSS+K+Y+ A+KDAE+AIE+DP YSKG+SRL FAKYAL
Sbjct: 117 KYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYAL 176

Query: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTT-TPEPSRSAGQQ 239
           NKPEEAL+ YKKVLD+EG+KAT  MKRD+E AK +VE+SMNLEKSST+ + E        
Sbjct: 177 NKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSDKSAT 236

Query: 240 PANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQNPN 299
                   G+PD                    PQVMQAA++MM +P     MQ+MM NP 
Sbjct: 237 EGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPG---LMQDMMSNPA 293

Query: 300 LREMAQNLASGDA--NLDDLMNNPSVKDMANNLFG 332
           +++MA   +SG    +L  +MN+PS++DMA N+FG
Sbjct: 294 MKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFG 328

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  293 bits (751), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 160/334 (47%), Positives = 216/334 (64%), Gaps = 20/334 (5%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           M  SNKE+ +LIV FLST    K++ E+  DSLNVAIDCI E+FE ER+   + +   ++
Sbjct: 1   MPGSNKEIAALIVQFLST--STKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120
           G+ L +++ S ++  T S  E +   N      E+   AE+ KLEGNKA AAKD+  A++
Sbjct: 59  GRGLVDLVKSGASEPTLSSSEPTGN-NTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVK 117

Query: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180
           KY+EAI+ +P N ++Y NRAAAYSS K+++ A++DAE A+ I+P+YS+GYSRL  AKYAL
Sbjct: 118 KYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYAL 177

Query: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQP 240
            KPEEA+E YKKVLD+EGD AT AMKRD+E AK +VE S+NLE      P   +   QQ 
Sbjct: 178 GKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE----ALP---KGEEQQT 230

Query: 241 ANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQNPNL 300
           +   +  G PD                    PQVMQAAQ+MM +P++   MQEMM NP +
Sbjct: 231 SEGSSAGGFPD-----LSSMLGGGLGGLLNNPQVMQAAQKMMQNPSA---MQEMMNNPAI 282

Query: 301 REMAQNLASGDA--NLDDLMNNPSVKDMANNLFG 332
           ++MAQN ASG    NL D+M +P++KDMA   FG
Sbjct: 283 KQMAQNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  281 bits (719), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 163/347 (46%), Positives = 228/347 (65%), Gaps = 35/347 (10%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEF---ERDTVAQTLQD 57
           MS SNK++ +LIVDFL+T  K   + ED  DSL VAIDCITE+FE    E DT+   + +
Sbjct: 1   MSPSNKDIAALIVDFLTTSAKT--VGEDYEDSLKVAIDCITEAFELGPGEADTL---VSE 55

Query: 58  KFSGKTLKEILSSASA-TSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYR 116
           K  G++L ++L++  A TS   E +        V   E+K  AE+ KLEGN+AMAAKDY 
Sbjct: 56  KCGGRSLSQLLTTGMAHTSDAGEPK--------VAAEELKKEAEALKLEGNRAMAAKDYE 107

Query: 117 LAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFA 176
            AI+KY+ AI+ LPT+ +YYANRAAAYSS+++Y+ A++DAEKA ++D +YSKG+SRL +A
Sbjct: 108 TAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYA 167

Query: 177 KYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSA 236
           KYAL + EEALE YK+VLD+EGD AT AM+RD+E AK +VE S+N+++++  T     +A
Sbjct: 168 KYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDSAA 227

Query: 237 GQQPANPFAGSGMPDXXX--------XXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSM 288
           G         SG+PD                            PQVMQAAQ+MM +P++ 
Sbjct: 228 GSAGG-----SGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSA- 281

Query: 289 QKMQEMMQNPNLREMAQNLASGDAN--LDDLMNNPSVKDMANNLFGP 333
             +QEMM NP +++MA+N ASG+ +  L DLM +P+V++MA+  FGP
Sbjct: 282 --IQEMMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFGP 326

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  224 bits (572), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 136/337 (40%), Positives = 201/337 (59%), Gaps = 22/337 (6%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           MSL+NK+ G+LIV++L  +I  KE+SED+A+SLNVAIDCI++ FE +  +  + + D F+
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEI----KATAESFKLEGNKAMAAKDYR 116
              LK I    +    G +    V V + V++ EI    K  AE+ KLEGNK M+ K+Y+
Sbjct: 61  KSDLKTI----TLKGLGLQNVSDV-VELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYK 115

Query: 117 LAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFA 176
            AI+KYS+AI+  P+N  YY+NRAAAY  ++++ NA+ DA  AI++DP YSK YSRL  A
Sbjct: 116 SAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAA 175

Query: 177 KYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSA 236
           K A    E+A+  +KKVL++EGDK+T  MK D+E AK  V++ + L K+    P+PS   
Sbjct: 176 KLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKN---VPDPS--- 229

Query: 237 GQQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMMQ 296
           G  P N      + D                                +P  MQ+++ +MQ
Sbjct: 230 GPPPLN--TTDVLTDIATVLGSSFGSLMNNTQM---MQRAQQMMQTQNPEMMQQVEGLMQ 284

Query: 297 NPNLREMAQNLASGD--ANLDDLMNNPSVKDMANNLF 331
           NP +R+ A+N+A+G+    L D++NNPSVK++AN L 
Sbjct: 285 NPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLM 321

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  150 bits (380), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 142/239 (59%), Gaps = 29/239 (12%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           MSLSNKE+ S IV +LS++I+  +++ED A+S++VAI+CI +SF+ + +  A +      
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADS------ 54

Query: 61  GKTLKEILSS---ASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRL 117
              L  +L +          SEKE  +     V +  IK      KLEGNKA+  ++Y+ 
Sbjct: 55  --DLATVLLANLNLEPEPKLSEKEREL-----VNEQAIK-----LKLEGNKAVERENYKD 102

Query: 118 AIEKYSEAIKTL-----PTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSR 172
           AI+KY+ AI  L     P +  Y +N++ A +    Y+ A  DA   I+IDP +SKGYSR
Sbjct: 103 AIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSR 162

Query: 173 LAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVES---SMNLEKSSTT 228
           LA AK   NK E+A+  YK+VLD+EG+KAT  MKRDFE+ K + E+   S +++  S T
Sbjct: 163 LAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFETLNFSTHIDSGSAT 221

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  150 bits (380), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 175/349 (50%), Gaps = 51/349 (14%)

Query: 3   LSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFSGK 62
           +++K+V  LIV+FL  VI  KEIS+D+ DSLNVAIDCI + +      ++ +L  KFS  
Sbjct: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKS 65

Query: 63  TLKEILSS------ASATSTG---------SEKEESVK-------------VNIPVEDA- 93
            L  IL++       + TST          S   ESVK             ++I + D  
Sbjct: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTS 125

Query: 94  ------EIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVK 147
                 + K  A++FK EGN+ M ++DY+ AIE Y+ AI   P + IYY+NR+ AY  V 
Sbjct: 126 KNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVN 185

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKR 207
           +Y++AI DA   I ID  +SK Y RLA  K   ++  +AL+YYKK +++  D     + R
Sbjct: 186 DYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245

Query: 208 DFEMAKNRVESSMNLEKSST---TTPEPSRSAGQQPANPFAGSGMPDXXXXXXXXXXXXX 264
           +FE  K +V++ ++L + S           S      +P  GS + D             
Sbjct: 246 EFEDLKLKVQTDISLREISNDHSNNNYNENSYNSTKNSPDIGSILGD------------G 293

Query: 265 XXXXXXXPQVMQAAQQMM-SDPNSMQKMQEMMQNPNLREMAQNLASGDA 312
                  P + Q   +++ ++P++ + +  ++ NP ++ + QN  +G A
Sbjct: 294 FAALLSNPMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  149 bits (376), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 108/380 (28%), Positives = 180/380 (47%), Gaps = 75/380 (19%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           M+ +++E+ S+IVD+ +  I + ++++D+ DSLNVAIDCI + F+ ++D ++  L+  + 
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 61  GKTLKEILSSASATSTGSEKEESV----------------------KVNIPV-------E 91
              L   L +   ++   +K+ +                        +N+PV       E
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 92  DAEIKAT------AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSS 145
             E K +      AE  K +GN+ M AK Y  AI  YS+AIK  PTN  YY NRA AY  
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 146 VKEYDNAIKDAEKAIEID----PAYSKGYSRLAFAKYALNKPEEALEYYKKVLDM----- 196
              +D+AI DA K+IEID    P   K Y RL  AKY +   E +L  +K+++++     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 197 EGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPE---------PSRSAGQQPANPFAGS 247
           +GD+ T  M  D+E AK +V+    ++ + +T  E         P R          AG+
Sbjct: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300

Query: 248 GMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMM-SDPNSMQKMQEMMQNPNLREMAQN 306
            +                      P   +  +Q++ S+P + Q+   +M +P +R+M +N
Sbjct: 301 NL----------------NIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKEN 344

Query: 307 LASGDANLDDLMNNPSVKDM 326
           + S     D + N P +KD+
Sbjct: 345 VNS-----DSMSNIPILKDL 359

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  146 bits (369), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 126/217 (58%), Gaps = 18/217 (8%)

Query: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60
           MSL+ ++  SLI+ +LS +  N  + ED  +SL VAI CI ESF  + D +  +L+++  
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60

Query: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120
              L+E L++  AT     +E                 AE+ K EGN+AM    Y  AI+
Sbjct: 61  KTILQENLNTLEATQKIHNEE-----------------AEALKKEGNEAMIEGQYEEAIK 103

Query: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180
           KY+EAI+    NV YY+NR+ AYS +  Y++A+ DA  AI IDP++SK YSRL +AK   
Sbjct: 104 KYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQ 162

Query: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVE 217
           +K E+ +  YK+ +D+EG  A+  +  D+E A+ + E
Sbjct: 163 DKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYE 199

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 71/102 (69%), Gaps = 1/102 (0%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPT-NVIYYANRAAAYSSVKEYDNAIKDA 156
           TA+ +K +GN A  AKDY  AI+ +S+AI+   T N ++Y+NR+A Y+S+K++  A+ DA
Sbjct: 3   TADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDA 62

Query: 157 EKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEG 198
           E+ ++I+P +SKGY+RL  A   L   +EA   YKK L+++G
Sbjct: 63  EECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDG 104

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 51/90 (56%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +LEG       D+  A++ Y+E IK  P +   Y+NRAAA S +  +  AI+D  K
Sbjct: 390 AEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNK 449

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
           AIE DP + + Y R A A+ A+ +   A+E
Sbjct: 450 AIEKDPNFIRAYIRKATAQIAVKEFAAAIE 479

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 64/135 (47%), Gaps = 22/135 (16%)

Query: 106 GNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAY-------SSVKEYDNAIKDAEK 158
           GNKA  A+ +  AI  Y +A   L  ++ Y  NR+AA        +++K  D A+   EK
Sbjct: 263 GNKAYKARQFDEAIAHY-DAAWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAV---EK 318

Query: 159 AIEIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDF-----E 210
             E+   Y   +K ++R+    +  N  ++A+E+Y+K L    +  TP +         E
Sbjct: 319 GREMRTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSL---TEHRTPEILTKLRNTEKE 375

Query: 211 MAKNRVESSMNLEKS 225
           + K   E  +N EK+
Sbjct: 376 LKKQEAEEYINPEKA 390

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 89.7 bits (221), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 72/103 (69%), Gaps = 1/103 (0%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPT-NVIYYANRAAAYSSVKEYDNAIKDA 156
           TA+ +K +GN A  +KD+  AIE +++AI+  PT N + Y+NR+AAY+S K++  A+ DA
Sbjct: 4   TADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDA 63

Query: 157 EKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD 199
            + ++I+P +SKGY+RL  A++ L   EEA + YK+ L ++ +
Sbjct: 64  TECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNN 106

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 52/90 (57%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +LEG +     D+  A++ YSE IK  P +   Y+NRAAA S +  +  AIKD + 
Sbjct: 389 AEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDN 448

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
           AI+ DP + + Y R A A+ A+ +   AL+
Sbjct: 449 AIKKDPNFVRAYIRKATAQIAIKEYANALD 478

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 57/106 (53%), Gaps = 8/106 (7%)

Query: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155
           K  A+  K+EGNK   A  +  AIE+Y++A   L  ++ Y  NR+AA     +++ AI  
Sbjct: 252 KLEADEAKVEGNKLYKAHKFDEAIEQYNKAW-ALNKDITYLNNRSAAEFEKGDFETAIAT 310

Query: 156 AEKAI----EIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVL 194
             +A+    E+   Y   +K ++R+  A +     +++++YY+K L
Sbjct: 311 LNEAVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSL 356

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 73/101 (72%), Gaps = 1/101 (0%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPT-NVIYYANRAAAYSSVKEYDNAIKDA 156
           +AE FK +GN A  AKD+  A E +S+AI++  T N + Y+NR+A Y+S+K++  A++DA
Sbjct: 2   SAEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDA 61

Query: 157 EKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
           E+ ++I+P +SKGY+R+  A+Y L   ++A + YKK L+++
Sbjct: 62  EECVKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEID 102

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 50/90 (55%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +L+G +     D+  A+  Y+E IK  P +   Y+NRAA  + +  + +AIKD + 
Sbjct: 401 AEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDV 460

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
           AI  DP + + Y R A A+ A+ +   A+E
Sbjct: 461 AISKDPNFVRAYIRKASAQIAVREFAPAME 490

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 73/131 (55%), Gaps = 8/131 (6%)

Query: 71  ASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLP 130
           ++A S  S   + ++V+ P  + + KA A++ K EGNK   A+ +  AIE Y++A   L 
Sbjct: 239 STAESDLSADADKMEVDEPEPEQDSKAKADAEKAEGNKYYKARKFDEAIEHYNKAW-DLH 297

Query: 131 TNVIYYANRAAAYSSVKEYDNAIKDAEKAI----EIDPAY---SKGYSRLAFAKYALNKP 183
            +V Y  NR+AA     +Y+ AIK   +A+    E+   Y   SK ++R+  A   ++  
Sbjct: 298 RDVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQGREMRADYKLISKSFARIGNAYLKMDDL 357

Query: 184 EEALEYYKKVL 194
           ++A+E+Y++ L
Sbjct: 358 KKAIEFYQRSL 368

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 75/101 (74%), Gaps = 1/101 (0%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPT-NVIYYANRAAAYSSVKEYDNAIKDA 156
           +A+ FK +GN A  AKDY  AI+ +++AI+   T N + Y+NR+A Y+S K+++ A+KDA
Sbjct: 2   SADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDA 61

Query: 157 EKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
           E+ ++I P++SKGY+R+  A++ L++ +EA + YK+ L+++
Sbjct: 62  EECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELD 102

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 52/90 (57%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +L+G +     D+  A++ Y+E +K  P +   ++NRAAA + +  +  AI+D  K
Sbjct: 380 AEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNK 439

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
           A+ IDP + + Y R A A+ A+ +   A+E
Sbjct: 440 AVSIDPNFVRAYIRKATAQIAVKEFAAAIE 469

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 80/176 (45%), Gaps = 38/176 (21%)

Query: 56  QDKFSGKTLKEILSSASAT-------STGSEKEESVKVNIPV------------------ 90
           QD F+ K L  I+++           S GSE +ES K   P                   
Sbjct: 173 QDLFTDKRLMTIMAALLGIDLNMGDPSAGSEAQESAKPKEPESNPEPRKEPKQEPKQEPE 232

Query: 91  -----EDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSS 145
                E+   +  AE+ K EGNK   A+ +  AIE Y++A + L  ++ Y  NR+AA   
Sbjct: 233 AMEVDEEPNSRVAAEAEKAEGNKLYKARQFEEAIEHYNKAWE-LHKDITYLNNRSAAEFE 291

Query: 146 VKEYDNAIK---DA-EKAIEIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVL 194
             +YD AIK   DA E+  E+   Y   +K ++R+  A Y L    +A+E+Y + L
Sbjct: 292 KGDYDTAIKTLNDAVEQGRELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPT-NVIYYANRAAAYSSVKEYDNAIKDA 156
           TA+ +K EGN A  AKDY+ AI+ +++AI+   T N + Y+NR+AAY+S K+Y+ A+ DA
Sbjct: 4   TADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDA 63

Query: 157 EKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKA 201
           ++ I+I+P+++KGY+R   A   L+K EEA + Y + L ++ + A
Sbjct: 64  DECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 93/209 (44%), Gaps = 29/209 (13%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +LEG +     D+  A++ Y+E IK  P +   Y+NRAAA + +  + +AI D  K
Sbjct: 385 AEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNK 444

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVES 218
           AIE DP++ + Y R A  + A+ +   A+E     LD         + R+ +  KN  E 
Sbjct: 445 AIEKDPSFIRAYLRKATCQIAVKEFAGAIE----TLD---------LARERDDGKNGNEI 491

Query: 219 SMNLEKSSTTTPEPSRSAGQQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAA 278
           +    K+S    +P+    + P   +A   M D                    P ++   
Sbjct: 492 NQLYAKASAQRFQPA-EGNETPEETYA-RAMKD-----------PEVAKIMQDPVMVSIL 538

Query: 279 QQMMSDPNSMQKMQEMMQNPNLREMAQNL 307
           QQ  +DP +   +QE M+NP +    Q L
Sbjct: 539 QQAQNDPAA---LQEHMKNPEVFRKIQTL 564

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 56/103 (54%), Gaps = 8/103 (7%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD--- 155
           A+  K EGNKA  A+ +  AI  Y++A +T   ++ Y  NR+AA     +Y+  IK    
Sbjct: 251 ADKAKAEGNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTE 309

Query: 156 -AEKAIEIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVL 194
             E A E+   Y   +K ++R+  A   L+  ++A+EYY+K L
Sbjct: 310 AVENARELRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSL 352

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 87.0 bits (214), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 73/101 (72%), Gaps = 1/101 (0%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIK-TLPTNVIYYANRAAAYSSVKEYDNAIKDA 156
           +A+ +K +GN A AAKD+  AIE +++AI+ +   N + Y+NR+A Y+S K+++ A++DA
Sbjct: 2   SADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDA 61

Query: 157 EKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
           ++ + I+PA+SKGY+R+  A + L   +EA + YKK L+++
Sbjct: 62  KQCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELD 102

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 63/106 (59%), Gaps = 8/106 (7%)

Query: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155
           KA A++ K EGNK   A+ +  AIE YS+A + L  ++ Y  NRAAA     EY+ AIK 
Sbjct: 256 KAKADAEKAEGNKFYKARKFDEAIEHYSKAWE-LHKDITYLNNRAAAEYEKGEYETAIKT 314

Query: 156 AEKAI----EIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVL 194
             +A+    E+   Y   SK ++R+  + + LN+ ++A+E+Y+K L
Sbjct: 315 LTEAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 46/82 (56%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +L+G +     D+  A++ Y+E IK  P +   Y+NRAAA S +  +  AIKD   
Sbjct: 393 AEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNV 452

Query: 159 AIEIDPAYSKGYSRLAFAKYAL 180
           AI  DP + + Y R A A+ A+
Sbjct: 453 AISKDPNFIRAYIRKATAQIAV 474

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 87.0 bits (214), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 114/244 (46%), Gaps = 63/244 (25%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKT--LPTNVIYYANRAAAYSSVKEYDNAIKD 155
           +A+ +K +GN A  AKDY  AI+ +S+AI     P +V+Y +NR+A Y+S+K++ NA+KD
Sbjct: 4   SADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLY-SNRSACYTSLKKFVNALKD 62

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNR 215
           AE+ ++I+P++SKGY+R+  A + +   +EA   YKK L++  D +  A +   E     
Sbjct: 63  AEECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALEL--DASNKAAQEGLEQVHRT 120

Query: 216 VESSMNLEKSSTTTPEPSRSAGQQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVM 275
            ES                             GMPD                        
Sbjct: 121 QESR---------------------------RGMPDM----------------------- 130

Query: 276 QAAQQMMSDPNSMQKMQ------EMMQNPNL-REMAQNLASGDANLDDLMNNPSVKDMAN 328
               QM +DPN ++ ++      EMM++P L  ++ Q  ++  A   DL  +P +  +  
Sbjct: 131 -GLTQMFNDPNLIENLKKNPKTAEMMKDPQLVAKLIQYRSNPQAISQDLFTDPRLMTIMA 189

Query: 329 NLFG 332
            L G
Sbjct: 190 TLMG 193

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 66  EILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEA 125
           EILS   A       E+ VK+    ED      AE  +LEG       D+  A++ Y+E 
Sbjct: 371 EILSKLRAA------EKQVKIQ-EAEDYINPEKAEEARLEGKDYFTKGDWPNAVKAYTEM 423

Query: 126 IKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEE 185
           IK  P +   Y+NRAA  S +  +  AI D  KAIE DP + + Y R A A+ A+ +   
Sbjct: 424 IKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRKATAQIAVREFSS 483

Query: 186 ALE 188
           ALE
Sbjct: 484 ALE 486

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 52/98 (53%), Gaps = 8/98 (8%)

Query: 104 LEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEID 163
            EGNK   A+ +  A+ KY+EA +    ++ Y  NR+AA     +Y+ +IK  E+A+E  
Sbjct: 268 AEGNKLYKARQFDEAVAKYNEAWEA-HNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKG 326

Query: 164 -------PAYSKGYSRLAFAKYALNKPEEALEYYKKVL 194
                     +K ++R+      LN  ++A+++YKK L
Sbjct: 327 REMRADYKVIAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 86.7 bits (213), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 70/102 (68%), Gaps = 3/102 (2%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKT--LPTNVIYYANRAAAYSSVKEYDNAIKD 155
           TAE +K EGN A AAKD+  AIE + +AI+    P +V+Y +NR+A Y+S++++  A+ D
Sbjct: 3   TAEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLY-SNRSACYASMRKFREALAD 61

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
           A++ + I P +SKG++RL  A Y L   +EA E YKK L+++
Sbjct: 62  AQECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELD 103

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 53/90 (58%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +L+G +     D+  A++ Y+E IK  P +   Y+NRAAA + +  + +AIKD + 
Sbjct: 388 AEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDM 447

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
           AI+ DP + + Y R A A+ A+ +   A+E
Sbjct: 448 AIQKDPNFVRAYIRKATAQIAVQEYAAAIE 477

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 8/106 (7%)

Query: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155
           ++ AE  K +GN+    + +  AI  Y +A   L  ++ Y  NRAAA     +Y++AIK 
Sbjct: 251 RSKAEEAKAKGNELYKKRQFDEAIANYEKAW-DLHKDITYLNNRAAAEYEKGDYESAIKT 309

Query: 156 AEKAI----EIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVL 194
            EKA+    E+   Y   +K ++RL  A Y L   ++A+EYY+K L
Sbjct: 310 LEKAVEEGRELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 86.3 bits (212), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPT-NVIYYANRAAAYSSVKEYDNAIKDA 156
           TA+ +K +GN A  AKDY  AIE +++AI+   T N + Y+NR+A Y+S+K++ +A+ DA
Sbjct: 4   TADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDA 63

Query: 157 EKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEG 198
            + ++I+P++SKGY+RL  A   L   +EA   YKK L+++ 
Sbjct: 64  NECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDA 105

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 51/90 (56%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +LEG +     D+  A++ Y+E IK  P +   Y+NRAAA + +  +  AI D  K
Sbjct: 396 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNK 455

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
           AIE DP + + Y R A A+ A+ +   ALE
Sbjct: 456 AIEKDPNFVRAYIRKATAQIAVKEYASALE 485

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 82/156 (52%), Gaps = 12/156 (7%)

Query: 79  EKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYAN 138
           E +ES  + +  +D++I+A  E  K EGNK   A+ +  AIE Y++A + L  ++ Y  N
Sbjct: 244 ESKESEPMEVDEDDSKIEADKE--KAEGNKFYKARQFDEAIEHYNKAWE-LHKDITYLNN 300

Query: 139 RAAAYSSVKEYDNAI---KDA-EKAIEIDPAY---SKGYSRLAFAKYALNKPEEALEYYK 191
           RAAA     EY+ AI    DA E+  E+   Y   SK ++R+  A + L   ++ +EYY+
Sbjct: 301 RAAAEYEKGEYETAISTLNDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQ 360

Query: 192 KVL--DMEGDKATPAMKRDFEMAKNRVESSMNLEKS 225
           K L      D  T     + E+ K   E+ +N EK+
Sbjct: 361 KSLTEHRTADILTKLRNAEKELKKAEAEAYVNPEKA 396

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 69/101 (68%), Gaps = 1/101 (0%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPT-NVIYYANRAAAYSSVKEYDNAIKDAE 157
           A+ +K +GN A  AKDY  AIE +++AI+   T N + Y+NR+A Y+S+K++ +A+ DA+
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAK 64

Query: 158 KAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEG 198
           + I I+P++SKGY+RL  A   L   +EA   YKK L+++ 
Sbjct: 65  ECININPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDA 105

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 92/225 (40%), Gaps = 48/225 (21%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +LEG       D+  A++ Y+E IK  P +   Y+NRAAA + +  +  AI D  K
Sbjct: 396 AEEARLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNK 455

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVES 218
           AIE DP + + Y R A A+ A+ +   ALE     LD    K                ++
Sbjct: 456 AIEKDPNFVRAYIRKATAQIAVQEYAAALE----TLDAARTK----------------DA 495

Query: 219 SMNLEKSSTTTPEPSRSAGQQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAA 278
            +N   SS    +    A QQ   P  G+  P+                        +  
Sbjct: 496 DVNNGASSREIDQLYYKASQQRFQPGTGNETPE------------------------ETY 531

Query: 279 QQMMSDPNSMQKMQEMMQNPNLREMAQNLASGDANLDDLMNNPSV 323
           Q+ M DP    ++  +MQ+P ++ + Q      A L + M NP V
Sbjct: 532 QRAMKDP----EVAAIMQDPVMQSILQQAQQNPAALQEHMKNPEV 572

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 75/145 (51%), Gaps = 10/145 (6%)

Query: 90  VEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEY 149
           V++ + KA A+  K EGNK   A+ +  AIE Y++A + L  ++ Y  NRAAA     EY
Sbjct: 253 VDEDDSKAEADKEKAEGNKFYKARQFDEAIEHYNKAWE-LHRDITYLNNRAAAEYEKGEY 311

Query: 150 DNAI---KDA-EKAIEIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVL--DMEGDK 200
             AI    DA E+  E+   Y   S+ ++R+  A + L   ++ +EYY+K L      D 
Sbjct: 312 KTAIATLNDAVEQGREMRADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADI 371

Query: 201 ATPAMKRDFEMAKNRVESSMNLEKS 225
            T     + E+ K   E+ +N EK+
Sbjct: 372 LTKLRNAEKELKKAEAEAYINPEKA 396

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 73/102 (71%), Gaps = 3/102 (2%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKT--LPTNVIYYANRAAAYSSVKEYDNAIKD 155
           +AE FK +GN A  AKDY  A E +++AI+    P +V+Y +NR+A ++S+K+++ A+ D
Sbjct: 2   SAEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLY-SNRSACFTSLKKFNEALND 60

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
           A + ++I+PA+SKGY+R+  A + L K +EA + YKK L+++
Sbjct: 61  ANECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEID 102

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 58/111 (52%), Gaps = 3/111 (2%)

Query: 78  SEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYA 137
            EKE+ V+      D E    AE  +L+G +     D+  A++ Y+E  K  P +   Y+
Sbjct: 383 CEKEQKVREAQAYIDPE---KAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYS 439

Query: 138 NRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
           NRAAA + +  +  AIKD + AI  DP + + Y R A A+ A+ +   A+E
Sbjct: 440 NRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRKATAQIAVREFASAIE 490

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 65/118 (55%), Gaps = 8/118 (6%)

Query: 84  VKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAY 143
           ++V+ P  + + K  A++ K EGNK   A+ +  AIE Y++A   L  +V Y  NR+AA 
Sbjct: 252 MEVDEPQPEQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAW-DLHKDVTYLNNRSAAE 310

Query: 144 SSVKEYDNAIKDAEKAI----EIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVL 194
               +Y+ AIK   +A+    E+   Y   SK ++R+  A   L   ++A+E+Y+K L
Sbjct: 311 YEKGDYEQAIKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 71/102 (69%), Gaps = 1/102 (0%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPT-NVIYYANRAAAYSSVKEYDNAIKDA 156
           +A+ +K +GN A +AK+Y  A++ +S+AI+  P  N + Y+NR+A Y+S+K++ +A+ DA
Sbjct: 4   SADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDA 63

Query: 157 EKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEG 198
            +  +I+P +SKGY+R+  A Y L   +EA + YKK L+++ 
Sbjct: 64  NECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDA 105

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 112/268 (41%), Gaps = 56/268 (20%)

Query: 59  FSGKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKAT---AESFKLEGNKAMAAKDY 115
           F  K+L E  + A+ T     K  S++  I V++AE       AE  +++G        +
Sbjct: 354 FFNKSLTEFRTPATLT-----KLRSLEKKIKVQEAEAYINPEKAEEARIQGKDFFNKGQW 408

Query: 116 RLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAF 175
             A++ Y+E I   P +   Y+NRAAA S +  +  AI D EKA+E DP + K Y R A 
Sbjct: 409 PDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKAT 468

Query: 176 AKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRS 235
           A+ A+ +   ALE     LD+       A  +D E+        +N   +  T       
Sbjct: 469 AQIAIKEYSSALE----TLDI-------ARSKDTELNNGSNIREINQLYAKAT------- 510

Query: 236 AGQQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMMSDPNSMQKMQEMM 295
             QQ   P + +  P+                        Q  Q+ M DP    ++  +M
Sbjct: 511 --QQRFEPASSNETPE------------------------QTYQRAMKDP----EVAAIM 540

Query: 296 QNPNLREMAQNLASGDANLDDLMNNPSV 323
           Q+P ++ + Q   +  A L + M NP +
Sbjct: 541 QDPVMQSILQQAQTNPAALQEHMKNPEI 568

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 82/173 (47%), Gaps = 15/173 (8%)

Query: 87  NIPVEDAEI-KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSS 145
           N+ V+DA++ K  A++ K EGNK   A  +  AIE Y +A + L  ++ Y  N+AAA   
Sbjct: 245 NMEVDDADVQKKLADAEKDEGNKLYKAHKFDEAIEHYDKAWE-LHNDITYLNNKAAAQYE 303

Query: 146 VKEYDNAIKDAEKAI----EIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVLDMEG 198
             +Y+  IK  E AI    E+   Y   +K ++R+  A   LN  ++A E++ K L    
Sbjct: 304 KGDYETTIKTLEDAIEKGRELRADYKIIAKAFTRMGNAYEKLNDLKKAAEFFNKSLTEFR 363

Query: 199 DKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQPANPFAGSGMPD 251
             AT    R  E  K +V+     E  +   PE +  A  Q  + F     PD
Sbjct: 364 TPATLTKLRSLE-KKIKVQ-----EAEAYINPEKAEEARIQGKDFFNKGQWPD 410

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 116/245 (47%), Gaps = 63/245 (25%)

Query: 97  ATAESFKLEGNKAMAAKDYRLAIEKYSEAI--KTLPTNVIYYANRAAAYSSVKEYDNAIK 154
           +TA+  K +GN A A+KD+  AIE ++EAI   T P +V+Y +NR+A Y+S+K++  A+ 
Sbjct: 2   STADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLY-SNRSACYTSLKQFQEALN 60

Query: 155 DAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKN 214
           DA++ ++I+P +SKGY+R+  A   L   ++A   YKK L+++ +          + A  
Sbjct: 61  DAQQCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNN---------KAASE 111

Query: 215 RVESSMNLEKSSTTTPEPSRSAGQQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQV 274
            +E    +++S  + P+                GM                         
Sbjct: 112 GLEQVHRVQESRKSRPD---------------FGM------------------------- 131

Query: 275 MQAAQQMMSDPNSMQKMQE------MMQNPNLREMAQNLASGDANL-DDLMNNPSVKDMA 327
                +M SDPN ++K+++      MM +P+L    Q+  S    L  DLM +P +  + 
Sbjct: 132 ----TEMFSDPNLIEKLRQNPKTKDMMNDPSLVAKLQSYKSNPQGLSSDLMGDPRLMTIM 187

Query: 328 NNLFG 332
             L G
Sbjct: 188 ATLLG 192

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 65/217 (29%), Positives = 96/217 (44%), Gaps = 35/217 (16%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +LEG +     D+  A++ Y+E IK  P +   Y+NRAAA + +  +  AIKD EK
Sbjct: 390 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEK 449

Query: 159 AIEIDPAYSKGYSRLAFAKYALN---KPEEALEYYKKVLDM--EGDKATPAMKRDFEMAK 213
           AIE DP + + Y R A A+ A+    K  E LE  KK  D    G  +   MK   +  +
Sbjct: 450 AIEKDPNFVRAYLRKATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEIMKLQMKATQ 509

Query: 214 NRVESSMNLEKSSTTTPEPSRSAGQQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQ 273
            R ++      +   TPE +     Q  +P   + M D                    P 
Sbjct: 510 ERFQAP-----TGNETPEETYKRAMQ--DPEVAAIMQD--------------------PV 542

Query: 274 VMQAAQQMMSDPNSMQKMQEMMQNPNLREMAQNLASG 310
           +    QQ  +DP +   +QE M+NP + +  Q L S 
Sbjct: 543 MQSILQQAQNDPAA---LQEHMKNPEISKKIQVLVSA 576

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 63/130 (48%), Gaps = 10/130 (7%)

Query: 105 EGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAI---- 160
           EGNK   +  +  AI +Y++A   L  ++ Y  NR+AA     +++ A+    +A+    
Sbjct: 262 EGNKLYKSHKFDEAIAEYNKAW-DLHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGR 320

Query: 161 EIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVL--DMEGDKATPAMKRDFEMAKNR 215
           E+   Y   +K ++R+  A       ++A+EYY+K L      D  T     + E+ K  
Sbjct: 321 ELRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSLTEHRTADILTKLRTCEKELKKQE 380

Query: 216 VESSMNLEKS 225
           +E  +N EK+
Sbjct: 381 IEEYINPEKA 390

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 73/102 (71%), Gaps = 3/102 (2%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKT--LPTNVIYYANRAAAYSSVKEYDNAIKD 155
           +A+ FK EGN+A A+KDY  AIE +++AI+    P +V++ +NR+A Y+S K++  A+ D
Sbjct: 2   SADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLF-SNRSACYASNKDFVKALDD 60

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
           A + ++I+P+++KGY+RL  A Y L   +EA + YKK L+++
Sbjct: 61  ANECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELD 102

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 52/90 (57%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +L+G +     D+  A+E Y+E IK  P +   Y+NRAAA S +  + +AI+D +K
Sbjct: 389 AEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDK 448

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
           AIE DP + + Y R A  + A+     A+E
Sbjct: 449 AIEKDPNFVRAYIRKATGQIAIKDYAGAIE 478

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 78/146 (53%), Gaps = 10/146 (6%)

Query: 89  PVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKE 148
           P+E  + K+ AE+ K EGNK    + +  AIEKY+EA +T   ++ Y  NRAAA     +
Sbjct: 245 PMEVDDDKSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGD 303

Query: 149 YDNAIKDAEKAI----EIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVLDMEG--D 199
           Y+ AI+   KA+    E+   Y   SK ++R+  + + L   ++A++YY+K L      D
Sbjct: 304 YEAAIETLTKAVEQGRELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSLTEHRTPD 363

Query: 200 KATPAMKRDFEMAKNRVESSMNLEKS 225
             T     + E+ +   ES M+ EK+
Sbjct: 364 ILTKLRNTEKELKQKEAESYMDPEKA 389

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 78/127 (61%), Gaps = 5/127 (3%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKT--LPTNVIYYANRAAAYSSVKEYDNAIKD 155
           +A+ +K +GN A  AKDY  A E + +AI     P +V+Y +NR+A Y+S+K++   +KD
Sbjct: 3   SADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLY-SNRSACYTSLKKFAEGLKD 61

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNR 215
           AE+ ++I+P +SKGY+R+  A++ LN  E+A + Y+K L++  D A  A K   +     
Sbjct: 62  AEECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALEL--DSANKAAKEGLDQVLKT 119

Query: 216 VESSMNL 222
            ES   +
Sbjct: 120 RESRQQM 126

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 53/90 (58%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +LEG +  +  D+  A++ Y+E IK  P +   Y+NRAAA + +  +  AI D ++
Sbjct: 382 AEEARLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDR 441

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
           AIE DP + + Y R A A+ A+ +   A+E
Sbjct: 442 AIEKDPNFIRAYIRKASAQIAVKEFAAAVE 471

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 64/126 (50%), Gaps = 13/126 (10%)

Query: 81  EESVKVNIPVEDAEI-----KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIY 135
           EE +K N   E  E+     +  AE  K EGNK   A+ +  AIE Y++A + L  ++ Y
Sbjct: 225 EEPLKENNEPEPMEVDEKGPQVAAEEEKAEGNKFYKARKFDEAIEHYNKAWE-LHKDITY 283

Query: 136 YANRAAAYSSVKEYDNAIKDAEKAI----EIDPAY---SKGYSRLAFAKYALNKPEEALE 188
             NRAAA     +Y+ AI     A+    E+   Y   +K ++R+  A + L   ++++ 
Sbjct: 284 LNNRAAAEYEKGDYETAIATLTNAVDEGREMRADYKVIAKSFARIGNAYHKLGDLKKSIN 343

Query: 189 YYKKVL 194
           +Y+K L
Sbjct: 344 FYQKSL 349

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 82.8 bits (203), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIK-TLPTNVIYYANRAAAYSSVKEYDNAIKDA 156
           +AE +K EGN A  AKD++ A+E ++ AI+ +   N + Y+NR+ AY+S+K++D A+ DA
Sbjct: 3   SAEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDA 62

Query: 157 EKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEG 198
            + ++I   +SKG++RL  A + L   +EA E YKK L+++ 
Sbjct: 63  TECVKIKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDA 104

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +L+G +     D+  A++ YSE I   P +   Y+NRAAA S +  + +AIKD +K
Sbjct: 392 AEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDK 451

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
           AIEIDP++ + Y R A A+ A+ +   A+E
Sbjct: 452 AIEIDPSFVRAYIRKATAQIAVQEYSAAIE 481

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 64/120 (53%), Gaps = 11/120 (9%)

Query: 85  KVNIPVEDAEI---KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAA 141
           K   P E  E+   +  AE  K EGN+    + +  AI KY EA   L  ++ Y  NRAA
Sbjct: 241 KTQTPPEPMEVDLDRENAEKAKAEGNQLYKQRKFDEAIAKYEEAW-NLQKDITYLNNRAA 299

Query: 142 AYSSVKEYDNAIKDAEKAIE----IDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVL 194
           A     +Y++AIK   +A+E    +   Y   +K ++RL  A Y L++ ++A+EYY+K L
Sbjct: 300 AEYEKGDYNSAIKTLNEAVEQGRELRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 70/101 (69%), Gaps = 1/101 (0%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPT-NVIYYANRAAAYSSVKEYDNAIKDA 156
           TA+ +K +GN A  AK+Y  AIEK+++AI+   T N + Y+NR+A Y+S K++   ++DA
Sbjct: 4   TAQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDA 63

Query: 157 EKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
            + ++I+P +SKGY+R+  A + +   +EA + YKK L+++
Sbjct: 64  NECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELD 104

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 46/82 (56%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +LEG +     D+  A++ Y+E I   P++   Y+NRAAA S +  +  AI D   
Sbjct: 389 AEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNT 448

Query: 159 AIEIDPAYSKGYSRLAFAKYAL 180
           AIE DP + + Y R A A+ A+
Sbjct: 449 AIEKDPNFIRAYIRKATAQIAI 470

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 61/113 (53%), Gaps = 10/113 (8%)

Query: 89  PVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKE 148
           P ++++I A AE  K EGNK   A  +  AIE Y++A + L  ++ Y  NR+AA     +
Sbjct: 247 PEDESKIAADAE--KAEGNKLYKAHKFDEAIEHYNKAWE-LHNDITYLNNRSAAEFEKGD 303

Query: 149 YDNAIKD----AEKAIEIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVL 194
           Y  AI+      EK  E+   Y   +K ++R+A +   LN  + A+ YY+K L
Sbjct: 304 YQTAIETLHEAVEKGREMRADYKLVAKSFTRIANSYMKLNDIKSAINYYQKSL 356

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 73/104 (70%), Gaps = 3/104 (2%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKT--LPTNVIYYANRAAAYSSVKEYDNAIKD 155
           TA+ +K +GN A  AK+Y  AIE +++AI+    P++V++ +NR+A Y+S+K++ +A+ D
Sbjct: 4   TADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLF-SNRSACYTSLKKFSDALND 62

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD 199
           A + ++I+P++SKGY+RL  A   L   +EA   YKK L+++ +
Sbjct: 63  ANECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDAN 106

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 97/225 (43%), Gaps = 48/225 (21%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +LEG +     D+  A++ Y+E IK  P +   Y+NRAAA + +  +  AI D  K
Sbjct: 396 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNK 455

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVES 218
           AIE DP + + Y R+A A+ A+ +   ALE     LD+       A  +D E+ K     
Sbjct: 456 AIEKDPNFVRAYIRMAAAQIAVKEFAAALE----TLDV-------ARTKDAEVNKG---- 500

Query: 219 SMNLEKSSTTTPEPSRSAGQQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAA 278
                 S+    +    A QQ   P  GS  P+                        +  
Sbjct: 501 -----ASAKEIDQLYYKASQQRFQPDTGSETPE------------------------ETY 531

Query: 279 QQMMSDPNSMQKMQEMMQNPNLREMAQNLASGDANLDDLMNNPSV 323
           Q+ M DP    ++  +MQ+P ++ + Q      A L + M NP+V
Sbjct: 532 QRAMKDP----EVAAIMQDPVMQSILQQAQQNPAALQEHMKNPAV 572

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 60/112 (53%), Gaps = 8/112 (7%)

Query: 90  VEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEY 149
           V++   KA A++ K EGNK   A  +  AIE Y+ A + L  ++ Y  NRAAA     +Y
Sbjct: 253 VDEDNSKAEADNEKAEGNKFYKAHQFDEAIEHYNRAWE-LHKDITYLNNRAAAEYEKGDY 311

Query: 150 DNAI---KDA-EKAIEIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVL 194
           +  I    DA EK  ++   Y   SK ++R+  A + L   ++ +EYY+K L
Sbjct: 312 ETVIATLNDAVEKGRDMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 71/103 (68%), Gaps = 3/103 (2%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKT--LPTNVIYYANRAAAYSSVKEYDNAIKD 155
           TA+ +K +GN A  AKDY  AI+ +++AI+    P +V+Y +NR+A Y+S+K++ +A+ D
Sbjct: 4   TADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLY-SNRSACYTSLKKFTDALND 62

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEG 198
           A + ++I+P++SKGY+RL  A   L   ++A   YKK L+++ 
Sbjct: 63  ATECVKINPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDA 105

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 51/90 (56%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +LEG +     D+  A++ Y+E IK  P +   Y+NRAAA + +  +  AI D  K
Sbjct: 393 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNK 452

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
           AIE DP + + Y R A A+ A+ +   ALE
Sbjct: 453 AIEKDPNFVRAYIRKATAQIAVQEFAGALE 482

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 88/170 (51%), Gaps = 16/170 (9%)

Query: 69  SSASATSTGSEKEESVKVNIPVE----DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSE 124
           ++ S +S+ + ++E  K   P+E    D++++A  E  K EGNK   A+ +  AIE Y++
Sbjct: 227 TTKSESSSKAPQQEETKEAEPMEVDEDDSKVEADKE--KAEGNKFYKARQFEEAIEHYNK 284

Query: 125 AIKTLPTNVIYYANRAAAYSSVKEYDNAI---KDA-EKAIEIDPAY---SKGYSRLAFAK 177
           A + L  ++ Y  NRAAA     +Y+ AI    DA E+  E+   Y   SK ++R+  A 
Sbjct: 285 AWE-LHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQGREMRADYKVISKSFARIGNAY 343

Query: 178 YALNKPEEALEYYKKVL--DMEGDKATPAMKRDFEMAKNRVESSMNLEKS 225
           + L   ++ ++ Y+K L      D  T     + E+ K   E+ +N EK+
Sbjct: 344 HKLGDLKKTIDNYQKSLTEHRTADILTKLRNAEKELKKAEAEAYINPEKA 393

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 109/222 (49%), Gaps = 26/222 (11%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPT-NVIYYANRAAAYSSVKEYDNAIKDA 156
           TA+ +K +GN A AAK Y  A++ +++AI+   T N + Y+NR+A+Y+S ++++ A+KDA
Sbjct: 4   TADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDA 63

Query: 157 EKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRV 216
            +  +I+P+++KGY+R   A + +   ++A   YKK L+++ +          ++AK  +
Sbjct: 64  LECTKINPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANN---------KIAKEGI 114

Query: 217 ESSMNLEKSSTTTPEPSRSAGQQPANPFAG-SGMPDXXXXXXXXXXXXXXXXXXXXPQVM 275
           E             +  R   Q+ A P  G + M +                    PQ++
Sbjct: 115 E-------------QIQRVQSQRQAQPDLGLTEMFNDPNLIEKLKNNPKTAELMNDPQLV 161

Query: 276 QAAQQMMSDPNSMQKMQEMMQNPNLREMAQNLASGDANLDDL 317
                  S+PN +   Q++  +P L  +   L   D N+ DL
Sbjct: 162 AKLLSFRSNPNGL--AQDLFSDPRLMTIMGTLMGIDLNMPDL 201

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 95/225 (42%), Gaps = 48/225 (21%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           AE  +LEG +     D+  A++ Y+E IK  P +   Y+NRAAA S +  + +AI D  K
Sbjct: 385 AEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNK 444

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVES 218
           AIE DP + + Y R A A+ A+     A+E     LD        A  +D E        
Sbjct: 445 AIEKDPNFVRAYIRKATAQIAVKDFSYAIE----TLDA-------ARTKDAE-------- 485

Query: 219 SMNLEKSSTTTPEPSRSAGQQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAA 278
            +N   ++    +    A QQ   P  G   P+                        Q  
Sbjct: 486 -VNGGANAREIDQLYMKAAQQRFQPATGDETPE------------------------QTY 520

Query: 279 QQMMSDPNSMQKMQEMMQNPNLREMAQNLASGDANLDDLMNNPSV 323
           ++ M DP    ++ ++MQ+P L+ + Q   +  A L + M NP +
Sbjct: 521 ERAMRDP----EVAKIMQDPVLQSILQQAQNDPAALQEHMKNPEI 561

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 61/112 (54%), Gaps = 8/112 (7%)

Query: 90  VEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEY 149
           V+  E K  AE  K+EGNKA  A+++  AI  Y++A + L  N+ Y  NR+AA     EY
Sbjct: 242 VDQDESKVAAEEAKVEGNKAYKARNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGEY 300

Query: 150 DNAIKDAEKAI----EIDPAY---SKGYSRLAFAKYALNKPEEALEYYKKVL 194
           D AI    +AI    E+   Y   +K ++R+  A   +   +EA+ +Y+K L
Sbjct: 301 DTAINTLNEAIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 58/103 (56%), Gaps = 1/103 (0%)

Query: 95  IKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN-VIYYANRAAAYSSVKEYDNAI 153
           +  +++  K  GNK    K Y  A+  ++ A+    TN  I Y+NRAAA+  +K Y  A+
Sbjct: 4   VSMSSQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEAL 63

Query: 154 KDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDM 196
           +D +  +E+ P + KGYSR+  A   L K +EA E +KK L +
Sbjct: 64  EDGKNCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQL 106

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E  ++EG +    ++Y  A++ Y+E IKT PT+ + + NRAA +  +      I D +KA
Sbjct: 430 EEARIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKA 489

Query: 160 IEIDPAYSKGYSRLAFAKYALNKPEEALEYY 190
           I +DP+Y K Y R  FA+      +EALE +
Sbjct: 490 ISVDPSYIKAYVRKGFAQITERDLDEALETW 520

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 53/92 (57%)

Query: 89  PVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKE 148
           P  D+   ATA  +K EGN+ + AKDY  A+E Y+ AI+   T  I+++NRA A   +  
Sbjct: 28  PRRDSMTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDR 87

Query: 149 YDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180
           + +A++D+ +AIE+D    K Y R   A   L
Sbjct: 88  FQSALEDSARAIELDAGNVKAYHRRGLAHCGL 119

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 47/84 (55%)

Query: 97  ATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDA 156
           A A  FK  GN A+  +DY  AIE Y+EAIK   T  IY++NRA  +  +  + + I D 
Sbjct: 10  AKALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDC 69

Query: 157 EKAIEIDPAYSKGYSRLAFAKYAL 180
           +KA+EIDP   K Y R   +   L
Sbjct: 70  DKALEIDPKNIKAYHRRGMSYIGL 93

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 53/91 (58%), Gaps = 3/91 (3%)

Query: 90  VEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEY 149
           V D E+   A S+K EGNK +  +D++ A E Y++AI+T PT  I+Y+NRA A   +  +
Sbjct: 3   VYDTEL---ATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNF 59

Query: 150 DNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180
            NA+ D   AIE++ +  K Y R   A   L
Sbjct: 60  MNALNDCTNAIELNSSNLKAYHRRGLANIGL 90

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 52/92 (56%), Gaps = 2/92 (2%)

Query: 89  PVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKE 148
           P E   +KA     K EGN  +  K +  AIEKY+EAI    T  IY++NRA ++  V  
Sbjct: 4   PTEADRVKAHER--KNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDN 61

Query: 149 YDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180
           + +A+ D ++AI++DP   K Y R A +  AL
Sbjct: 62  FQSALNDCDEAIKLDPKNIKAYHRRALSCMAL 93

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (58%)

Query: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155
           +A A   K EGN  +  K +  AIEKY+EAI    T  IY++NRA A+  V  + +A+ D
Sbjct: 9   RAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYAL 180
            ++AI++DP   K Y R A +  AL
Sbjct: 69  CDEAIKLDPKNIKAYHRRALSCMAL 93

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%)

Query: 105 EGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDP 164
           EGN  +  K +  AIEKY+EAI    T  IY++NRA A+  V  + +A+ D ++AI++DP
Sbjct: 18  EGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDP 77

Query: 165 AYSKGYSRLAFAKYAL 180
              K Y R A +  AL
Sbjct: 78  KNIKAYHRRALSCMAL 93

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A  +K +GNK +A+KDY  AIE Y++AI+      I+++NRA A   +  + +A++D+ K
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 159 AIEIDPAYSKGYSRLAFAKYAL 180
           AIE+D +  KGY R   A   L
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGL 90

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 49/109 (44%), Gaps = 8/109 (7%)

Query: 128 TLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEAL 187
           T+    + Y ++   + + K+Y  AI+   KAIE+D   S  +S  A A   L++ + AL
Sbjct: 4   TIVPEALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSAL 63

Query: 188 EYYKKVLDMEGDKATPAMKR--------DFEMAKNRVESSMNLEKSSTT 228
           E   K ++++        +R        DF  AK  +E  + ++    T
Sbjct: 64  EDSSKAIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVKPGEAT 112

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 50/85 (58%)

Query: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155
           +A A   K EGN  +  K +  AIEKY++AI    T  IY++NRA A+  V  + +A+ D
Sbjct: 9   RANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYAL 180
            ++A+++DP   K Y R A +  AL
Sbjct: 69  CDEALKLDPKNIKAYHRRALSCMAL 93

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 53/94 (56%)

Query: 93  AEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNA 152
           A+ K  A +FK EGN  +  ++Y  AIE YS+AI+  PT  I+++NRA A   +  + + 
Sbjct: 6   ADAKEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSC 65

Query: 153 IKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEA 186
           + D + A+ +DP   K Y R   +   L + ++A
Sbjct: 66  MNDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKA 99

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 54/101 (53%), Gaps = 4/101 (3%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKT-LPTNVI---YYANRAAAYSSVK 147
           + E    AE+FK +GN     K +R A E YS+ I      N I    YANRAA    +K
Sbjct: 74  EGEPHEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIK 133

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
            Y   I D ++A++++P   K Y R+A A  AL + +EALE
Sbjct: 134 NYRRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEALE 174

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 104 LEGNKA---MAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAI 160
           L  N+A   +  K+YR  I    +A++  P N+  Y   A A+++++  D A++  E   
Sbjct: 121 LYANRAACELEIKNYRRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEALESIEFGE 180

Query: 161 EID 163
           +ID
Sbjct: 181 KID 183

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 45/82 (54%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A  +K EGN  +  +DY  AIEKY +AI+   T  +Y++NRA  +  +  +  A +D +K
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 159 AIEIDPAYSKGYSRLAFAKYAL 180
           A+ +DP   K Y R   A   L
Sbjct: 69  ALALDPKNVKAYHRRGLACVGL 90

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 52/96 (54%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A  FK +GN  +  K++  A E YS+AI+   T  IY++NRA A+  +  +  A+ D  K
Sbjct: 12  ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNK 71

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVL 194
           AIE+DP   K Y R   +   L +  +A +  K VL
Sbjct: 72  AIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVL 107

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 67/125 (53%), Gaps = 5/125 (4%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDN 151
           DAE    A  FK EGN  + ++DY+ AIE Y++AI+   T+ I+Y+NRA A+  +  + +
Sbjct: 8   DAE---AALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQS 64

Query: 152 AIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEM 211
           A+ D   AI++D    K Y R   A   L +  +A      +L  + + AT   KR  EM
Sbjct: 65  ALHDCNDAIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTILLKYKPNDATA--KRGLEM 122

Query: 212 AKNRV 216
            ++ +
Sbjct: 123 CESFI 127

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 64/112 (57%), Gaps = 4/112 (3%)

Query: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVK 147
           +P+E  E K  +   K +GNK   AKDY  AI+ Y+ A+  L  + I+Y+N +A Y S+ 
Sbjct: 113 LPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLG 169

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD 199
           + D  I+ + KA+E++P YSK   R A A  +L    +AL +   VL + GD
Sbjct: 170 QLDKVIESSTKALELNPNYSKALLRRASANESLENYSDAL-FDLSVLSLNGD 220

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 52/99 (52%), Gaps = 4/99 (4%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKT----LPTNVIYYANRAAAYSSVK 147
           + E    AE+FK +GN+   AK ++ A E YS+ +         N   YANRAA    +K
Sbjct: 76  EGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELK 135

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEA 186
            Y   I+D  KA+ I+P   K Y R + A + LNK EEA
Sbjct: 136 NYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 45/76 (59%)

Query: 97  ATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDA 156
           ATA  FK +GN+ +   DY  AIE YS+AI    T  IY++NRA A+     + +A+ D 
Sbjct: 10  ATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDC 69

Query: 157 EKAIEIDPAYSKGYSR 172
           + A+++DP   K Y R
Sbjct: 70  DNALKLDPKNIKAYHR 85

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 94  EIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAI 153
           ++   A + K +GN+   AKD+  AIE Y+ AI +L  + ++Y+NR+AAY S+  ++  +
Sbjct: 99  QVDKYALALKDKGNEFFKAKDFEKAIEYYTLAI-SLKEDPVFYSNRSAAYVSINNFEKVV 157

Query: 154 KDAEKAIEIDPAYSKGYSRLA 174
           +D   A+++ P YSK + R A
Sbjct: 158 EDTTAALKLKPDYSKCWLRRA 178

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 98  TAESFKL--EGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155
           +AE+ KL  EGN  +  +D+  AI+ Y++AI    T  IY++NRA A+  +  + +++ D
Sbjct: 9   SAEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLND 68

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYAL 180
            ++A+++DP  +K Y R   +   L
Sbjct: 69  CDEALKLDPKNAKAYHRRGLSYIGL 93

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 51/101 (50%), Gaps = 4/101 (3%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL----PTNVIYYANRAAAYSSVK 147
           + E    AE+FK +GN     K +R A + Y++ I+        N   +ANRAA    +K
Sbjct: 73  EGEPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELK 132

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
            Y + I D + A+ ++P   K Y R+  A Y LN  EEA E
Sbjct: 133 NYRSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEAKE 173

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKT----LPTNVIYYANRAAAYSSVK 147
           + E    AE+FK +GN+   AK ++ A E Y++ I         N   +ANRAA    +K
Sbjct: 76  EGEPHEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELK 135

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEA 186
            Y   I+D  KA+ I+P   K Y R + A ++L+K EEA
Sbjct: 136 NYRRCIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (53%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A   K EGNK +  K Y  A+E Y++AI+   T  I+++NRA A   +  + + + D   
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 159 AIEIDPAYSKGYSRLAFAKYAL 180
           A+E+DP   K Y R   ++  L
Sbjct: 73  ALELDPKNIKAYHRRGLSQLGL 94

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 46/88 (52%)

Query: 93  AEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNA 152
           AE  A A  FK EGN  +  ++Y  AIE Y++AI+  P   I+Y+NRA A   +  + +A
Sbjct: 6   AEDIAKAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSA 65

Query: 153 IKDAEKAIEIDPAYSKGYSRLAFAKYAL 180
             D  +A+ +D    K Y R   A   L
Sbjct: 66  YNDCNEALTLDSKNVKAYHRRGLANVGL 93

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 51/99 (51%), Gaps = 4/99 (4%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL----PTNVIYYANRAAAYSSVK 147
           + E    AE+FK + N     K +R A E Y++ IK        N   +ANRAA    +K
Sbjct: 78  EGEPHEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELK 137

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEA 186
            Y + + D +KA+EI+P   K + R+  A  AL K +EA
Sbjct: 138 NYRSCVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 55/101 (54%), Gaps = 4/101 (3%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKT-LPTNVI---YYANRAAAYSSVK 147
           D E    AE+FK +GN+    K Y+ A E Y++ I+    +N I    ++NRAA    +K
Sbjct: 71  DGEPHEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELK 130

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
            Y   + D  +A++ +P   K + R+A A + L+K E+A E
Sbjct: 131 NYRRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKE 171

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 55/104 (52%), Gaps = 1/104 (0%)

Query: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155
           +A A   K +GN    AK +  AI+ Y  AI+  P + ++Y+N +A Y S  + D  ++ 
Sbjct: 128 QAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEY 187

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD 199
             KA+EI P +SK   R A A  +L    +A+ +   VL + GD
Sbjct: 188 TTKALEIKPDHSKALLRRASANESLGNFTDAM-FDLSVLSLNGD 230

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (52%), Gaps = 4/99 (4%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKT----LPTNVIYYANRAAAYSSVK 147
           + E    AE+FK +GN+   AK ++ A E Y++ +         N   +ANRAA    +K
Sbjct: 76  EGEPHEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELK 135

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEA 186
            Y   ++D  KA+ I+P   K Y R++ + + L K EEA
Sbjct: 136 NYRKCVEDCGKALTINPKNIKCYYRISKSFFQLRKLEEA 174

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 54/104 (51%), Gaps = 1/104 (0%)

Query: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155
           +A A   K  GN    AK++  AI+ Y  AI+  P   ++Y+N +A Y S  + +  I+ 
Sbjct: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD 199
             KA+EI P +SK   R A A  +L    +A+ +   VL + GD
Sbjct: 184 TTKALEIKPDHSKALLRRASANESLGNFTDAM-FDLSVLSLNGD 226

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 37/70 (52%)

Query: 138 NRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
           NR   + + K ++ AIK  + AIE+DP     YS ++    +    E+ +E+  K L+++
Sbjct: 132 NRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIK 191

Query: 198 GDKATPAMKR 207
            D +   ++R
Sbjct: 192 PDHSKALLRR 201

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 7/109 (6%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIK----TLPTNVIYYANRAAAYSSVK 147
           + E    AE+FK +GN     K +R A E Y++ I+        N   YANRAA    +K
Sbjct: 71  EGEPHEIAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELK 130

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPE---EALEYYKKV 193
            + + I D + A+  +P   K Y R+  A  A+NK E   E++E+ +K+
Sbjct: 131 NFRSCISDCKTALTYNPKNIKCYFRMGKAFTAINKFESARESIEFGQKI 179

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 51/104 (49%), Gaps = 4/104 (3%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL----PTNVIYYANRAAAYSSVK 147
           D E    AE+FK + N    AK ++ A E Y + I+        N   +AN AA    +K
Sbjct: 71  DGEPHEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIK 130

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYK 191
            +   I   +KA++ +P   K Y R+A A Y LNK +EA E  K
Sbjct: 131 NFRRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVK 174

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 6/99 (6%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A  FK +GN  +  K Y+ A+E YS+AI+   T  IY++NRA +   +  +  A +D +K
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDK 69

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
           AI +DP   K   R   +   L      LE++K   D+ 
Sbjct: 70  AIALDPKNIKAIHRRGLSYVGL------LEFFKARKDLR 102

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (53%), Gaps = 4/91 (4%)

Query: 94  EIKAT----AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEY 149
           E+KA     A   K EGNK +  K Y  A E Y++AI+  P N I Y+NRA     +  +
Sbjct: 4   EVKACNPEKALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNF 63

Query: 150 DNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180
            +++ DA++AIE+D    K Y R A +   L
Sbjct: 64  QSSLDDAKRAIELDNNNLKAYHRRAMSYIGL 94

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 87/177 (49%), Gaps = 8/177 (4%)

Query: 71  ASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLP 130
           A  T  G E++  +   +   + + K  A + K +GN     K +  AIE Y+ AIK L 
Sbjct: 65  AYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LH 123

Query: 131 TNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYY 190
            + ++++N +A Y S+ + D  ++ + +A+E+ P YSK   R A A   + + ++A+ + 
Sbjct: 124 EDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAM-FD 182

Query: 191 KKVLDMEGD----KATPAMKRDFEMAKNRV-ESSMNLEKSSTTTPEPSRSAGQQPAN 242
             VL + GD       P ++R+      RV +  M ++ S     +P R   + P+N
Sbjct: 183 ISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQP-RERQELPSN 238

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 50/99 (50%), Gaps = 4/99 (4%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLP----TNVIYYANRAAAYSSVK 147
           + E    A  FK +GN+   AK ++ A E Y + +         N   +AN+AA    +K
Sbjct: 76  EGEPHEIAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELK 135

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEA 186
            Y   I+D  KA+ I+P  +K Y R + A + LNK EEA
Sbjct: 136 NYRRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 6/132 (4%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A   K +GN    +K++  AI+ Y  AI+  P + ++Y+N +A Y S  + +  ++   K
Sbjct: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD----KATPAMKRDFEMAKN 214
           A+EI P +SK   R A A  +L    +A+ +   VL + GD       P ++R+      
Sbjct: 185 ALEIKPDHSKALLRRASANESLGNFTDAM-FDLSVLSLNGDFDGASIEPMLERNLNKQAM 243

Query: 215 RVESSMNLEKSS 226
           +V ++ NL K+S
Sbjct: 244 KVLNA-NLSKNS 254

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 52/101 (51%), Gaps = 4/101 (3%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL----PTNVIYYANRAAAYSSVK 147
           + E    AE+FK +GN    A+ Y+ A E Y++ ++        N   + NRAA    +K
Sbjct: 73  EGEPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELK 132

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
            +   I D ++A+  +P   K + R+  A ++LNK EEA E
Sbjct: 133 NHRRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKE 173

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 53/99 (53%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A  FK +GN  +  K Y  A+E YS+AI+   T  I+++NRA +   +  +  A++D  K
Sbjct: 12  ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNK 71

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
           +IE+DP   K   R   +   L +  +A +  K +L ++
Sbjct: 72  SIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVK 110

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 86/176 (48%), Gaps = 9/176 (5%)

Query: 60  SGKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAI 119
           S KT  E  +     S+  E + S K N   E+ +  A A   K +GN+    K Y  AI
Sbjct: 62  SKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALA--LKDKGNQYFRNKKYDDAI 119

Query: 120 EKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYA 179
           + Y+ A++ L  + ++Y+N +A Y SV +    ++ + KA+EI P YSK   R A A   
Sbjct: 120 KYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEG 178

Query: 180 LNKPEEALEYYKKVLDMEGD----KATPAMKRDF-EMAKNRVESSMNLEKSSTTTP 230
           L    +A+ +   VL + GD       P ++R+  + A +R++       ++T TP
Sbjct: 179 LGNFADAM-FDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATP 233

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%)

Query: 122 YSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALN 181
           + +A+K  P N   Y +R      ++ YD A KD +KA E+DP     Y +LA   Y  N
Sbjct: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 182 K 182
           K
Sbjct: 446 K 446

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (51%), Gaps = 5/102 (4%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAI-----KTLPTNVIYYANRAAAYSSV 146
           + E    AE+FK +GN    AK ++ A + Y + I     K +      +AN+AA    +
Sbjct: 69  EGEPHEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELEL 128

Query: 147 KEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
           K +   I D + A++++P   K Y R+  A +AL+K EEA E
Sbjct: 129 KNFRRCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEAKE 170

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 57/100 (57%), Gaps = 4/100 (4%)

Query: 101 SFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAI 160
           + K +GN+    KDY  A++ Y  A+ TL  + ++Y+N +A Y S+ + D  ++++ KA+
Sbjct: 108 ALKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKAL 166

Query: 161 EIDPAYSKGYSRLAFAKYAL-NKPEEALEYYKKVLDMEGD 199
           E+ P YSK   R A A  +L N P+   +    VL + GD
Sbjct: 167 ELKPDYSKALLRRASANESLENYPDAMFDL--SVLSLNGD 204

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 51/101 (50%), Gaps = 4/101 (3%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL----PTNVIYYANRAAAYSSVK 147
           + E    AE+FK +GN+A   K YR A   Y   I+        N + + N+AA    +K
Sbjct: 67  EGEPHEIAENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMK 126

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
            Y + I D +KA+  +P   K Y R+A A  A+ K +E+ E
Sbjct: 127 NYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRE 167

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 6/90 (6%)

Query: 107 NKA---MAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEID 163
           NKA   +  K+YR  I    +A+   P NV  Y   A A+S++++YD + +  E  +++D
Sbjct: 117 NKAACELEMKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVD 176

Query: 164 PAYSKGYSRLAFAKYALNKPEEALEYYKKV 193
              S+  S L   K  + K EE   Y  K+
Sbjct: 177 ---SRNSSLLNLLKTIIKKQEEKTAYRLKL 203

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A+  K +GN+   +KD   AI+ Y  A++ L  + ++Y+N +A Y ++ + D  I+ + K
Sbjct: 158 AKELKNKGNQYFKSKDNENAIKYYEYALR-LDQDPVFYSNISACYFAMNQLDKVIESSNK 216

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD 199
           A+E+ P YSK   R A A  AL   +EAL Y   +L + G+
Sbjct: 217 ALELKPDYSKALLRRANAYEALGNNKEAL-YDFSILSLFGE 256

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 40/72 (55%), Gaps = 5/72 (6%)

Query: 138 NRAAAYSSVKEYDNAIKDAEKAIEID--PAYSKGYSRLAFAKYALNKPEEALEYYKKVLD 195
           N+   Y   K+ +NAIK  E A+ +D  P +   YS ++   +A+N+ ++ +E   K L+
Sbjct: 163 NKGNQYFKSKDNENAIKYYEYALRLDQDPVF---YSNISACYFAMNQLDKVIESSNKALE 219

Query: 196 MEGDKATPAMKR 207
           ++ D +   ++R
Sbjct: 220 LKPDYSKALLRR 231

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 68/146 (46%), Gaps = 16/146 (10%)

Query: 102 FKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIE 161
            K +GN+    KDY  A++ Y  A+  L  + ++Y+N +A Y S+ E D  I+ + KA+E
Sbjct: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169

Query: 162 IDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMN 221
           + P YSK   R A A        E LE Y    D   D +  ++  DF  A        N
Sbjct: 170 LKPDYSKALLRRATAN-------EQLENYS---DAMFDLSVLSLNNDFNGATIEPMLERN 219

Query: 222 LEKSSTTTPE-----PSRSAGQQPAN 242
           L K +    +     PS++  + P+N
Sbjct: 220 LNKQAIKVLDQKSKNPSKNESELPSN 245

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 66/126 (52%), Gaps = 4/126 (3%)

Query: 74  TSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNV 133
            S+  E + S K N   E+ +  A A   K +GN+    K Y  AI+ Y+ A++ L  + 
Sbjct: 76  VSSNGEPDFSNKANFTAEEKDKYALA--LKDKGNQFFRNKKYDDAIKYYNWALE-LKEDP 132

Query: 134 IYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKV 193
           ++Y+N +A Y SV +    ++ + KA+E+ P YSK   R A A   L K  +A+ +   V
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAM-FDLSV 191

Query: 194 LDMEGD 199
           L + GD
Sbjct: 192 LSLNGD 197

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%)

Query: 122 YSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALN 181
           + +A+K    N   Y +R      ++ YD A KD +KA E+DP     Y +LA   Y  N
Sbjct: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 182 K 182
           K
Sbjct: 446 K 446

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 79/172 (45%), Gaps = 19/172 (11%)

Query: 9   GSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFSGKTLKEIL 68
           G L+ DF S  +KN   S  S  S   +I      F+F+ D+V      + +  T K I+
Sbjct: 465 GDLLGDFGSN-LKNHNESLVSHGSQESSI-----LFDFDSDSVTSMHIKQNNSATSKNIV 518

Query: 69  SSASATSTGSEKEESVK---VNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEA 125
                T+   EK+       V +P+   E+    E F+  G +     DY  A+ +Y ++
Sbjct: 519 -----TAKADEKDLVNTLPIVKVPISTIELSGYTE-FRANGTEFFKKGDYDSALSEYKKS 572

Query: 126 IKTLPT----NVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRL 173
           + TLP      +I Y+N  AA   V EY  ++KD + A+E+ P   K +++ 
Sbjct: 573 LNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQWTQF 624

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 63/114 (55%), Gaps = 3/114 (2%)

Query: 87  NIPVEDAEIKAT-AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSS 145
           NI     E++ T A + K  GN+    KDY  A++ Y+ A+  +  + ++Y+N +A Y S
Sbjct: 88  NIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNISACYVS 146

Query: 146 VKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD 199
           + + D  ++++ KA+E+ P YSK   R A A  +L    +A+ +   VL + GD
Sbjct: 147 LGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAM-FDLSVLSLNGD 199

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 53/101 (52%), Gaps = 1/101 (0%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A   K +GN     K++  AI+ Y  AI+  P + ++Y+N +A Y S  + +  ++   K
Sbjct: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD 199
           A+EI P +SK   R A A  +L    +A+ +   VL + GD
Sbjct: 184 ALEIKPDHSKALLRRASANESLGNFTDAM-FDLSVLSLNGD 223

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%)

Query: 131 TNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYY 190
           T  +   N+   + + K +  AIK  + AIE+DP     YS ++    +     + LEY 
Sbjct: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181

Query: 191 KKVLDMEGDKATPAMKR 207
            K L+++ D +   ++R
Sbjct: 182 TKALEIKPDHSKALLRR 198

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 53/114 (46%), Gaps = 4/114 (3%)

Query: 77  GSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKT----LPTN 132
           G E +E   +     + E    A +FK +GN    AK ++ A E Y++ I+        N
Sbjct: 56  GGENQELEALKALAYEGEPHEIAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSIN 115

Query: 133 VIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEA 186
              YANRAA    +K Y   + D + A++ +P   K Y R+  A  AL   EEA
Sbjct: 116 ESLYANRAACELEIKNYRRCLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEA 169

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 49/99 (49%), Gaps = 4/99 (4%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL----PTNVIYYANRAAAYSSVK 147
           + E    AE+FK +GN    AK Y+ A E Y+  I         N   ++NRAA    +K
Sbjct: 71  EGEPHEVAENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELK 130

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEA 186
            Y   + D ++A++ +    K Y R+A A   LNK E+A
Sbjct: 131 NYRRCVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A + K +GN     KD+  AI+ Y+ A+ +L  + +YY+N +A YSS+  Y+  I+ A K
Sbjct: 95  AGALKEKGNALFKKKDFENAIKYYTFAL-SLKEDPVYYSNISACYSSLLNYEKVIEMATK 153

Query: 159 AIEIDPAYSKGYSRLA 174
           A+ + P YSK   R A
Sbjct: 154 ALALRPDYSKVLVRRA 169

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 18/116 (15%)

Query: 122 YSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALN 181
           Y +A+K    N   Y +R   Y   ++Y+ A +D +KA E+DP     Y +LA   Y  N
Sbjct: 363 YEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYREN 422

Query: 182 KPEEALEYYKKVLDMEGDKATP-------------AMKRDFEMAKNRVESSMNLEK 224
           K ++      + L  E  +  P             A K DF+ A    E ++ LEK
Sbjct: 423 KFDDC-----ETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEK 473

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 5/110 (4%)

Query: 97  ATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDA 156
           A A  +K +GN  +  +D+  A E Y++AI+   T  I+++NRA A+     +  ++ D 
Sbjct: 10  AKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDC 69

Query: 157 EKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVL-----DMEGDKA 201
           +KA+E+D    K Y R   +   L + ++A    K VL     D+  D+A
Sbjct: 70  DKALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRA 119

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 91  EDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYD 150
           E AE    A   K  GN     KDY  AI  Y  A++ L  + ++Y+N AA Y S++   
Sbjct: 78  ETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNK 136

Query: 151 NAIKDAEKAIEIDPAYSK 168
            AI+   KA+E++P YSK
Sbjct: 137 EAIEACSKALELNPDYSK 154

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 5/71 (7%)

Query: 139 RAAAYSSVKEYDNAIKDAEKAIEI--DPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDM 196
           R  AY  VK+Y+NAI   + A+++  DP +   YS +A    +L   +EA+E   K L++
Sbjct: 92  RGNAYFKVKDYENAINYYKFALQLKNDPVF---YSNMAACYISLEHNKEAIEACSKALEL 148

Query: 197 EGDKATPAMKR 207
             D +   +KR
Sbjct: 149 NPDYSKVLLKR 159

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 64/145 (44%), Gaps = 15/145 (10%)

Query: 59  FSGKTLKEILSSASATSTGSEKEE----SVKVNIPVE-------DAEIKATAESFKLEGN 107
           F GKT  E+L   +       K E    +   N+ +E       D E    AE+FK +GN
Sbjct: 26  FQGKTTDEVLGELNRMPFFMTKLEPGDAASGENVELEALKALAYDGEPHEVAENFKNQGN 85

Query: 108 KAMAAKDYRLAIEKYSEAIKTLPTNV----IYYANRAAAYSSVKEYDNAIKDAEKAIEID 163
                K +R A   Y++ I+    +     +   NRAA    +K Y   I D  +A++++
Sbjct: 86  DLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCREALKLN 145

Query: 164 PAYSKGYSRLAFAKYALNKPEEALE 188
           P   K + R+  A   L+K EEA E
Sbjct: 146 PKNPKAFFRIGKAFLQLDKLEEAAE 170

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 49/101 (48%), Gaps = 4/101 (3%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL----PTNVIYYANRAAAYSSVK 147
           + E    A +FK +GN     K +R A E Y++AI         N   YANRAA    +K
Sbjct: 67  EGEPHEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELK 126

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
            Y   I D + A+ ++P   K Y R+A A  A+ K ++  E
Sbjct: 127 NYRRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDCKE 167

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A + K +GN+      +  AI+ Y  A+K L  + IYY+N +A Y+S+ +Y+  I+ A K
Sbjct: 110 AMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATK 168

Query: 159 AIEIDPAYSKGYSRLAFAKYAL 180
           A+++ P +SK   R A A  A+
Sbjct: 169 ALKLRPTFSKVLMRRALAYEAM 190

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%)

Query: 119 IEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKY 178
           ++ + +A++  P N   Y +R  +Y   ++Y+ A KD +K  E+D      Y +LA   Y
Sbjct: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAY 433

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 53/99 (53%), Gaps = 2/99 (2%)

Query: 101 SFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAI 160
           + K +GN    A  +  AI+ Y+ AI+ L  N I+Y+N +A Y S+ + +  IK   KA+
Sbjct: 113 ALKDKGNSLFKADKFEEAIKYYNWAIE-LKENPIFYSNLSACYVSLNKLEEIIKYCNKAL 171

Query: 161 EIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD 199
           E+ P YSK   R A A   L    +A+ +   VL + GD
Sbjct: 172 ELKPDYSKVLLRRANANEKLENYADAM-FDLSVLSLNGD 209

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 65/145 (44%), Gaps = 15/145 (10%)

Query: 55  LQDKFSGKTLKEI---------LSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLE 105
             DK + + LKE+         L +A   + G+ + E++K      + E    A +FK +
Sbjct: 28  FHDKTTDEVLKELNKMPFFMTKLDNADVENGGNVELEALKA--LAYEGEPHEVAANFKNQ 85

Query: 106 GNKAMAAKDYRLAIEKYSEAIKTL----PTNVIYYANRAAAYSSVKEYDNAIKDAEKAIE 161
           GN     K Y+ A   YS+ I+        N   Y NRAA    ++ + + I D +KA+ 
Sbjct: 86  GNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCKKALN 145

Query: 162 IDPAYSKGYSRLAFAKYALNKPEEA 186
            +    K + R+  A + L K EEA
Sbjct: 146 FNAKCVKAFYRMGQAYFKLKKLEEA 170

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 106 GNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPA 165
           GN+    K Y  AI+ YS A++ L  + ++Y+NR+A +  + + +  ++D   A+E+ P 
Sbjct: 105 GNECFKEKKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPD 163

Query: 166 YSKGYSRLAFAKYALNKPEEAL 187
           YSK   R A A  +L    +A+
Sbjct: 164 YSKCLLRRATANESLGNFADAM 185

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 80/179 (44%), Gaps = 33/179 (18%)

Query: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL----PTNVIYYANRAAAY 143
           IP+   EI    E FK  G       DY  A+E+Y +++ TL    P  +I Y+N  A+ 
Sbjct: 352 IPISHIEISGYNE-FKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASR 410

Query: 144 SSVKEYDNAIKDAEKAIEI---------------DPAYSKGYSRLAFAKYALNKPE--EA 186
             + ++  ++ DA++A+++               DP  S  Y+ + + K  L + E  EA
Sbjct: 411 IKIGQHSQSVVDAQEAMKLLPEEKSLWTAAIQNSDPVRS--YNDI-WPKIILRQAESYEA 467

Query: 187 LEYYKKVLDMEGDKATPAMKRDFE----MAKNRVESSMNLEKSSTTTPEPSRSAGQQPA 241
           +E YK  LD      T   K  F       K R + ++ L+    + P PS+SA   PA
Sbjct: 468 IEKYKLALDA---YQTLLEKNLFSEKVIAGKRRCQHALGLDSKPKSNP-PSKSATPAPA 522

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 81/170 (47%), Gaps = 7/170 (4%)

Query: 74  TSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNV 133
            S+  + + S K N   E+ +  A A   K +GN+    K Y  AI+ Y+ A++ L  + 
Sbjct: 76  VSSNGDPDFSNKANFTAEEKDRYALA--LKDKGNQFFRNKKYDDAIKYYNWALE-LKDDP 132

Query: 134 IYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKV 193
           ++Y+N +A Y SV +    ++ + KA+E+ P YSK   R A A   L    +A+ +   V
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAM-FDLSV 191

Query: 194 LDMEGDKATPAMKRDFEMAKNRVESSMNLEKSS---TTTPEPSRSAGQQP 240
           L + GD    +++   E   N+   S   EK     T T  P+  + Q P
Sbjct: 192 LSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAP 241

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%)

Query: 122 YSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALN 181
           + +A+K    N   Y +R      ++ YD A KD +KA E+DP     Y +LA   Y  N
Sbjct: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 182 K 182
           K
Sbjct: 446 K 446

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 71/137 (51%), Gaps = 7/137 (5%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A + K +GN+    K Y  AI+ Y+ A++ L  + ++Y+N +A Y SV +    ++ + K
Sbjct: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTK 157

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD----KATPAMKRDF-EMAK 213
           A+E+ P YSK   R A A   L    +A+ +   VL + GD       P ++R+  + A 
Sbjct: 158 ALELKPDYSKVLLRRASANEGLGNFADAM-FDLSVLSLNGDFNDASIEPMLERNLNKQAM 216

Query: 214 NRVESSMNLEKSSTTTP 230
           +R++       ++T TP
Sbjct: 217 SRLKEKFGDIDAATATP 233

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%)

Query: 122 YSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALN 181
           + +A+K    N   Y +R      ++ YD A KD +KA E+DP     Y +LA   Y  N
Sbjct: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 182 K 182
           K
Sbjct: 446 K 446

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAY 143
           +P+   EI    E +K  G +   A DY  A ++Y +++ +LP N    ++ Y+N  AA 
Sbjct: 263 VPISHLEISGYKE-YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAAL 321

Query: 144 SSVKEYDNAIKDAEKAIEIDP 164
             V EY   + D E A+E+ P
Sbjct: 322 FKVGEYKRCLSDIESALEMFP 342

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A   K +GN+    K Y  AI+ YS AI+ +  + ++Y+NR+A Y S+ + +  ++D   
Sbjct: 95  AMGLKDKGNEFFKNKKYDEAIQYYSWAIE-VKEDPVFYSNRSACYVSLGQQEKVVEDTTA 153

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEAL 187
           A+++ P YSK   R A A  +L    +A+
Sbjct: 154 ALKLKPDYSKCLLRRASANESLGNFADAM 182

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 5/81 (6%)

Query: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAY 143
           IP+   E+    E +   G+      DY  A+E+Y +++ TLP +    +I Y+N  AA 
Sbjct: 347 IPISSIELSGYNE-YNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAE 405

Query: 144 SSVKEYDNAIKDAEKAIEIDP 164
             + EY N +K A+KA+++ P
Sbjct: 406 LKIGEYSNLVKKADKALKLFP 426

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A   K +GN+    K +  A++ YS AI+ +  + ++Y+NR+A Y S+ + +  ++D   
Sbjct: 96  AMGLKDKGNEFFKNKQFEDALKYYSLAIE-VKEDPVFYSNRSACYVSLGQQEKVVEDTTA 154

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEAL 187
           A+++ P YSK   R A A  +L K  +A+
Sbjct: 155 ALKLKPDYSKCLLRRASANESLGKFADAM 183

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 5/81 (6%)

Query: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAY 143
           IP+   E+   AE F+  G +     DY  + ++Y +++ TLP N    +I Y+N  A+ 
Sbjct: 393 IPISHIELSGYAE-FRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASE 451

Query: 144 SSVKEYDNAIKDAEKAIEIDP 164
             + EY  ++K++  A+E+ P
Sbjct: 452 LKIGEYSKSLKNSSSALEMFP 472

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 7/92 (7%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAE 157
           T E+ K +GN A    ++  A E Y + I   P N I Y+NRA A   ++++   I   +
Sbjct: 3   TFETVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQ 62

Query: 158 KAI-------EIDPAYSKGYSRLAFAKYALNK 182
           + +       + +P   K   RL  A+ +LNK
Sbjct: 63  RGLGKLEDNEKDEPIRKKLLYRLHLAQESLNK 94

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           + FK  GN+     +Y LAIE+Y + I   PTN + Y+N A AY   +  D    +A+ A
Sbjct: 36  QHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPD----EAKTA 91

Query: 160 IEIDPAYSK 168
            E+  +Y K
Sbjct: 92  CEMGLSYCK 100

 Score = 32.3 bits (72), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEA 186
           EYD AI+   K I ++P  + GYS LA A      P+EA
Sbjct: 50  EYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEA 88

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 49/101 (48%), Gaps = 4/101 (3%)

Query: 92  DAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL----PTNVIYYANRAAAYSSVK 147
           + E    A +FK  GN+    K YR A E Y++ I         N   YANRAA    +K
Sbjct: 67  EGEPHEIAGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELK 126

Query: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALE 188
            +   I+D +KA+  +    K Y R+  A  ++++ +E+ E
Sbjct: 127 NFRKCIEDCKKALSFNVKNIKCYYRMGKAFLSVDRFDESKE 167

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A + K +GN+    + Y  AI+ Y  A+K L  + ++Y+NR+A Y  + + +  ++D   
Sbjct: 95  AMALKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTA 153

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEAL 187
           A+++ P YSK   R A A  +L    +A+
Sbjct: 154 ALKLKPDYSKCLLRRATANESLGNYADAM 182

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%)

Query: 120 EKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKY 178
           + + +A++  P +   Y +RA     ++++D A KD +KA E DP+    Y +LA   Y
Sbjct: 360 QNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAY 418

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 6/120 (5%)

Query: 101 SFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAI 160
           + K +GN+    + Y  A++ Y+ A+  L  + ++Y+N +A Y S+   +  ++ + KA+
Sbjct: 101 ALKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKAL 159

Query: 161 EIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD----KATPAMKRDFEMAKNRV 216
           E+ P YSK   R A A   L    EA+ +   VL + GD       P ++R+      RV
Sbjct: 160 ELKPDYSKALLRRASANENLENFAEAM-FDLSVLSLNGDFNEASIEPMLERNLNKQAMRV 218

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 7/113 (6%)

Query: 130 PTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSR-------LAFAKYALNK 182
           P  +I   NRAA++  +     A+ DA++ I++D    KGY R       +A  K AL  
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDKEALYV 126

Query: 183 PEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRS 235
             E L   K+   +  +K         E  KN V   +NL+K + TT    R+
Sbjct: 127 YREGLSKAKEAYQLHFEKPPSKFVEIVEHQKNEVIKRLNLQKLTPTTGASKRT 179

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 82/171 (47%), Gaps = 31/171 (18%)

Query: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAY 143
           IP+ D E+    E FK +G       DY  ++++Y +++ TLP N    +I  +N  A+ 
Sbjct: 364 IPISDIELSGYNE-FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQ 422

Query: 144 SSVKEYDNAIKDAEKAIEIDPAY-SKGYSRLA-----------FAKYALNKPE--EALEY 189
             + EY  +I+++  A+E+ P+  +K  ++++           + K  + + E  E LE 
Sbjct: 423 LKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLES 482

Query: 190 YKKVL---------DMEGDKATPAMKR--DFEMAKNRVESSMNLEKSSTTT 229
           +KK L         +   DK     +R  DF +    V+ SM ++K +TTT
Sbjct: 483 FKKALETYQELIKKNFFDDKIMQGKRRCQDF-INPPPVKKSMPVKKKTTTT 532

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLP----TNVIYYANRAAAY 143
           +P+   E+    E FK  G++     DY  A+++Y +++ TLP      +I Y+N  A  
Sbjct: 404 VPISHIELSGHIE-FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQ 462

Query: 144 SSVKEYDNAIKDAEKAIEIDP 164
             + EY  +I+D + A+ + P
Sbjct: 463 LKIGEYSKSIEDCKIALSLFP 483

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 5/82 (6%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E +K EGN+      Y++A E Y + +   P N I Y+N+A A   +  Y   ++   K 
Sbjct: 4   EQYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKG 63

Query: 160 IEIDP-----AYSKGYSRLAFA 176
           +   P      Y K   RL  A
Sbjct: 64  LTFTPNTTDTVYKKLNYRLEMA 85

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 60/127 (47%), Gaps = 8/127 (6%)

Query: 51  VAQTLQDKFSGKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAM 110
           V   L D   G   K   S +++   G+    S    IP+ D E+    E FK +G+   
Sbjct: 330 VENNLLDFSEGNVTKSNSSESNSLFNGNRNPNSA---IPISDIELSGYNE-FKAKGSNFF 385

Query: 111 AAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAY 166
              DY  ++++Y +++ +LP+N    +I  +N  A+   V EY  +I+++  A+ + P  
Sbjct: 386 KNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENSSMALALFPPT 445

Query: 167 SKGYSRL 173
              +S +
Sbjct: 446 KANWSNM 452

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 41/93 (44%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E++   GN     KD+  AIE + +A K  P     Y  +    SS   +D A K   KA
Sbjct: 552 ETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKA 611

Query: 160 IEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
           I  DP +   Y  +      L   +EAL Y++K
Sbjct: 612 IACDPRHYNAYYGMGIYSMKLGHYDEALLYFEK 644

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 58/135 (42%), Gaps = 2/135 (1%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A ++ L+G++  +   +  A + + +AI   P +   Y         +  YD A+   EK
Sbjct: 585 AYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEK 644

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKR-DFEMAKNRVE 217
           A +I P  +        A   L   ++ALEYY+    ++ +      KR +   A  R  
Sbjct: 645 ARQIYPINAVLICCCGVALEKLEYQDKALEYYELACTLQPNSNLARFKRANLLYAMGRYN 704

Query: 218 SSM-NLEKSSTTTPE 231
            ++ + E+ S  TPE
Sbjct: 705 LALQSFEELSKLTPE 719

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E  K +GN +     Y  AI  Y+  I   P+N I Y+N+A A      +D AI   EK 
Sbjct: 4   EELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKG 63

Query: 160 IEI 162
           +++
Sbjct: 64  LQL 66

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 81/159 (50%), Gaps = 9/159 (5%)

Query: 11  LIVDFLSTVIKNKEISEDSADSLNVAIDC-ITESFEFERDTVAQTLQDKFSGKTLKEILS 69
           L+ DF + +   K  S++ A S + + D  I E    +  ++  +L D FS +   +  S
Sbjct: 271 LLTDFEAKIDITKRASKNVASSPSPSFDIPIDEDSGKKESSMDDSLLD-FSPENFTKSDS 329

Query: 70  SASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL 129
           + + T  G E   +V V +P+ D E+   +E FK +G       DY  ++++Y +A+ +L
Sbjct: 330 TENNTLFG-ESSNAVSV-VPISDIELSGYSE-FKAKGATLFKNGDYVNSLQEYEKALNSL 386

Query: 130 PTN----VIYYANRAAAYSSVKEYDNAIKDAEKAIEIDP 164
           P+N    +I  +N  A+   V EY  +I +++ A+ + P
Sbjct: 387 PSNHPLRIIGLSNIIASQLKVGEYSKSIVNSDLALALFP 425

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 43/93 (46%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E++   GN     K++  AI+ + +A +  P     Y  +   Y+S   +D A +   KA
Sbjct: 529 ETWCCLGNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKA 588

Query: 160 IEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
           I  DP +   Y  L      L + EEAL +++K
Sbjct: 589 IACDPGHYNAYYGLGMVSMKLGQYEEALLFFEK 621

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 49/109 (44%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A ++ L+G++  ++  + +A   Y +AI   P +   Y         + +Y+ A+   EK
Sbjct: 562 AYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEK 621

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKR 207
           A  I+P           A   L+  E+AL+YY+   +++   +    KR
Sbjct: 622 ARSINPINVVLVCCGGVALEKLSYQEKALQYYELACELQPSSSLATFKR 670

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A + K +GN+    K    AI+ Y  A++    + ++YAN +A Y S+ +++  +++  K
Sbjct: 106 ALALKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNK 164

Query: 159 AIEIDPAYSKGYSRLA 174
           A+E+ P YSK   R A
Sbjct: 165 ALELKPDYSKVLLRRA 180

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 43/99 (43%)

Query: 94  EIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAI 153
           E +   E++   GN     KD+  AI  + +A K  P  V  Y  +   Y S+  YD A 
Sbjct: 585 EFRDKPETWCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAK 644

Query: 154 KDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
               KAI  D  +   Y  +      L + E+AL Y++K
Sbjct: 645 TFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEK 683

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%)

Query: 130 PTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEY 189
           P   +   NRAA +  + + D A+ DA   I +D    KGY R       L + EEAL+ 
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 190 YKKVLDMEGD 199
           Y+  L   G+
Sbjct: 127 YENGLKQAGE 136

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 11/98 (11%)

Query: 130 PTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEY 189
           P  V  Y N +A Y  ++E D A + + + I I+P   KGY R+        K  EA + 
Sbjct: 68  PKLVKLYDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKC 127

Query: 190 YKKVLDM------EGDKATPAMKRDF-----EMAKNRV 216
           YKK L M      + D   P   RD      ++ K R+
Sbjct: 128 YKKGLLMSREMLQKFDIVVPEKFRDIIKQQRDIVKKRI 165

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%)

Query: 138 NRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDM 196
           NRAA++  + + D A+KDA+  I ++P   K Y R       LNK +EA   Y + L M
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNYSQGLKM 134

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 10/92 (10%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAE 157
           TAE  K++GN      DY  AI  Y +A     +N IY++N A A   ++ +  A+    
Sbjct: 40  TAEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVN--- 96

Query: 158 KAIEIDPAYSKGYSRLAFAKYALNKPEEALEY 189
                  A  KG ++++F     +K ++ LE+
Sbjct: 97  -------ACDKGLNKVSFKTGMDSKTKQKLEW 121

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 106 GNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIE--ID 163
           GN       YR A++ Y + I   P N + Y+N+A A   + EY +AI+  ++ +   + 
Sbjct: 15  GNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRYALG 74

Query: 164 PAYSKGYSRLAF 175
           P ++   S+L +
Sbjct: 75  PEHAAIRSKLQY 86

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 62/135 (45%), Gaps = 2/135 (1%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A ++ L+G++  A + Y  A   Y +AI   P +   Y       S + +YD A+   EK
Sbjct: 555 AYAYTLQGHEHAANETYDTAKIMYRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEK 614

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKR-DFEMAKNRVE 217
           A  I+P  +        +   LN P++AL YY+    ++ +   P  K+     +  +  
Sbjct: 615 ARVINPVNAILICCCGHSLEKLNLPDQALTYYELAEKLQPEMTIPKYKKAQLLFSLGKFS 674

Query: 218 SSMNLEKSST-TTPE 231
           S+M + +S T  +PE
Sbjct: 675 SAMYIFESLTKLSPE 689

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 2/94 (2%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIY-YANRAAAYSSVKEYDNAIKDAEK 158
           E++ + GN     KD+  AI+ + +A  +L     Y Y  +   +++ + YD A     K
Sbjct: 522 ETWCVVGNYFSLIKDHGEAIKAFEKA-TSLDRKFAYAYTLQGHEHAANETYDTAKIMYRK 580

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
           AI  DP +   Y  L      L K ++AL Y++K
Sbjct: 581 AIACDPQHYNAYYGLGDCASRLGKYDKALLYFEK 614

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%)

Query: 106 GNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPA 165
           GN     KD+  AI  + +AI+  P     Y  +   YS+   +DNA     KA+ I+  
Sbjct: 499 GNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKT 558

Query: 166 YSKGYSRLAFAKYALNKPEEALEYYKK 192
           +      L      L K EEAL +++K
Sbjct: 559 HYNALYGLGMCCVKLGKFEEALLFFEK 585

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAYSSVKEYDN 151
           + + E FK +G  +    DY  A + Y +++ +LP      V+ ++N       V EY  
Sbjct: 322 RHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYRE 381

Query: 152 AIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLD 195
           A+ DA  A+++ P  S   S +      LN P+   E++ K+++
Sbjct: 382 ALSDASSALKLIPQGSMN-SNIP----NLNPPKTYKEFWSKIMN 420

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 74/160 (46%), Gaps = 12/160 (7%)

Query: 36  AIDCITESFEFERDTVAQTLQDKFSGKTLKEILSSASATSTGSEKEESVKVNIPVEDAEI 95
           A  C  +SFE +         D  + K + EI ++A   +  ++  E + V       E+
Sbjct: 630 AYKCYYKSFEMD-------FTDIRAAKYICEIYTAAGNWNAAAQICERL-VKTEAIKMEL 681

Query: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155
           ++T   +++ G   +  +    ++E +  A++  P +V  +     AY +    + + K 
Sbjct: 682 RSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGRVEASTKV 741

Query: 156 AEKAIEIDP--AYSKGYSRLAFAKYALNKPEEALEYYKKV 193
            EKAIEIDP   Y++ ++ L+ A+  +   EE +E  K +
Sbjct: 742 FEKAIEIDPLHLYAQYFNSLSLAE--MGCFEECIEILKNI 779

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A   K +GN+    K +  AI+ Y+ A++ L  + ++Y+NR+A Y S+ + +  ++D   
Sbjct: 102 AMGLKDKGNEFFKEKKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMGQLEKVVEDTTA 160

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEAL 187
           A+++   YSK   R A A  +L    +A+
Sbjct: 161 ALKLKSDYSKCLLRRASANESLGNYADAM 189

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 55/120 (45%), Gaps = 20/120 (16%)

Query: 119 IEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKY 178
            E + +A++  P     Y +R   Y   ++Y+NA KD +KA E +      Y +LA   Y
Sbjct: 366 FENFDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAY 425

Query: 179 ALNKPE-----------------EALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMN 221
             NK E                 E   +Y ++L  +GD A    K+ +E+A+ ++E +++
Sbjct: 426 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANA--KKQYEIAR-KLEDALD 482

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E  K +GN       YR A+  Y + I   P N + Y+N+A A   + EY  AI+  ++ 
Sbjct: 5   EKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQG 64

Query: 160 I 160
           +
Sbjct: 65  L 65

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 43/99 (43%)

Query: 94  EIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAI 153
           E K   +++   GN     KD++ AI+ + +  K  PT    Y  +A  Y S   +D A 
Sbjct: 560 EFKNEPQTWCCLGNLFSLQKDHKEAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAK 619

Query: 154 KDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
               KA+  D  +   Y  +      L + E AL Y++K
Sbjct: 620 NYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEK 658

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 6/101 (5%)

Query: 69  SSASATSTGSEKEESVKVNI-PVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIK 127
           SS S + T      S+++ I P+   E+    E F+ +G +     DY  A+ +Y +++ 
Sbjct: 260 SSKSGSRTHVNNSPSIELPIVPISTMELSGYNE-FRAKGTELFKKGDYSAAVLEYEKSLN 318

Query: 128 TL----PTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDP 164
           TL    P  +I  +N    Y  + EY   +K A  A+E+ P
Sbjct: 319 TLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLAPLALELIP 359

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E++   GN     KD+  AI+ + +A +  P     Y  +   +SS    D+A     KA
Sbjct: 541 ETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKA 600

Query: 160 IEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
           +  DP +   Y  L  +   L + EEAL Y++K
Sbjct: 601 LACDPQHYNAYYGLGTSAMKLGQYEEALLYFEK 633

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E++   GN     KD+  AI+ + +A +  P     Y  +   +SS    D+A     KA
Sbjct: 546 ETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKA 605

Query: 160 IEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
           +  DP +   Y  L  +   L + EEAL Y++K
Sbjct: 606 LACDPQHYNAYYGLGTSSMKLGQYEEALLYFEK 638

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 5/90 (5%)

Query: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPT----NVIYYANRAAAY 143
           +P+ + E+    E FK  G +     DY  A+E Y +++ TLP      +I  +N  A+ 
Sbjct: 384 VPISEIELLGYKE-FKERGTENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASM 442

Query: 144 SSVKEYDNAIKDAEKAIEIDPAYSKGYSRL 173
           S   EY  +I+ +  A+E  P   K ++  
Sbjct: 443 SKTGEYRKSIEISTSALEQFPGDQKQWNEF 472

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E++   GN     KD+  AI+ + +A +  P     Y  +   +SS    D+A     KA
Sbjct: 534 ETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKA 593

Query: 160 IEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
           +  DP +   Y  L  +   L + EEAL Y++K
Sbjct: 594 LACDPQHYNAYYGLGTSSMKLGQYEEALLYFEK 626

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 5/82 (6%)

Query: 130 PTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEY 189
           P  V    NRAA +  + +   A+KDA +A   +P   K Y R       L    +ALE 
Sbjct: 68  PRLVKLLDNRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQALEN 127

Query: 190 YKKVLDMEGDKATPAMKRDFEM 211
           Y+     EG KA   M R + +
Sbjct: 128 YE-----EGVKAIRDMTRKYHL 144

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 35.4 bits (80), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%)

Query: 103 KLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAI 160
           K EGN+     DY  A + Y   I   PTN I Y+N+A +    + +D AI+     +
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGL 64

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E FK++GN A    ++  A+  Y +AI   PTN + Y+N A A   +  Y +A +  ++ 
Sbjct: 5   EEFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADASQMCQRG 64

Query: 160 I 160
           +
Sbjct: 65  L 65

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 37.0 bits (84), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 51/101 (50%)

Query: 93  AEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNA 152
           AEI++    F++ G   +  ++   +IE +  A++  P +V  +     AY +    + +
Sbjct: 689 AEIRSNNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEAS 748

Query: 153 IKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKV 193
           IK  +KAIE+ P+++      A +   + +  E+LE  +KV
Sbjct: 749 IKVFDKAIELQPSHTYARYFRALSLCDMGEYLESLETLEKV 789

>KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.470
           YDR244W
          Length = 562

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%)

Query: 111 AAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGY 170
           A  D+   IE +  A+   PT+ + +    AA ++    +++IK   KAI++ P++ +  
Sbjct: 418 ANDDFDKTIECFKAALNENPTDELMWNRLGAALANSNRSEDSIKAYYKAIQLKPSFVRAR 477

Query: 171 SRLAFAKYALNKPEEALEYYKKVLDME 197
             LA A   ++  +EA E+    L M 
Sbjct: 478 YNLAVACMNIHCYKEAAEHLLTALSMH 504

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 36.2 bits (82), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 60/141 (42%), Gaps = 11/141 (7%)

Query: 59  FSGKTLKEILSSASATSTGSEKEESVKVNIPVE-------DAEIKATAESFKLEGNKAMA 111
           F  KT  E+L   +       K +  + N+ +E       + E    A +FK +GN    
Sbjct: 23  FQNKTTDEVLEELNKMPFFMNKLDPDESNVELEALKAMAYEGEPHEIATNFKNQGNDLYK 82

Query: 112 AKDYRLAIEKYSEAIKT----LPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYS 167
            K ++ A   Y +A+      L  N   Y N AA    +K Y + I    +A++++    
Sbjct: 83  GKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCREALKLNAKNV 142

Query: 168 KGYSRLAFAKYALNKPEEALE 188
           K + R+  A   L + E++LE
Sbjct: 143 KAFFRIGKAYLELGRFEDSLE 163

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 54/109 (49%), Gaps = 5/109 (4%)

Query: 69  SSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKT 128
           +++++ S    ++ SV   +P+ + E+    E FK    +     DY  A+++Y ++  T
Sbjct: 316 ANSTSASVSVSRQGSVVPTVPITEIELSGYNE-FKDRAGELFKTGDYVAALQEYEKSANT 374

Query: 129 LPT----NVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRL 173
           LP      +I Y+N  A+     +Y  ++  A  A+++ P  +  +++L
Sbjct: 375 LPHGHPLRIISYSNLMASQLKTGQYKESLHVASMALKLFPEDTTQWTQL 423

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 34.7 bits (78), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 8/91 (8%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           + FK EGN+     +Y  AI+ Y + I+  P N I Y+N+A A     +   A++  +  
Sbjct: 4   DHFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDG 63

Query: 160 IE--------IDPAYSKGYSRLAFAKYALNK 182
           ++         +    K   RL  A+ ALNK
Sbjct: 64  LKRVSKNDATHETIQKKLEYRLELAEKALNK 94

 Score = 32.7 bits (73), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 149 YDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEAL 187
           Y +AIK  EK IEI+P    GYS  A A    NK +EA+
Sbjct: 19  YASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAV 57

>Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AGR352C
          Length = 661

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 50/111 (45%), Gaps = 10/111 (9%)

Query: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAY 143
           +P+   E+    E F + G +     DY  A ++Y +++ TLP      ++ Y+N     
Sbjct: 356 VPISQIEMSGYQE-FNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQ 414

Query: 144 SSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVL 194
             + E+  ++K+ EKA ++        S L       N P+   E++ K++
Sbjct: 415 LKIGEHTESLKNIEKACDLLDG-----SSLDGIIQGTNPPKTYKEFWNKII 460

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 43/93 (46%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           +++   GN     KD+  AI+ + +A +  P     Y  +   +SS   +D A     KA
Sbjct: 536 QTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKA 595

Query: 160 IEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
           +  DP +   Y  L  +   L + +EAL +++K
Sbjct: 596 LACDPQHYNAYYGLGMSCMKLGQYDEALLHFEK 628

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 44/97 (45%)

Query: 106 GNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPA 165
           G   M    Y  A+  + +A    P NVI       A   ++  + A+   E A E+ P+
Sbjct: 610 GMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQEKALSYYELACELQPS 669

Query: 166 YSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKAT 202
            S    + A   Y++ +   AL+Y++++  +  D+AT
Sbjct: 670 SSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEAT 706

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 46/109 (42%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A ++ L+G++  +   +  A   Y +A+   P +   Y     +   + +YD A+   EK
Sbjct: 569 AYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEK 628

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKR 207
           A  I+P           A   L   E+AL YY+   +++   +    KR
Sbjct: 629 ARSINPINVILICCCGVALEKLQYQEKALSYYELACELQPSSSLANFKR 677

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A + K +GN     +D+  A++ Y+ A+ TL  + ++Y+N +A Y S+ + +  ++ + +
Sbjct: 105 AMALKDKGNDYFKKQDFENALKYYNYAL-TLKQDPVFYSNISACYVSLGQLEKVVESSTE 163

Query: 159 AIEIDPAYSKGYSRLA 174
           A+++   YSK   R A
Sbjct: 164 ALKLKHDYSKALLRRA 179

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%)

Query: 118 AIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAK 177
           +I+ +  AI    TN   Y +R   Y   ++Y+ A  D +KA E+D +    Y +LA   
Sbjct: 368 SIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLACLA 427

Query: 178 YALNK 182
           Y  NK
Sbjct: 428 YKENK 432

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 39/84 (46%)

Query: 114 DYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRL 173
           D+   +E +  A+K  P + + +    A+ ++    + AIK   KAI + P++ +    L
Sbjct: 456 DFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRARYNL 515

Query: 174 AFAKYALNKPEEALEYYKKVLDME 197
           A A   +   +EA  +   VL M 
Sbjct: 516 AVASMNIGCYQEAAGHLLTVLKMH 539

>Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}
           similar to Ashbya gossypii ABR206W
          Length = 626

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 49/105 (46%)

Query: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155
           K+   ++ L G++ +  K+   AIE Y  A+   P +   +     AY  +  +  A+  
Sbjct: 427 KSCTNAWTLMGHEFVETKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLDRHLYALYY 486

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDK 200
            +KA  + P   + +  LA     L++P +A++ +++   +  D+
Sbjct: 487 LQKACSLKPLDKRMWQALANCYDKLDRPNQAIKCFQRASQLSNDQ 531

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 89  PVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL----PTNVIYYANRAAAYS 144
           P+ D E+    E FK +G       DY  ++++Y +++ +L    P  +I  +N  A+  
Sbjct: 361 PISDIELSGYNE-FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQL 419

Query: 145 SVKEYDNAIKDAEKAIEIDPA 165
            + EY  +I++++ A+ + PA
Sbjct: 420 KIGEYSKSIENSDTALALFPA 440

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 124 EAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYS 171
           E ++T P     + +    YS  +++D AI+  EKA E+DP ++ GY+
Sbjct: 500 ELLETQPDKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYT 547

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 37/87 (42%)

Query: 106 GNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPA 165
           GN     +D+  AI  + +A +  P     Y  +   +SS    D A     KAI  DP 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 166 YSKGYSRLAFAKYALNKPEEALEYYKK 192
           +   Y  L      L + EEAL Y++K
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALLYFEK 602

>NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.395
           YPR088C
          Length = 585

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 18/57 (31%)

Query: 272 PQVMQAAQQMM-SDPNSMQKMQ-----------------EMMQNPNLREMAQNLASG 310
           PQ+MQ AQQ +  +P  MQ MQ                 +MMQ+PN+++MAQ    G
Sbjct: 528 PQMMQQAQQRLRQNPGMMQNMQNMFGGAGGGMPDMNEMMKMMQDPNMQKMAQQFGMG 584

>Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR189W
           (REAL)
          Length = 1417

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 50/101 (49%)

Query: 93  AEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNA 152
           AE++     F++ G   +  ++   +IE +  A++  P +V  +     AY +    + +
Sbjct: 681 AELRKNNWPFRVVGIAHLEKQEESDSIEWFQSALRIDPNDVESWVGLGQAYHACGRIEAS 740

Query: 153 IKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKV 193
           IK  +KAI++ P+++      A +   + +  E+LE  KKV
Sbjct: 741 IKVFDKAIQLRPSHTYAQYFKAVSLCDIGEYLESLEILKKV 781

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           ++ K +GN      DY  A+  Y +AI   P+N I Y+N A     ++++  A+    K 
Sbjct: 5   DTLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKG 64

Query: 160 IEI 162
           +++
Sbjct: 65  LKM 67

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 74/178 (41%), Gaps = 24/178 (13%)

Query: 35  VAIDCITESFEFERDTVAQTLQDKFSGKTLKEILSSASATSTGSEKEE-SVKVNIPVEDA 93
           +AI  I E +    D  A T+ DK++     EI S+       ++KE  S  +     D 
Sbjct: 387 LAISYINEGY----DMSAFTMLDKWAETKYPEIWSNIKQQDERTQKERGSTHI-----DM 437

Query: 94  EIKATAESFKLEGNKAMAAKDYRLA--------------IEKYSEAIKTLPTNVIYYANR 139
             + T +  +L  + + A  + +L               I+ +  A+K  P + + +   
Sbjct: 438 NARVTKQYLQLANSLSSADPEVQLCLGLLFYTKDDFDKTIDCFESALKVNPNDELMWNRL 497

Query: 140 AAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
            A+ ++    + AI+   +A+++ P++ +    LA +   +   +EA  Y   VL M 
Sbjct: 498 GASLANSNRSEEAIQAYHRALQLKPSFVRARYNLAVSSMNIGCYKEAAGYLLTVLSMH 555

>ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR166C (CDC23)
          Length = 614

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 48/105 (45%)

Query: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155
           K    ++ L G++ +  K+   AIE Y  A+   P +   +     AY  +  +  A+  
Sbjct: 415 KTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLDRHLYALYY 474

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDK 200
            +KA  + P   + +  LA     L++P +A++ +++   +  D+
Sbjct: 475 LQKACSLKPLDKRMWQALANCYDKLDRPNQAIKCFQRASQLSNDQ 519

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 36/177 (20%), Positives = 72/177 (40%), Gaps = 22/177 (12%)

Query: 35  VAIDCITESFEFERDTVAQTLQDKFSGKTLKEILSSASATSTGSEKEESVKVNIPVEDAE 94
           +AI  I E +    D  A T+ DK++     E+ SS       +++E+    +I   D  
Sbjct: 388 LAISYINEGY----DMSAFTMLDKWAETKYPEVWSSIKQQHDAAQREKGF-AHI---DMN 439

Query: 95  IKATAESFKLE--------------GNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRA 140
            + T +  +L               G       D+   I+ +  A+K  P + + +    
Sbjct: 440 ARITKQYLQLANSLNTVDPEVQLCLGLLFYTKDDFDKTIDCFESALKVNPNDELMWNRLG 499

Query: 141 AAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
           A+ ++    + AI+   +A+++ P++ +    LA +   +   +EA  Y   VL M 
Sbjct: 500 ASLANSNRSEEAIQAYHRALQLKPSFVRARYNLAVSSMNIGCFKEAAGYLLSVLSMH 556

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 25/116 (21%)

Query: 116 RLAIEKYSEAIKTLP---------TNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAY 166
           ++  ++Y + I TLP           V++YAN         E+D  I   + A+ + P  
Sbjct: 403 KVITDQYLKVINTLPEIDPDVQLGLGVLFYAN--------DEFDKTIDCFKAALHVRPND 454

Query: 167 SKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNL 222
              ++RL  +    N+ EEA++ Y + + ++     PA  R      N   SSMN+
Sbjct: 455 ECMWNRLGASLANSNRSEEAIQAYHRAIQLK-----PAFVR---ARYNLAVSSMNI 502

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 43/94 (45%)

Query: 111 AAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGY 170
           A +DY   I+ +  A+   P + + +    A+ ++    + AI+   +A+++ P++ +  
Sbjct: 434 ANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 493

Query: 171 SRLAFAKYALNKPEEALEYYKKVLDMEGDKATPA 204
             LA +   +   +EA EY    L M   +  P 
Sbjct: 494 YNLAVSSMNIGCYKEAAEYLLTALSMHEVEGVPV 527

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E +K  GN      +Y  A+E Y + I+  P N I Y+N A +   + +Y  A++     
Sbjct: 4   EEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTG 63

Query: 160 IE-IDPAYSKGYSRLAF 175
           ++ ++ A S+ Y +L +
Sbjct: 64  LKYVNDADSQVYKKLQY 80

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 62/141 (43%), Gaps = 16/141 (11%)

Query: 36  AIDCITESFEFER-DTVAQTLQDKFSGKTLKEILSSASATSTGSEKEESVKVNIPVEDAE 94
           A  C  ++FE +  D VA            K ++ +   +   S  E   K+ +  + A+
Sbjct: 613 AFGCYYKAFELDSSDIVAA-----------KYMVETYCNSGNWSAAESISKILVKTDGAK 661

Query: 95  --IKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNA 152
             ++ T   F++ G   +  +    AIE +  A++  P NV  +     +Y S    + +
Sbjct: 662 KYLRYTCWPFRVIGIANLERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEAS 721

Query: 153 IKDAEKAIEIDP--AYSKGYS 171
           I+  EKA E+DP   Y+K ++
Sbjct: 722 IRVFEKATELDPDHLYAKYFT 742

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 42/93 (45%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E++   GN     KD+  +I+ +  + +  P+    Y  +   YSS   +D A+    KA
Sbjct: 410 ETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKA 469

Query: 160 IEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
           +  +P +   +  L      L + EE L +++K
Sbjct: 470 LGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEK 502

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 60/135 (44%), Gaps = 6/135 (4%)

Query: 101 SFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVK--EYDNAIKDAEK 158
           ++ L+G++  +   +  A+  Y +A+ + P +  Y A+       +K  +Y+  +   EK
Sbjct: 445 AYTLQGHEYSSNDAFDTAMTCYRKALGSNPQH--YNAHYGLGMCCLKLGQYEECLLHFEK 502

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKR-DFEMAKNRVE 217
           A  I+P           A   L+  E+AL+YY    +++   +    KR    +A  +  
Sbjct: 503 ARSINPVNVILICCCGVALEKLSHQEKALQYYDLACELQPVSSLALFKRAQLLLAMGKYN 562

Query: 218 SSM-NLEKSSTTTPE 231
            ++ N EK  T  P+
Sbjct: 563 FALENFEKLVTIAPD 577

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 41/97 (42%)

Query: 106 GNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPA 165
           G   +    Y   +  + +A    P NVI       A   +   + A++  + A E+ P 
Sbjct: 484 GMCCLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQEKALQYYDLACELQPV 543

Query: 166 YSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKAT 202
            S    + A    A+ K   ALE ++K++ +  D+AT
Sbjct: 544 SSLALFKRAQLLLAMGKYNFALENFEKLVTIAPDEAT 580

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 47/109 (43%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           A ++ L+G++  +      A   Y  A+   P +   Y      Y  + +YD A+   EK
Sbjct: 516 AYAYTLQGHEHSSNDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEK 575

Query: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKR 207
           A  I+P           A   L+  E+AL+YY++  +++   +    K+
Sbjct: 576 ARNINPVNVILICCCGVALEKLSYQEKALQYYEQACELQPSSSLAKFKK 624

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 44/97 (45%)

Query: 106 GNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPA 165
           G   M    Y  A+  + +A    P NVI       A   +   + A++  E+A E+ P+
Sbjct: 557 GMCYMKLGQYDKALLFFEKARNINPVNVILICCCGVALEKLSYQEKALQYYEQACELQPS 616

Query: 166 YSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKAT 202
            S    + A   Y++ +   ALE ++++  +  D+AT
Sbjct: 617 SSLAKFKKAHLLYSMARYSAALENFEELAKLAPDEAT 653

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 42/93 (45%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E++   GN     KD+  AI+ + +A +  P     Y  +   +SS    D+A     KA
Sbjct: 552 ETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKA 611

Query: 160 IEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
           +  D  +   Y  L  +   L + EEAL Y++K
Sbjct: 612 LACDSQHYNAYYGLGTSSMKLGQYEEALLYFEK 644

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%)

Query: 138 NRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVL 194
           NRAA +  + E + A++DA K   I+P   K + R       L+K ++A   YK  L
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTAL 155

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 40/84 (47%)

Query: 114 DYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRL 173
           D+   I+ +  A+K  P + + +    A+ ++    + AI+   +A+++ P++ +    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 174 AFAKYALNKPEEALEYYKKVLDME 197
           A +   +   +EA  Y   VL M 
Sbjct: 532 AVSSMNIGCLKEAAGYLLSVLSMH 555

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%)

Query: 103 KLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIE 161
           K +GN       Y  A++ Y   I   P N + Y+N+A A   + E+  AI+  ++ ++
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGLQ 70

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 31.2 bits (69), Expect = 1.1,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 32/63 (50%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E  K EGN+      YR AI  Y   I   P N + ++N+A A   + E+  AI+  ++ 
Sbjct: 5   ERDKEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQG 64

Query: 160 IEI 162
           +++
Sbjct: 65  LQL 67

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 38/84 (45%)

Query: 114 DYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRL 173
           DY   ++ +  A+   P + + +    A+ ++    + AI+   KA+++ P + +    L
Sbjct: 441 DYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 500

Query: 174 AFAKYALNKPEEALEYYKKVLDME 197
           A +   +   +EA EY    L M 
Sbjct: 501 AVSCMNMGCYKEAAEYLLTALSMH 524

>SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 628

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 57/131 (43%), Gaps = 3/131 (2%)

Query: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155
           K    ++ L G++ +  K+   AIE Y  A+   P +   +     AY  +  +  ++  
Sbjct: 429 KNCTSAWTLMGHEFVELKNSHAAIESYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYY 488

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDM--EGDKATPAMKRDFEMAK 213
            +KA  + P   + +  LA     L+K +E+++ Y++ L +    D  T  + R   +  
Sbjct: 489 FQKACALKPLDKRMWQALASCYEKLSKKDESIKCYERALQLSISSDHDTAILYR-LALLY 547

Query: 214 NRVESSMNLEK 224
            R++   N  K
Sbjct: 548 ERIQDVRNCRK 558

>TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3.32
           YNL313C
          Length = 914

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 46/103 (44%), Gaps = 1/103 (0%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E++   G   +     +LA E +S  +    TN + ++N +AAY +  +   A     +A
Sbjct: 647 ETWYFYGCIGLECGKMQLAAEAFSRCVSLDDTNAMAWSNLSAAYVNQGKLKEAFSCLNRA 706

Query: 160 IEIDPAYS-KGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKA 201
              D   + + +       + L + +E L   KK++D+  D+A
Sbjct: 707 TRTDSQKNWRIWENYMIVAFKLREWDEVLLSCKKLIDINKDRA 749

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E  K +GN     +DY  A+  Y + ++   TN I ++NRA     +    N  ++A+KA
Sbjct: 5   ERLKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKL----NRSQEAQKA 60

Query: 160 IE 161
            +
Sbjct: 61  CQ 62

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 41/93 (44%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E++   GN     KD+  +I+ +  + +  P+    Y  +   YSS   +D A+    KA
Sbjct: 411 ETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKA 470

Query: 160 IEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
           +  +  +   Y  L      L + EE L +++K
Sbjct: 471 LASNSQHYNAYYGLGMCSLKLGQYEECLLHFEK 503

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 43/97 (44%)

Query: 106 GNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPA 165
           G  ++    Y   +  + +A    P NVI       A   +   + A+++ + A E+ P 
Sbjct: 485 GMCSLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQPM 544

Query: 166 YSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKAT 202
            S    + A    A+ K   ALE ++K++ +  D+AT
Sbjct: 545 SSLALFKRAQLLLAMGKYNYALESFEKLVKIAPDEAT 581

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 35/64 (54%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158
           ++  + +GN   +  +Y  A+  Y  A    P+N ++ AN + A   ++ +++A+   ++
Sbjct: 8   SDHLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDR 67

Query: 159 AIEI 162
           A+EI
Sbjct: 68  ALEI 71

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%)

Query: 102 FKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIE 161
            K EGN      DY  A   Y + IK  PTN I Y+N+A +      +  A++  ++ ++
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 162 IDPAYSK 168
              + +K
Sbjct: 66  YTSSSTK 72

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 34/58 (58%)

Query: 139 RAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDM 196
           R   Y +  ++D  I+  +++++I+P     ++RL  +    NKPE+A++ Y + L++
Sbjct: 437 RGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNL 494

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 40/91 (43%), Gaps = 17/91 (18%)

Query: 116 RLAIEKYSEAIKTLP---------TNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAY 166
           RL IE+Y      LP           +++YAN        +++D  I     A+ + P  
Sbjct: 399 RLIIEQYLRVANALPEVDPDVQLGLGILFYAN--------EDFDKTIDCFRAALAVRPDD 450

Query: 167 SKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
              ++RL  +    N+ EEA++ Y + + ++
Sbjct: 451 ECMWNRLGASLANSNRSEEAIQAYHRAIQLK 481

>Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR080W
           (DIA2) - may be involved in regulation of invasive
           growth and budding pattern [contig 126] FULL
          Length = 690

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 7/112 (6%)

Query: 130 PTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSR-------LAFAKYALNK 182
           P  V    NRAA +  + +   A+KDA +A++ +P   K Y R       L     AL  
Sbjct: 68  PRFVKLLDNRAATWEKLGDLTKALKDANRAVKYEPYNLKCYLRKGKILQKLQLDDMALKN 127

Query: 183 PEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSR 234
            EE L+   ++    G +    + R  E  K+ ++S +   + + ++ E S+
Sbjct: 128 YEEGLQKADEMRSRYGLEPPQKLSRIVEHQKSLIKSRITETRDTVSSEEVSK 179

>SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} similar
           to gnl|GLV|KLLA0B10197g Kluyveromyces lactis
           KLLA0B10197g and some similarites with YDR320C
           uniprot|Q06677 Saccharomyces cerevisiae YDR320C SWA2
           auxilin- like protein
          Length = 582

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 57/131 (43%), Gaps = 10/131 (7%)

Query: 67  ILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAI 126
           +L    A S    +  S +  I +   E+    E FK +G +  A  +Y  A+ +Y +++
Sbjct: 258 LLDFEQAVSPPQLRSSSARPPISISAMELSGFGE-FKSKGGELFAHGNYSSALLEYEKSL 316

Query: 127 KTLPTN----VIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNK 182
            TLP+     +I  +N       + E  +A+++ E A+ +      G   L     A N 
Sbjct: 317 NTLPSGHPLRIISLSNIITTQLKLGESSSALQNIETALRL-----IGEDELQLTIPASNP 371

Query: 183 PEEALEYYKKV 193
           P+   E++ K+
Sbjct: 372 PKSYREFWGKI 382

>NCAS0G00350 Chr7 complement(60735..62831) [2097 bp, 698 aa] {ON}
           Anc_5.689 YOR080W
          Length = 698

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%)

Query: 138 NRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
           NRAA +  + E + A++D++K   I+P   K Y R       L K ++A + YK+ L   
Sbjct: 78  NRAACWEKLGELERALRDSQKMCYIEPYNLKCYLRRGRLLQRLGKDKDAYKNYKEALQRV 137

Query: 198 GD 199
            D
Sbjct: 138 QD 139

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%)

Query: 106 GNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPA 165
           GN     +D+  AI+   +A    P     Y  +   YS+   +DNA     KA+ I+P 
Sbjct: 445 GNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 504

Query: 166 YSKGYSRLAFAKYALNKPEEALEYYKK 192
           +   +  L  +   L + +EAL +++K
Sbjct: 505 HYNAHYGLGMSCIKLGQYDEALLHFEK 531

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 61/137 (44%), Gaps = 8/137 (5%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVK--EYDNAIKDA 156
           A ++ L+G++      +  A   Y +A+   P +  Y A+     S +K  +YD A+   
Sbjct: 472 AYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHF 529

Query: 157 EKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRV 216
           EKA  I+P           A   L + E+AL++Y+   +++ + +    K+  ++  N  
Sbjct: 530 EKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKKS-QLLFNLG 588

Query: 217 ESS---MNLEKSSTTTP 230
           + S    N EK    TP
Sbjct: 589 QYSNALQNFEKLEQLTP 605

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR189W
           (SKI3)
          Length = 1390

 Score = 32.3 bits (72), Expect = 2.2,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 43/78 (55%)

Query: 118 AIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAK 177
           +IE +  A++   ++V  +     AY++    + +IK  E+A+E+ P +      LA + 
Sbjct: 679 SIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALELSPEHKYAGLFLAISL 738

Query: 178 YALNKPEEALEYYKKVLD 195
             L++ E++LE  +K+++
Sbjct: 739 CQLSEFEKSLEALRKLVN 756

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 118 AIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDP--AYSKGYSRLAF 175
           +IE +  A++  P+++  +     AY +    + ++K  EKA+E++P  AY+  +  L+ 
Sbjct: 699 SIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEPTSAYAHYFKALSL 758

Query: 176 AKYAL 180
           ++  L
Sbjct: 759 SRMGL 763

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%)

Query: 109 AMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSK 168
           A+A++DY  ++ K  + +K    N   +     AYS + +  N+      AI IDP  + 
Sbjct: 14  ALASEDYEESVLKSKQVLKIDKQNYFAHVFLGKAYSCLNDLSNSKDHYTTAIHIDPENAL 73

Query: 169 GYSRL 173
           G+  L
Sbjct: 74  GWKGL 78

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%)

Query: 98  TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAE 157
           +A ++   GN     +D+  AI+   +A    P     Y  +   YS+   +DNA     
Sbjct: 456 SAITWCCLGNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYR 515

Query: 158 KAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
           KA+ I+P +   +  L  +   L + +EAL +++K
Sbjct: 516 KALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEK 550

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAYSSVKEYDNAIKD 155
           + FK +G  + +A DY  A + + +++ +LP +     I  +N       + EY  AI+D
Sbjct: 305 QEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIED 364

Query: 156 AEKAIEI 162
           +  A+++
Sbjct: 365 SSVALKL 371

>KLLA0E11573g Chr5 (1017355..1018833) [1479 bp, 492 aa] {ON} similar
           to uniprot|P11914 Saccharomyces cerevisiae YHR024C MAS2
           Larger subunit of the mitochondrial processing protease
           essential processing enzyme that cleaves the N-terminal
           targeting sequences from mitochondrially imported
           proteins
          Length = 492

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 2/76 (2%)

Query: 33  LNVAIDCITESFEFERDTVAQTLQDKFSGKTLKEILSSASATSTGSEKEESVKVNIPVED 92
             V+I CI ++  F  + +AQTL + F+   LK  L+    + + ++ + S+ +N+  + 
Sbjct: 339 FGVSISCIPQAAPFAAEIIAQTLSNVFANDKLK--LTKEEVSRSKNQLKSSLLMNLESKI 396

Query: 93  AEIKATAESFKLEGNK 108
            E++       L G K
Sbjct: 397 VELEDLGRQVLLHGRK 412

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 69/155 (44%), Gaps = 27/155 (17%)

Query: 66  EILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEA 125
           E LSS +  S  S  +E + V I +   E+    E FK  G +     DY  A E+Y ++
Sbjct: 366 EDLSSPANVSISSSGQECIPV-ISINQIELSGYNE-FKDRGTEYFKKGDYVSATEQYEKS 423

Query: 126 IKTL----PTNVIYYANRAAA------YSSV---------------KEYDNAIKDAEKAI 160
           + +L    P  +I  +N  A+      Y+S+               K +DN I+++E + 
Sbjct: 424 LNSLSKLHPLRIIASSNLLASLLKTGDYTSMITISTSALDLFPKESKLWDNVIQNSEPSK 483

Query: 161 EIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLD 195
                +SK  +R A A   +   ++A + Y+ +++
Sbjct: 484 TYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIE 518

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 62/140 (44%), Gaps = 4/140 (2%)

Query: 57  DKFSGKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYR 116
           D+F  +T   I   A+  ST  E E+S+           K T+ ++ L G++ +  K+  
Sbjct: 449 DRFRPETCCII---ANFYSTRQEHEKSIMYFRRALTLNKKNTS-AWTLMGHEFVELKNSH 504

Query: 117 LAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFA 176
            AIE Y  A+   P +   +     AY  +  +  ++   +KA  + P   + +  L   
Sbjct: 505 AAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACALKPLDKRMWQALGEC 564

Query: 177 KYALNKPEEALEYYKKVLDM 196
            + ++  + AL+ YK+ L +
Sbjct: 565 YFIVDNTDSALKCYKRALQL 584

>TPHA0A04590 Chr1 complement(1041662..1042540) [879 bp, 292 aa] {ON}
           Anc_1.205 YJL145W
          Length = 292

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 69/168 (41%), Gaps = 17/168 (10%)

Query: 27  EDSADSLNVAIDCITESFEFERDTVAQTLQDKFSGKTLKEILSSASATSTGSEKEESVKV 86
           ED A SL   +  I + ++FE DTV Q L D    ++    LS+A   S  +E  +SV +
Sbjct: 53  EDIARSL---VYKICKGYQFEYDTVIQVLVDILKWRSKFNPLSAAFKESH-NEILQSVGI 108

Query: 87  NIPVEDAEIKATAESFKLEG----NKAMAAKD-----YRLAIEKYSEAIKTLPTNVIYYA 137
                D E      ++ L G    +K + A       YR+ + +    +    +    Y 
Sbjct: 109 LTSYPDDEANKKIITWNLYGKIVKHKELFADSEAFIRYRIGLMERGLKLLDFTSEDNSYM 168

Query: 138 NRAAAYSSVKEY--DNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKP 183
            +   Y  V  +  D  IK   K  +    + K Y  L FAKY +N P
Sbjct: 169 TQVHDYKGVSVFKMDPQIKSCTK--QTIAIFQKYYPELLFAKYFVNVP 214

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 38/84 (45%)

Query: 114 DYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRL 173
           DY   ++ +  A+   P + + +    A+ ++    + AI+   KA+++ P + +    L
Sbjct: 434 DYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 493

Query: 174 AFAKYALNKPEEALEYYKKVLDME 197
           A +   +   +EA EY    L M 
Sbjct: 494 AVSCMNMGCFKEAAEYLLTALSMH 517

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/123 (19%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 111 AAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGY 170
           A  ++   I+ +  A+K  P + + +    A+ ++    + AI+   +A+++ P++ +  
Sbjct: 436 ANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 495

Query: 171 SRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTP 230
             LA +   +   +EA E+    L M        ++ +FE+   R  S  + +K S +  
Sbjct: 496 YNLAVSSMNIGCYKEAAEHLLTALSMHD------VEGEFEVQSTRSNSISSADKYSFSGF 549

Query: 231 EPS 233
           +P+
Sbjct: 550 KPT 552

>Ecym_1366 Chr1 (753035..754213) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AEL062C
          Length = 392

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 23/126 (18%)

Query: 101 SFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIK-DAEKA 159
           + K  G      KDY+ A  KY ++++                  V EY   I+ D E+ 
Sbjct: 241 TIKESGTILFKRKDYQNAYYKYRKSLRY-----------------VNEYIPDIELDDERF 283

Query: 160 IEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEG----DKATPAMKR-DFEMAKN 214
           +  +    K Y  L+F  + L++ +E++ Y   +++MEG    DKA    +R +  + K 
Sbjct: 284 LLFNKLKMKLYLNLSFVLFILSRHDESITYANYLIEMEGVTSLDKAKAYYRRGNCYLVKK 343

Query: 215 RVESSM 220
           R+E ++
Sbjct: 344 RLEDAL 349

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 51/123 (41%), Gaps = 22/123 (17%)

Query: 106 GNKAMAAKDYRLAIEKYSEAIKTLPTNV------------------IYYANRAAAYSSVK 147
           G+     KDY+ +  KY +A+K + T +                    Y N   A  ++K
Sbjct: 241 GSALFKIKDYQNSYYKYMKALKYVNTYIPEQDVDEKHCLLFIELKKKLYLNICLALFNLK 300

Query: 148 EYDNAIKDAEKAIEIDPA----YSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATP 203
           +YD ++K     +E+D       +K Y R+  + +A  + +EAL+ Y+   D   D    
Sbjct: 301 DYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRYDEALKNYRLCRDHNPDDNVI 360

Query: 204 AMK 206
             K
Sbjct: 361 GQK 363

>KLLA0E22705g Chr5 complement(2027229..2028398) [1170 bp, 389 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 389

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 49/116 (42%), Gaps = 24/116 (20%)

Query: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIK-------------------TLPTNVIYYANR 139
           AE+ K  G+     +D+R A+ KY +A+K                   T+  + + Y N 
Sbjct: 236 AETIKESGSLLFKKRDFRNALFKYKKALKYTTAYTPEVDIDKFHNEKFTIQKHKL-YLNI 294

Query: 140 AAAYSSVKEYDNAIKDAEKAIEIDPA----YSKGYSRLAFAKYALNKPEEALEYYK 191
                 +KEY  +IK +   ++ D       +K Y R     YALN+ E AL  YK
Sbjct: 295 CLMLFYLKEYHESIKYSTFLVDDDRVGNKDKAKAYLRRGNCLYALNRFEAALTDYK 350

>Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON}
           (57301..58476) [1176 nt, 392 aa]
          Length = 391

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 48/117 (41%), Gaps = 26/117 (22%)

Query: 101 SFKLEGNKAMAAKDYRLAIEKYSEAIKTL----------PTNVI--------YYANRAAA 142
           + K  G      KDY+ A+ KY +++K +            N I         Y N +  
Sbjct: 240 TIKESGTLLFKQKDYQNALLKYKKSLKYVNEFIPEMEVNKDNCILFTVLKMKLYLNISLV 299

Query: 143 YSSVKEYDNAIK------DAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKV 193
           Y ++K+ DN I       D E   ++D A  K Y R   A +A  + EEAL  YK  
Sbjct: 300 YFNLKDNDNCITYTTYLLDMENVPDLDQA--KAYYRRGNAYFAKKRLEEALNDYKNC 354

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 33/176 (18%), Positives = 71/176 (40%), Gaps = 22/176 (12%)

Query: 34  NVAIDCITESFEFERDTVAQTLQDKFSGKTLKEILSSASATSTGSEKEE----------- 82
           N+AI  I E +    D  A T+ ++++      +L S    +  +E+E            
Sbjct: 329 NLAISYINEGY----DVSAFTMLNRWAETKYSNLLDSNEGITISNEEERFALNAKIRREF 384

Query: 83  -SVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAA 141
             +   +P  D +++         G    A  ++   I+ +  A+   P + + +    A
Sbjct: 385 LQIANRLPRVDPDVQLCL------GLLFYADSEFDKTIDCFKAALSVNPNDELMWNRLGA 438

Query: 142 AYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
           + ++    + AI+   KA+++ P++ +    LA +   +   +EA EY    L M 
Sbjct: 439 SLANSNRSEEAIQAYYKALQLKPSFVRARYNLAVSSINIGCYKEAAEYLLSALKMH 494

>KLLA0C02453g Chr3 complement(216740..219826) [3087 bp, 1028 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1028

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 36/89 (40%), Gaps = 7/89 (7%)

Query: 116 RLAIEKYSEAIKT--LPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRL 173
           R AI  Y+ AI+        IY  NRA  Y  + +   A    +K    DP  +     L
Sbjct: 196 RQAIYCYTRAIRINNEEWECIY--NRALLYKEIGQLGRAFDGFQKLYAYDPLDANILREL 253

Query: 174 AFAKYALNKPEEALEYYKKVLDMEGDKAT 202
           A      N+  EA+E Y KV    GD  T
Sbjct: 254 AVIYVEYNRVSEAIELYMKVF---GDNVT 279

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 118 AIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPA--YSKGYSRLAF 175
           +IE +  AI+  P +V  +     AY      + +IK  EKAIE+D +  Y+K +  +A 
Sbjct: 684 SIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYAKYFKSIAL 743

Query: 176 AK 177
           ++
Sbjct: 744 SE 745

>NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {ON}
           Anc_3.32 YNL313C
          Length = 918

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/103 (19%), Positives = 49/103 (47%), Gaps = 1/103 (0%)

Query: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKA 159
           E++   G  A+      +A E +S  +   PT+ + ++N +AAY  + +   A    +++
Sbjct: 645 ETWYFYGCVALECNKMEVAAEAFSRCVSLDPTHAMAWSNLSAAYVELNKLKEAFSCLKRS 704

Query: 160 IEIDPAYS-KGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKA 201
           I  D   + + +         LN+ ++ L   K+++++  +K+
Sbjct: 705 IACDSQRNWRIWENYMLVSAKLNEWDDVLIACKQLVNIRRNKS 747

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 47/106 (44%)

Query: 101 SFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAI 160
           ++ LEG++  +   +  A   Y +AI   P +   Y         + +YD A+   EKA 
Sbjct: 654 AYTLEGHEQASIDAFDTAKNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAK 713

Query: 161 EIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMK 206
            I+P+ +        A   LN  E+AL YY+   +++ + +    K
Sbjct: 714 MINPSNAILLCCCGSALEKLNFNEKALNYYELACNLQPNSSFAKFK 759

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 37/92 (40%)

Query: 101 SFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAI 160
           S+   GN      D+  AI+   +A    P     Y       +S+  +D A     KAI
Sbjct: 620 SWCFIGNYFSLINDHDKAIKYLKKATTINPRFTYAYTLEGHEQASIDAFDTAKNCYRKAI 679

Query: 161 EIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
             DP +   Y  L      L + ++AL Y++K
Sbjct: 680 ACDPNHYNAYYGLGTCCMRLGQYDQALLYFEK 711

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%)

Query: 126 IKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYS 171
           I   P N I +      +S + ++D AIK  +KA  I+P ++  Y+
Sbjct: 611 IDNYPNNSISWCFIGNYFSLINDHDKAIKYLKKATTINPRFTYAYT 656

>CAGL0K05599g Chr11 (545761..547893) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q08496 Saccharomyces cerevisiae YOR080w
          Length = 710

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%)

Query: 123 SEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNK 182
            E I T P +V    N +A +      DNA+K + K ++++P   K Y R       L K
Sbjct: 68  CERIITHPKHVKILDNLSACWEKQNILDNALKLSHKMVKLEPFNIKTYIRKGRILMKLTK 127

Query: 183 PEEALEYYKKVL 194
             +A   +K+ L
Sbjct: 128 YRDAYHNFKEGL 139

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 42/97 (43%)

Query: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155
           + T +++   GN     KD+  AI+ + +A +  P     Y  +   YSS   +D A   
Sbjct: 411 RFTPQTWCCVGNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTC 470

Query: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKK 192
             KA+  +  +      L      L + EE+L +++K
Sbjct: 471 YRKALATNSQHYNASYGLGMCCLKLGQYEESLLHFQK 507

>YIL073C Chr9 complement(222937..225809,225900..225954) [2928 bp,
           975 aa] {ON}  SPO22Meiosis-specific protein essential
           for chromosome synapsis, involved in completion of
           nuclear divisions during meiosis; induced early in
           meiosis
          Length = 975

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 72/166 (43%), Gaps = 20/166 (12%)

Query: 58  KFSGKTL--KEILSSASATSTGSEKEESVK---------VNIPVEDAEIKATAESFKLEG 106
           KF GK +  + ++++ S T   SE  ES++         V+ P+    I          G
Sbjct: 397 KFLGKAICSRFLITTQSKTMNDSEIAESLENFSTQMERIVSEPLTKHAISCIITLLWNTG 456

Query: 107 NKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRA-------AAYSSVKEYDNAIKDAEKA 159
            K    + Y ++I  Y  A+K + +    Y++R          Y+ +++Y N ++  +  
Sbjct: 457 KKLEKMEKYVVSIRFYKLALKDIISQ--NYSDRGKIQRALQVVYNKIEDYSNTVRVYQDM 514

Query: 160 IEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAM 205
            E+D         +  +  A +K EEAL   +K+   E +K+T A+
Sbjct: 515 DEVDRQSPLCQLLMLQSFLADDKTEEALTCLQKIKSSEDEKSTDAL 560

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 69/164 (42%), Gaps = 25/164 (15%)

Query: 34  NVAIDCITESFEFERDTVAQTLQDKFSGKTLKEILSSASATSTGSEKEESVKVNIPVEDA 93
           N+AI  I E +    D  A T+ +K+       I +S+    T   K    ++  P+  +
Sbjct: 372 NLAISYINEGY----DASAFTILNKWIETKYSTIDTSSPEIITDGHKLVESEMEDPLSLS 427

Query: 94  EIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAI 153
           E K T    KL     +   D +L +             +++YAN         +++  I
Sbjct: 428 E-KITKRFLKLANQLPVVDSDVQLCL------------GLLFYAN--------DDFNKTI 466

Query: 154 KDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDME 197
              + A++++P     ++RL  A    N+ EE+++ Y + L ++
Sbjct: 467 DCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLK 510

>TBLA0A09170 Chr1 complement(2276263..2278443) [2181 bp, 726 aa]
           {ON} Anc_5.689 YOR080W
          Length = 726

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 138 NRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSR 172
           N AA +  V E   AI+ ++K IE +P   KGY R
Sbjct: 81  NLAACWEKVGEVSKAIRVSKKMIESEPYNMKGYIR 115

>Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {ON}
           YPR088C (REAL)
          Length = 539

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 35/97 (36%), Gaps = 24/97 (24%)

Query: 238 QQPANPFAGSGMPDXXXXXXXXXXXXXXXXXXXXPQVMQAAQQMM-SDPNSMQ------- 289
           QQP  P A   MP                     PQ+MQ AQQ +  +P  MQ       
Sbjct: 443 QQPGAPGANGRMPGMPNMPGMPGMPNMPGMPKVSPQMMQQAQQKLKQNPGLMQNMMSMFG 502

Query: 290 ----------------KMQEMMQNPNLREMAQNLASG 310
                           +M +MMQ+P ++EMA+    G
Sbjct: 503 GSGMGGGMGGGMPDMNEMMKMMQDPQMQEMAKQFGMG 539

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.122    0.322 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,083,857
Number of extensions: 1266762
Number of successful extensions: 6869
Number of sequences better than 10.0: 334
Number of HSP's gapped: 6690
Number of HSP's successfully gapped: 462
Length of query: 338
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 228
Effective length of database: 40,868,139
Effective search space: 9317935692
Effective search space used: 9317935692
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)