Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H008206.20ON1146114657150.0
NDAI0D008006.20ON1193119120370.0
Suva_13.1606.20ON1090112617850.0
Skud_13.1526.20ON1090113117200.0
Smik_13.1576.20ON1090111917190.0
ZYRO0C07810g6.20ON1099115116260.0
Sklu_YGOB_Anc_6.20b6.20ON1088115316060.0
TDEL0G044906.20ON1093114115500.0
Sklu_YGOB_Anc_6.20singletonOFF84985113151e-164
ACR006C6.20ON1071114112721e-156
Kpol_1037.256.20ON1105113212641e-154
TPHA0J003306.20ON1107114312591e-153
Ecym_30246.20ON1079112912561e-153
Kwal_56.224246.20ON1089113912501e-152
CAGL0L07634g6.20ON1130112712251e-148
KLTH0C11242g6.20ON1097116811731e-141
YML002W6.20ON73773711441e-141
KNAG0M011606.20ON1131117811551e-138
KLLA0D01133g6.20ON10677919191e-105
TBLA0A072606.20ON120412319201e-104
KAFR0L004006.20ON9427956453e-69
YML003WsingletonOFF2902905731e-65
YBR107C (IML3)3.358ON245107880.070
Kpol_455.88.876ON457162820.51
Suva_4.3543.358ON24587771.6
CAGL0C01309g2.257ON111032753.6
KAFR0A030108.876ON453123744.1
Smik_13.5008.849ON60237744.7
NCAS0E032207.240ON341114718.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H00820
         (1146 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....  2206   0.0  
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   789   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   692   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   667   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   666   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   630   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   623   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   601   0.0  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   511   e-164
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   494   e-156
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   491   e-154
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   489   e-153
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   488   e-153
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   486   e-152
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   476   e-148
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   456   e-141
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   445   e-141
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   449   e-138
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   358   e-105
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   358   e-104
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   253   3e-69
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   225   1e-65
YBR107C Chr2 complement(453793..454530) [738 bp, 245 aa] {ON}  I...    39   0.070
Kpol_455.8 s455 (8478..9851) [1374 bp, 457 aa] {ON} (8478..9851)...    36   0.51 
Suva_4.354 Chr4 complement(622959..623696) [738 bp, 245 aa] {ON}...    34   1.6  
CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} simil...    33   3.6  
KAFR0A03010 Chr1 (617730..619091) [1362 bp, 453 aa] {ON} Anc_8.8...    33   4.1  
Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284...    33   4.7  
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    32   8.7  

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score = 2206 bits (5715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1119/1146 (97%), Positives = 1119/1146 (97%)

Query: 1    MEQYHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKI 60
            MEQYHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKI
Sbjct: 1    MEQYHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKI 60

Query: 61   QLEDLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNN 120
            QLEDLCYHNVDFIGAHILLPPK            GYTRLASIEQFDTLNGDNILVKWRNN
Sbjct: 61   QLEDLCYHNVDFIGAHILLPPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNN 120

Query: 121  FLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDT 180
            FLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDT
Sbjct: 121  FLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDT 180

Query: 181  LTLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN 240
            LTLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN
Sbjct: 181  LTLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN 240

Query: 241  ETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGT 300
            ETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGT
Sbjct: 241  ETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGT 300

Query: 301  RIKNISIEEIDDKFYEMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQIL 360
            RIKNISIEEIDDKFYEMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQIL
Sbjct: 301  RIKNISIEEIDDKFYEMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQIL 360

Query: 361  TNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYLKKFNYDEN 420
            TNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYLKKFNYDEN
Sbjct: 361  TNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYLKKFNYDEN 420

Query: 421  LINFGILSYTISTFEIVIYSFENIVEYDKLKSYSEIIEKLIKVDDLKKVPKTIKWEQFLT 480
            LINFGILSYTISTFEIVIYSFENIVEYDKLKSYSEIIEKLIKVDDLKKVPKTIKWEQFLT
Sbjct: 421  LINFGILSYTISTFEIVIYSFENIVEYDKLKSYSEIIEKLIKVDDLKKVPKTIKWEQFLT 480

Query: 481  FRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTLLMQALIYRNFK 540
            FRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTLLMQALIYRNFK
Sbjct: 481  FRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTLLMQALIYRNFK 540

Query: 541  ISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKYVNWKQRDLVGR 600
            ISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKYVNWKQRDLVGR
Sbjct: 541  ISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKYVNWKQRDLVGR 600

Query: 601  TPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNSILHILRSNIDI 660
            TPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNSILHILRSNIDI
Sbjct: 601  TPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNSILHILRSNIDI 660

Query: 661  LFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFNRYQRELYTTCF 720
            LFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFNRYQRELYTTCF
Sbjct: 661  LFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFNRYQRELYTTCF 720

Query: 721  DYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPLPDKENETGTVNIK 780
            DYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPLPDKENETGTVNIK
Sbjct: 721  DYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPLPDKENETGTVNIK 780

Query: 781  VKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEMLRNQSXXXXXXXX 840
            VKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEMLRNQS        
Sbjct: 781  VKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEMLRNQSLLRRLTDC 840

Query: 841  XXXXXXXDIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEKKSLKPEDINIIQSFL 900
                   DIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEKKSLKPEDINIIQSFL
Sbjct: 841  LDTLLFFDIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEKKSLKPEDINIIQSFL 900

Query: 901  KFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKNDQIAQATNRSLEP 960
            KFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKNDQIAQATNRSLEP
Sbjct: 901  KFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKNDQIAQATNRSLEP 960

Query: 961  IIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNWWKLYGELLELNKHY 1020
            IIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNWWKLYGELLELNKHY
Sbjct: 961  IIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNWWKLYGELLELNKHY 1020

Query: 1021 NKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSLE 1080
            NKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSLE
Sbjct: 1021 NKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSLE 1080

Query: 1081 ILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRRGDLEAVNDDLITFTEKTCSILR 1140
            ILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRRGDLEAVNDDLITFTEKTCSILR
Sbjct: 1081 ILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRRGDLEAVNDDLITFTEKTCSILR 1140

Query: 1141 DLGIPL 1146
            DLGIPL
Sbjct: 1141 DLGIPL 1146

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/1191 (41%), Positives = 724/1191 (60%), Gaps = 74/1191 (6%)

Query: 1    MEQYHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKI 60
            M QYHLPTLLNPLLN++FNCP+PS+SP KKL+ +LK++ FILLVPPT TLLNYTD+  K+
Sbjct: 1    MSQYHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKL 60

Query: 61   QLEDLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNN 120
             L +LCYHN DF+G+HIL                  T     E+FD LNG+  ++KW++N
Sbjct: 61   SLNELCYHNSDFLGSHIL------TWSNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHN 114

Query: 121  FLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDT 180
             +       N Q+ KI +I  L NFNDY  GS  F L+ IDKP+    +  ND L+C   
Sbjct: 115  IIFTRGNFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKC--- 171

Query: 181  LTLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN 240
            L  +  D  S     PL+QD+SQ  +S FEN +N N+ WN +F    N YK  ++  EPN
Sbjct: 172  LLPNTRDLKSQEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPN 231

Query: 241  ETLFKQIVAVAYNELKSNKIFKGF-----GHLRRLIHEYLEINLYDHLWLQITTLCA--- 292
              LF+++V  A+ E+ S K F+         L +L H+Y+E +LYD +W +I  +     
Sbjct: 232  HKLFRELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSV 291

Query: 293  ---LDDETKGTRIKNISIEEIDDKFYEMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEK 349
                DD+     IK+ SI EID  FY++FPL F+  LEKN+  S   INKL    S+ EK
Sbjct: 292  KNYADDQKAQHLIKHFSIVEIDPNFYDIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEK 351

Query: 350  SENLIATLQILTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNI 409
            S  LI +LQI+T+ +    E   +N+ G   LIDAD L+NLL L+I +S I + DLK N+
Sbjct: 352  STILIESLQIITDSNTGGEESKDKNKSGY--LIDADNLLNLLTLVILQSNITLHDLKANL 409

Query: 410  FYLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSYSEIIEKLIKVDDLKKV 469
            +YLK F+ DE+  +FGIL+YTI+TF +V +  EN++++D+LK  S++IE+LI  DDL  +
Sbjct: 410  YYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIEELIMTDDLSTL 469

Query: 470  PKTIKWEQ--FLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGT 527
              T + ++   L +R+  GES+L   I N Q +KF   L++YE+I +MD I +D +++ +
Sbjct: 470  SSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSS 529

Query: 528  TLLMQALIYRNFKISMVLINLLLRNCSN-KQIMEYINKIDKFNRNVGHYLINELEILKII 586
            TLL+QA+   NF+ +++L+ LL +NC N K+++ YIN++D  NRN+GHYL+  L ILKII
Sbjct: 530  TLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKII 589

Query: 587  GKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLK 646
            G+++NWKQ+D+ GRTPLFTIFR YDQ NYDE++  VF I + WYA N LKFQM+DH D  
Sbjct: 590  GQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSN 649

Query: 647  DNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRL 706
             NS+LHIL++NI IL  Y+K  +  I++NK N KGFTPLM+Y KY R  N+++I+ +++L
Sbjct: 650  GNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKL 709

Query: 707  LFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATF----- 761
            +FN++Q   +  CFDY+ DS+I N++G+  L N  +FG+I + SLK + ST  +      
Sbjct: 710  IFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLY 769

Query: 762  -SLTFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRII---KVLVKLTSKEN 817
             + T  + + +  T T  +K  +++  LK++++K  IS LPLD ++   +  +   SK N
Sbjct: 770  INYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNN 829

Query: 818  NK---IIVRKIEMLRNQSXXXXXXXXXXXXXXXDIGIDYLSLITDETKLLGWVTNENTKL 874
            N    I +R IE LR +                D       L+  ET+LL W++ E +KL
Sbjct: 830  NNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETELLEWISIEESKL 889

Query: 875  KHNVNKTHGEKK-----------SLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNF 923
            + +      + K            LKPE+INIIQ+FLKFN+ EL  + +N+K L KL+ F
Sbjct: 890  RRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSKLVIF 949

Query: 924  IHLKSIDVKESRLAFVHLVKSIKNDQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDF 983
            ++LK++D+ ++++ F  LVK + N ++     +S   I   +  +++      + +++ F
Sbjct: 950  MNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISF 1009

Query: 984  LKACTLILTGNIEDILRTQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATD------- 1036
               CTL L  ++E+I++ +IPNWWKLYGELLELNK+Y+K F PN   +   TD       
Sbjct: 1010 FNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNF-PNCVVHARRTDLLSGNNA 1068

Query: 1037 -----------------NQHSAEVSNDVNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSL 1079
                               H +E  N+ NN GVF  LIENQ+NK  +K    ID+    L
Sbjct: 1069 NTNTNTNTNTNTNSPQRLHHHSEHQNNSNN-GVFANLIENQKNKLERKTSHHIDETISLL 1127

Query: 1080 EILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRRGDLEAVNDDLIT 1130
            E LG+ +  KHE LAEELN+YMEFK  FF + I++N+   D++ + + ++ 
Sbjct: 1128 ESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIKLLEEHVLV 1178

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1126 (35%), Positives = 658/1126 (58%), Gaps = 64/1126 (5%)

Query: 1    MEQYHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKI 60
            M  YHLPTLLNPL+N+IFNCP P  SPLKKL+A+L+ + FILL PP+  LLNY D KTK+
Sbjct: 1    MSIYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKL 60

Query: 61   QLEDLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNN 120
             L +LCY N DFI +HILL  +                    + ++TL+G  ++V+W+NN
Sbjct: 61   PLHELCY-NADFINSHILLTTENSYINTTLRD----------DHYETLDGKTVVVQWKNN 109

Query: 121  FLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDT 180
             +  L+G P R+++KI   ++LPNFNDY +G+ YF +++ID+PL  + +  ND L CF++
Sbjct: 110  VIHTLNGFPLRRRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVP-NDYLHCFNS 168

Query: 181  LTLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN 240
               ++    ++ +A  L+ D SQ ERS FENI++ +  W  +     + Y+ +   ++P+
Sbjct: 169  ---YEETSKTARNAPNLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPS 225

Query: 241  ETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGT 300
            + +F+++V  A++ +KS+ +FK F +L  LIH+Y E+NLY+ +W ++T +     E    
Sbjct: 226  KKMFEELVEQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLT-IHFKGYEVNTE 284

Query: 301  RIKNISIEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIAT 356
              +  S+ ++   +Y    E F L  IT +E+ +  ++    KL   +S+ EKS+ L+ T
Sbjct: 285  NCEYFSVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVET 344

Query: 357  LQILTNMDNPIGELNQENEKGANNL-IDADTLINLLILIICRSEINIVDLKRNIFYLKKF 415
            LQ L+   + +G    +   G NNL +DADTLI+L +L++CRSE     ++ +++YL+ F
Sbjct: 345  LQHLSGTTD-MGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQK--HIRSHLYYLQNF 401

Query: 416  NYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSYS--------EIIEKLIKVDDLK 467
            + + +   FGIL Y IST E V+  FEN  + +   + +        ++++KL   +   
Sbjct: 402  SNNSSSSKFGILGYAISTLEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTN 461

Query: 468  KVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGT 527
            +V     ++  L +R++ G+SIL  CITNN+ +  LD+L +YE +F +++IL+D  ++G+
Sbjct: 462  EVNDLATYKDILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGS 521

Query: 528  TLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIG 587
            TLL++++   N + + +LI ++L NC++++++ Y+NK DK+ R+V HYL +E++ILK IG
Sbjct: 522  TLLIESIKVGNLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIG 581

Query: 588  KYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKD 647
             Y+NWKQ++  G+TPLF+IFR YDQPNY+E++   F+I  +WY  +   F  SDH D K 
Sbjct: 582  SYINWKQKNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKG 641

Query: 648  NSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLL 707
            NS+LH+L++++ IL   +K N     IN  NYKG TPLM+YVKY RLSN+  I  D RL+
Sbjct: 642  NSLLHVLKTDVSILLQLTKLN-----INGENYKGLTPLMVYVKYKRLSNIDAITKDHRLI 696

Query: 708  FNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPL 767
              + Q   + TCFDYA D  + +++G+    N+++FG IY+HSL+   + NAT ++T  +
Sbjct: 697  LEKVQNSTFFTCFDYAKDRLVLSKIGERG-ANDSIFGLIYLHSLRYH-NLNATVNVT-SV 753

Query: 768  PDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEM 827
               E    T  I +K I  LL+ I K +  + LP+D  I  +  L   +   I    +  
Sbjct: 754  SKTEEPFVTAVINMKTIQGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRS 813

Query: 828  LRNQSXXXXXXXXXXXXXXXDIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEKKS 887
            L ++                +       L TDE  +L W+   NT  ++    +    K+
Sbjct: 814  LLHKLTNCFNVLLFLKKVPQN-------LFTDEASVLYWM-RINTSRRNQKPPSKDNPKT 865

Query: 888  LKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKN 947
            ++PE+IN+IQSFL+FN  E+ +   ++  L K+L F+ LKS D +++  + + +   + N
Sbjct: 866  MEPEEINMIQSFLRFNFDEILSFKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTN 925

Query: 948  DQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNWW 1007
             + A A       II+   + +    + L+ + + FL+ CT+ L  +I+ IL  +IPNWW
Sbjct: 926  GKAADA----FTTIIKNHKMFSDLSLDELL-EHVQFLEECTIQLFNSIQTILFDRIPNWW 980

Query: 1008 KLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKK 1067
            K YGE L L+K+Y K FP        A   + +A  S+ +      GG IE +R ++ ++
Sbjct: 981  KHYGEFLTLHKNYRKAFPS-------AVKPKSTAGTSSHI----PLGGFIETKREQSEQR 1029

Query: 1068 LKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAII 1113
            L   I      L+ LG+EIF  HE LAEEL+ YMEF+     +  I
Sbjct: 1030 LSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQRTI 1075

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1131 (35%), Positives = 637/1131 (56%), Gaps = 74/1131 (6%)

Query: 1    MEQYHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKI 60
            M  YHLPTLLNPL+N+IFNCP P  SPLKKL+A+LK + FILL PP   LLNY D KTK+
Sbjct: 1    MSVYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKL 60

Query: 61   QLEDLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNN 120
             L +LCY NVDFI +HILL  +                      ++TL+G  ++++W+NN
Sbjct: 61   PLHELCY-NVDFINSHILLTTENSYLNTTLRD----------SHYETLDGKAVVIQWKNN 109

Query: 121  FLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDT 180
             +  L+G P RQ++KI   +VLPNFNDY +G+  F ++ ID+PL  +V   ND L+CFD+
Sbjct: 110  IIHALNGFPIRQRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAP-NDYLKCFDS 168

Query: 181  LTLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN 240
               ++    ++     L  +  + ERS F+NI++ +     +     + Y+     ++P+
Sbjct: 169  ---YEEVPKNAQSVSNLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPS 225

Query: 241  ETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGT 300
            + +F+ IV  +++ +KS+ +FK F +L  LIH+Y E+NLYD +W ++ T      E    
Sbjct: 226  KKMFEDIVQQSFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFK-GYEVDTE 284

Query: 301  RIKNISIEEIDDKFYEM----FPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIAT 356
            + K  S+ ++   F+      F L  IT +E+ +  ++    KL   +S+ EKS+ L+ T
Sbjct: 285  KYKYFSVNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVET 344

Query: 357  LQILTNMDNPIGELNQENEKGANNL-IDADTLINLLILIICRSEINIVDLKRNIFYLKKF 415
            LQ L+     I    QE   G N+L +DADTL++L +L++CRSE     LK +++YL+ F
Sbjct: 345  LQQLSG-PTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQK--HLKSHLYYLQNF 401

Query: 416  NYDENLINFGILSYTISTFEIVIYSFENI-----------VEYDKLKSYSEIIEKLIKVD 464
            + + +   FGIL Y IST E V+  FE+            V Y K +   E+++KL   +
Sbjct: 402  SNNPSSTKFGILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTR---ELLDKLSSEN 458

Query: 465  DLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANV 524
               ++     +E  L +R++ G+SIL  CITN +    LD+L +YE++F M++IL+D  +
Sbjct: 459  PTNEIENLATYEDNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETL 518

Query: 525  EGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILK 584
            +G+TLL++++   N + + +LI ++L NCS  +++ Y+NK DK+ R V HYL +E++ILK
Sbjct: 519  DGSTLLIESIKTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILK 578

Query: 585  IIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYD 644
             IG YV+WK+++  G+TPLF+IFR YDQPNY+E++   F+I  +WY ++   F   DH D
Sbjct: 579  SIGSYVDWKRKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTD 638

Query: 645  LKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDD 704
             K NS+LHIL+S++ IL   SK     +DIN RNYKG TPLMIYVKY R+SN+  I  D 
Sbjct: 639  SKGNSLLHILKSDVSILLQLSK-----LDINGRNYKGLTPLMIYVKYKRISNIDAITKDS 693

Query: 705  RLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLT 764
            RL+  + Q   + TCFDYA D ++ +++G+   + +++FG +Y+HSL+  +    T   T
Sbjct: 694  RLILEKVQNSTFFTCFDYAKDHSVLSKIGERGAR-DSLFGLVYLHSLRYHNLNATTNITT 752

Query: 765  FPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRK 824
                DK   T  +N+K   I  LL+ I K +Q + LPL+  I  +  L   +   I    
Sbjct: 753  ASNTDKPFLTTVINMKT--IQGLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKAD 810

Query: 825  IEMLRNQSXXXXXXXXXXXXXXXDIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGE 884
            +  L ++                +       L TDE  +L W+   NT  ++    +   
Sbjct: 811  VRSLLHKLTNCFNVLLFLKKVPQN-------LFTDEASVLYWM-RINTSKRNQKPPSKDN 862

Query: 885  KKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKS 944
             K+++PE+IN+IQSFL+FN  E+ +   ++  L K+L F+ LKS D +++  +   + + 
Sbjct: 863  PKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKILIFLSLKSNDFEDTYDSLREMGRK 922

Query: 945  IKNDQIAQATNRSLEPIIEMQSLENQYYNNTLIR--DELDFLKACTLILTGNIEDILRTQ 1002
            I N + A A  R       + +  N + +  L    + + FL+ CT+ L+  ++ IL  +
Sbjct: 923  IINGEAADAFAR-------IFTNHNMFSDLALAELLEHVSFLEQCTIQLSTFVQTILFDK 975

Query: 1003 IPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRN 1062
            I  WWK YGE L L K+Y K FP           +    + + D  +    G  IE +R 
Sbjct: 976  ITKWWKHYGEFLALQKNYRKAFP-----------SVVKPKSATDTPSHIPLGSFIETKRE 1024

Query: 1063 KAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAII 1113
            ++ ++L   I      L+ LG+EIF  HE LAEEL+ YMEF+     +  I
Sbjct: 1025 QSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTI 1075

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1119 (36%), Positives = 646/1119 (57%), Gaps = 68/1119 (6%)

Query: 1    MEQYHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKI 60
            M   HLPTLLNPL+N+IFNCP P  SPLKKL+A+LK   FILL PP+E LLNY D KTK+
Sbjct: 1    MSISHLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKL 60

Query: 61   QLEDLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNN 120
             L +LCY N +FI +HILL  +                 +    ++TL+G  ++++W+NN
Sbjct: 61   PLHELCY-NAEFINSHILLMTENSFINTN----------SRDSHYETLDGKTVVIQWKNN 109

Query: 121  FLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDT 180
             +  L+G   R+++KI   ++LPNFNDY +G+T F++++I++PL  + +  ND L+CF +
Sbjct: 110  VIHALNGFQVRRRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVP-NDYLQCFHS 168

Query: 181  LTLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN 240
               +     S      L  D SQ ERS FENI++ + T   +  +  + Y+    +++P+
Sbjct: 169  ---YKKIPKSVYSVHNLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPS 225

Query: 241  ETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGT 300
            E +F+ IV  A+  +KS+ +FK F +L  LIHEY E+NLYD +W ++T+      E    
Sbjct: 226  EKIFECIVQQAFEGMKSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFK-SYEVGTE 284

Query: 301  RIKNISIEEIDDKFYEM----FPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIAT 356
              K  SI  +   FY      F L  +T +EK +  ++    KL   +S+ EKS+ L+ T
Sbjct: 285  EYKYFSINHLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVET 344

Query: 357  LQILTNMDNPIGELNQENEKGANNL-IDADTLINLLILIICRSEINIVDLKRNIFYLKKF 415
            LQ L+   + +G    +     NNL +DADTLI+L +L+ICRSE     LK +++YL+ F
Sbjct: 345  LQELSGTTD-MGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQK--HLKSHLYYLQNF 401

Query: 416  NYDENLINFGILSYTISTFEIVIYSFENIVE-YDKLKSYSEIIEKLIKVDDL-------K 467
            + + +   FGIL Y +ST E V+  FE+  +  D +   + +++K  ++ ++        
Sbjct: 402  SNNSSSSKFGILGYAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTN 461

Query: 468  KVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGT 527
            KV     ++  L +R+  G+SIL  CI+NN+    LD+L +Y+ IF ++++L+D  ++G+
Sbjct: 462  KVENLATYKDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGS 521

Query: 528  TLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIG 587
            TLL++++   N + + +LI +++ NC+ ++++ YIN+ DK++R V HYL +E++ILK IG
Sbjct: 522  TLLIESIKSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIG 581

Query: 588  KYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKD 647
             YV+WK+++  G+TPLF+IFR YDQPNY+ ++   F+I   WY +    F   DH D K 
Sbjct: 582  NYVDWKRKNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKG 641

Query: 648  NSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLL 707
            N +LH+L+++  IL   +K     +DIN  NYKG TPLM+YVKY RL+N++ I+ D RL+
Sbjct: 642  NDLLHVLKTDASILLQLTK-----LDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLV 696

Query: 708  FNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPL 767
              + Q+  + TCFDYA D T+ +++G+   + +++FG IY HSL+   + NA  ++TF  
Sbjct: 697  LEKIQKSTFFTCFDYAKDHTVLSKVGERGAK-DSLFGLIYFHSLRYH-NLNAAVNITFA- 753

Query: 768  PDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRK--I 825
             D E       I +K I  LL+ I K +  + LPL+  I  + +L S+ +  II +   +
Sbjct: 754  SDTEKPFSNTVINMKTIQGLLRSILKDNPFTFLPLNIYIDEISQL-SRSDVTIIGKADVM 812

Query: 826  EMLRNQSXXXXXXXXXXXXXXXDIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEK 885
             +L   S                      SL TDE  +L W+   NT  ++    +    
Sbjct: 813  SLLHKLSNCFNVLLFLKKVPK--------SLFTDEASILYWM-RINTSKRNQKQPSKENY 863

Query: 886  KSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSI 945
            K+++PE+IN+IQSFL+FN  E+ +   ++  L K+L FI LKS D K+       + KSI
Sbjct: 864  KTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILIFISLKSNDFKDVNDNLNEMGKSI 923

Query: 946  KNDQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPN 1005
             N + A A   +L       ++ N Y    L+ + + FL+ CT+ L+  ++ IL  +IPN
Sbjct: 924  YNAKAADAFAGNLTN----HNMFNDYSLAKLL-EHVRFLEECTIQLSNLVQLILLEKIPN 978

Query: 1006 WWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAV 1065
            WWK YGEL+ L+K+Y K FP            + + + S  +      GG IE +R ++ 
Sbjct: 979  WWKHYGELITLHKNYRKAFPS-------VVKPKSTTDTSGHIQ----LGGFIETKREQSE 1027

Query: 1066 KKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFK 1104
            ++L   I     SL+ LG+EIF  HE LAEEL+ YMEF+
Sbjct: 1028 QRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFR 1066

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1151 (35%), Positives = 632/1151 (54%), Gaps = 84/1151 (7%)

Query: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63
            YH+P LLNPL+NS+FNC NPS+S  KKL+  LK + FILLVPPTE LL + D ++   + 
Sbjct: 3    YHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSSMN 62

Query: 64   DLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNNFLV 123
            DLC  N DF+ +HILL  +            G+   AS  ++ TLN   + V+  +  ++
Sbjct: 63   DLC-QNYDFVASHILLLQQDTYSDG------GFNLSASQTEYKTLNDKRVAVRSSSGEIL 115

Query: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTL 183
               G P R++ +I+ ++++ NFNDYL GS  F LVHID PL+  +IR  D          
Sbjct: 116  TTEGFPLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNF 175

Query: 184  HDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPNETL 243
            +  D   S     L++D++Q   S FENI+  +  W+     + N Y+ +   E P E L
Sbjct: 176  NGVDAKGS-----LVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEEL 230

Query: 244  FKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGTRIK 303
            F+ IV   + ++ ++++F+   HL  LI +Y+E+NL+D +W++I       DE     +K
Sbjct: 231  FRMIVKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVN-SYRKDEIDTEPLK 289

Query: 304  NISIEEID----DKFYEMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQI 359
             +SI E++     K YE F L  +T +EKN+  + NS   L   ++  EK++ LI TLQ 
Sbjct: 290  FLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQS 349

Query: 360  LTNMDNPIGELNQENEKGANNL---IDADTLINLLILIICRSEINIVDLKRNIFYLKKFN 416
            L+N         +E +     L   +DADTLI+  +L++CR+++   ++K ++FYLKKF+
Sbjct: 350  LSN--------TREQDMDIQTLPITMDADTLISFFVLVVCRTQVK--NIKSHLFYLKKFS 399

Query: 417  YDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSYSE----IIEKLIKVDDLKKVPKT 472
             DEN I FGIL Y IST E V++ F+ +    KL+   +      E  I + D       
Sbjct: 400  KDENSIKFGILGYAISTLEAVVFYFDGLKGTKKLQKLQDDSNKAKELYILISDKSTGQAV 459

Query: 473  IKWEQF---LTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTL 529
            +   QF   L FR+  GES+L  CI N++     +LL +YE+IF +++ILDD  V+G+TL
Sbjct: 460  LDISQFRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTL 519

Query: 530  LMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKY 589
            L+QAL   N + + +++ +L  +C+ +++ EY+N+ DK  R V HYL +E+ IL+ IGKY
Sbjct: 520  LIQALKCDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKY 579

Query: 590  VNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNS 649
            +NWK +D  G TPLFTIFR YDQ NY+ +IS  F   + WY  NG  FQ SDH D K N+
Sbjct: 580  INWKSQDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNT 639

Query: 650  ILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFN 709
            +LHI+++N+ IL  Y       +DIN  N KG TPLMIY +Y+R  NVK I+ D R++ +
Sbjct: 640  LLHIIKNNVSILLDYDN-----VDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILD 694

Query: 710  RYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPL-P 768
            + Q   +   FDYA +  +  EL   A++  T F   ++H LK  + +   F +T  +  
Sbjct: 695  KLQHPSFLNSFDYARNPLVLKELVSQAIK-TTAFELAFVHHLKYEAPS-WFFHITVKIGA 752

Query: 769  DKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEML 828
              + E  TV + +K + +L +V+ K    S LPL++ ++ L  L       I   K+E L
Sbjct: 753  GADEEYKTVKLHIKTLQNLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIA--KLETL 810

Query: 829  RNQSXXXXXXXXXXXXXXXDIGIDYLS---LITDETKLLGWVTNENTKLKHNVNKTHGEK 885
                               D+ + + +   L+  E++L+ W+ +++ K   N +K   ++
Sbjct: 811  ---------YFFYMLTDCFDVLLRHDNLNKLVLRESRLVSWIRSQDKKC--NNSKKLQKQ 859

Query: 886  KSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSI 945
            K+++PE+I I+ SFL+FN  EL  V L + T++KLL F+ LK+ D+  S   F+ L  + 
Sbjct: 860  KNVEPEEIGIMASFLRFNRGELSAVKLKLMTMKKLLIFLKLKNTDLTHS-YQFLSLFGTE 918

Query: 946  KNDQIAQATNRSLEPIIEMQSLE-NQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIP 1004
             N     A +R L   +E+      +    T +R E+ FL+ CT  L   +E +L   IP
Sbjct: 919  YN----LAQDRLLFKDLEINCCAFGEEATMTFVR-EIAFLENCTGKLLDRVEQLLSVDIP 973

Query: 1005 NWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKA 1064
             WWKLYG++LE++K Y + FP                 +S + +  G+     E +R K 
Sbjct: 974  EWWKLYGDVLEMHKVYKQKFP----------------NISRNDSGTGIIASFFEGKREKM 1017

Query: 1065 VKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRRGDLEAV 1124
              KL +D+   K  +  +G+ I   HE+LAEEL+KYMEFK  FF   I+R   R ++  +
Sbjct: 1018 ESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFINGILRRAVRENINIL 1077

Query: 1125 NDDLITFTEKT 1135
               L+   ++ 
Sbjct: 1078 KGRLVEMRKRA 1088

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/1153 (33%), Positives = 623/1153 (54%), Gaps = 105/1153 (9%)

Query: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63
            YHLP LLNPL+NS+FNCP PS SPLKK++ASL+D+ FIL+VP    LL+Y D  T   L+
Sbjct: 3    YHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQ 62

Query: 64   DLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNNFLV 123
            DLCY   +F+  HI++  K                  S ++F TLNG  +L++ +N  ++
Sbjct: 63   DLCY-TYEFVANHIIILKKDSKY--------------SDQEFKTLNGKTVLIRSQNGIVL 107

Query: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTL 183
               G P++++ KI   ++  NFNDYL+GS YF L+HIDKPLM D ++ NDEL+ F   + 
Sbjct: 108  TGDGFPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVK-NDELQVFGVRS- 165

Query: 184  HDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAE----EP 239
                  ++  + PL  D++Q E S FE +   +     RF     E +    A     + 
Sbjct: 166  ------TNTSSLPLSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDS 219

Query: 240  NETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKG 299
                F +    A+  ++  + F+    L + +H Y+E+NLYD +W QIT L   DDE + 
Sbjct: 220  LVDFFDKFNYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYR-DDEIEA 278

Query: 300  TR----IKNISIEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSE 351
            T     +K I+I ++   FY      F L  +T  EK++ ++T+   +L   +S +EK++
Sbjct: 279  TYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTK 338

Query: 352  NLIATLQILTNMDN-PIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIF 410
             ++ TLQ LT+    P  ++        +  IDADTLI L++L++CRS++   +LK ++F
Sbjct: 339  IIMDTLQTLTDYSEFPDADIE-------DVTIDADTLIGLMVLVVCRSQVK--NLKSHLF 389

Query: 411  YLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKS-----------YSEIIEK 459
            YL+ F+ DEN I FG+++Y +ST E V+  FE+     K++S           +  +  K
Sbjct: 390  YLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCK 449

Query: 460  LIKVDDLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNIL 519
             +  D LK       +   L  R+  GES L  CI          LL ++E    +++IL
Sbjct: 450  AVSFDSLKS------YRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDIL 503

Query: 520  DDANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINE 579
            DD  + G+TLLMQ L   N +++ VL+ +L ++C+  ++ EY+N+ +++ R   HYL  +
Sbjct: 504  DDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQD 563

Query: 580  LEILKIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQM 639
            L++   IG + +W+ +D+ G TPLF IFR YD P+Y ++++  F     WY   G  F  
Sbjct: 564  LQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNF 623

Query: 640  SDHYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKL 699
            S H D K N++LH++++NI+IL          ID+N+ N KG TPLM+YVKY+RL NVK 
Sbjct: 624  SAHKDTKGNTLLHVMKTNIEILLEQEN-----IDVNEVNKKGLTPLMVYVKYNRLDNVKC 678

Query: 700  ILGDDRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNA 759
            IL D+RL+  ++Q+ L+  CFDY  +  I  ELG HA +  T FG +  H+   R   N 
Sbjct: 679  ILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAE-KTKFGEVVAHTF--RFENNR 735

Query: 760  TF-SLTFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENN 818
             F  +T    D+E +  TV   ++AI  LL+V  +++ +S LP+D +++ L ++   +  
Sbjct: 736  WFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIG--KTG 793

Query: 819  KIIVRKIEMLRNQSXXXXXXXXXXXXXXXDIGIDYLSLITDETKLLGWVTNENTKLKHNV 878
             + V K+E+ R                     + YL      + L+ W+  E+ + + NV
Sbjct: 794  LVSVGKLEVHRFLCELTLVLKLICQKEEFKKAL-YLP----ASDLVNWI-RESGRKRTNV 847

Query: 879  NKTHGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAF 938
            +      + ++PE+IN IQSFL+FN+ EL  +   +  L+KL  F  LK+ D+ ++R   
Sbjct: 848  S------RRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDINQARCML 901

Query: 939  VHLVKSIKNDQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDI 998
                  +++  I+QA       I  +   +++  + T++   +DFLK CT  L G I+ +
Sbjct: 902  FSQSVRLEDTAISQAFG-----ISGLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQL 956

Query: 999  LRTQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIE 1058
            L+ ++  WWKLY ELL+    YNK FP             +S +   D +N G+FG  +E
Sbjct: 957  LQGKLTRWWKLYAELLDARNQYNKNFP-------------NSVKPHLD-DNKGLFGTYVE 1002

Query: 1059 NQRNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRR 1118
             +R+K  +KL   I      L+ L  E+ ++HE LAEEL+ Y+EFK  + +  II+++  
Sbjct: 1003 GKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTV 1062

Query: 1119 GDLEAVNDDLITF 1131
            G +  + D +  F
Sbjct: 1063 GKINTLKDTMRHF 1075

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/1141 (32%), Positives = 617/1141 (54%), Gaps = 81/1141 (7%)

Query: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63
            YHLP LLNPL+N++FNCPNPS S LKKL+++LKD+ FILLVPP + LL+  D  +   L+
Sbjct: 3    YHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQ 62

Query: 64   DLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNNFLV 123
            +LCY + +F+ +H+LL  +              T   S  +FDTLNG  ++V+ +N  ++
Sbjct: 63   ELCY-SYEFVASHVLLIDEQNAEYMT-------TAPPSQVKFDTLNGKKVIVRSQNRIIL 114

Query: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTL 183
               G   +++  I +  +  NFN+YL     F ++ ID+P+  + +R         + TL
Sbjct: 115  TSDGFQVKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQ---RVQISQTL 171

Query: 184  HDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPNETL 243
                 ++   + P + D SQ  +S F+NI+  +  W  +F +   EY+ +   ++P+  L
Sbjct: 172  GSGKRETKDGSSPTL-DSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIEL 230

Query: 244  FKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGTRIK 303
            F  I+  AY+ ++S+ +F     L  LI++Y+E+NLYD +W++IT     D E +   ++
Sbjct: 231  FHDIIRRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFK-DSEVESNGLR 289

Query: 304  NISIEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQI 359
             +S+ +++   Y    E F L  +  +E N+  + NS ++L   ++  +K+  LI TL+ 
Sbjct: 290  YLSLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRN 349

Query: 360  LTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYLKKFNYDE 419
            L+ +D  I E++          I ADTL++L +L+ICR+++   +LK  +FYL+ F  +E
Sbjct: 350  LSRVDKSIQEVSPVA-------IGADTLLSLFVLVICRTQLR--NLKGQLFYLQNFAKNE 400

Query: 420  NLINFGILSYTISTFEIVIYSFENIV---EYDKLKSYSEIIEKLI-KVDDLKKVPKTIKW 475
              I FG+L Y IST E  +  F+ +    +  +L+S  E    L+ K+         I +
Sbjct: 401  TSITFGVLGYAISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLSSESSSVNLIHY 460

Query: 476  EQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTLLMQALI 535
            ++ L++R++ GES+L  CI N + +   +LL D E  F +++IL+D   EG TLLMQ+L 
Sbjct: 461  QKTLSYRTEQGESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLK 519

Query: 536  YRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKYVNWKQR 595
              N   + ++++L+  +C+ +++  Y N+ DK  R   HYL +E+ IL+ IG + +W  +
Sbjct: 520  CGNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVK 579

Query: 596  DLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNSILHILR 655
            D  G T LFTIFR YDQPNYD++I   F     WYA     F  + H D K+N++LHIL+
Sbjct: 580  DSSGHTALFTIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILK 639

Query: 656  SNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFNRYQREL 715
             +I IL  Y       +D+N RN KG TPLM+Y KY+RL N K IL D R++  + Q  L
Sbjct: 640  RSISILLEYE-----SVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPL 694

Query: 716  YTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSST---NATFSLTFPLPDKEN 772
                 DYA +  I +E+ K +   +T FG+ ++H+LK  SS+   N T        D++ 
Sbjct: 695  LLCSIDYAKNPLILHEIAKQSAM-DTAFGKCFVHTLKYESSSWLVNITVQ-----ADRKG 748

Query: 773  ETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKI-IVRKIEMLRNQ 831
               TV   +K + +  + + +   ++ LPLD  +  L  L     + I  +  +  LR+ 
Sbjct: 749  NFETVEFHLKTVQNFFRTVLRTCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSL 808

Query: 832  SXXXXXXXXXXXXXXXDIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEKKSLKPE 891
            +                       ++ +E+KLL W+  +    ++    TH   K ++PE
Sbjct: 809  TNCFNVLINSQELPK--------DILANESKLLSWIKVQYKAFRNGT--THIFSKKVEPE 858

Query: 892  DINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKNDQIA 951
            +++IIQ FL+FN  EL  +   +  ++KL  F+ LKS DV++S    V L+  + ++ + 
Sbjct: 859  EMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRLKSSDVEQS----VELLLPLGSEGMG 914

Query: 952  QATNRSLEPIIEMQ-SLENQYYNNTLIR--DELDFLKACTLILTGNIEDILRTQIPNWWK 1008
                  L P+ + + S    Y N+++I   +++D +  CT+ L  +I ++L+ +IP WWK
Sbjct: 915  D-----LYPLTDHKFSCTTVYGNDSMILLVEDIDLMLKCTIRLYDHINNLLQVKIPEWWK 969

Query: 1009 LYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKKL 1068
            LYGELL   K Y + FP    N   +TD              G+ G ++E ++ K  K+L
Sbjct: 970  LYGELLNFRKQYAQNFPHLVKNGETSTD-------------AGIIGKILEGKKEKLEKRL 1016

Query: 1069 KTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRRGDLEAVNDDL 1128
               I + + S+   G  I   HE LAE+L+K+MEFKG +  + +I+ W R +++ + + L
Sbjct: 1017 SFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENIKELKERL 1076

Query: 1129 I 1129
            I
Sbjct: 1077 I 1077

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  511 bits (1315), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 300/851 (35%), Positives = 475/851 (55%), Gaps = 74/851 (8%)

Query: 4   YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63
           YHLP LLNPL+NS+FNCP PS SPLKK++ASL+D+ FIL+VP    LL+Y D  T   L+
Sbjct: 3   YHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQ 62

Query: 64  DLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNNFLV 123
           DLCY   +F+  HI++  K                  S ++F TLNG  +L++ +N  ++
Sbjct: 63  DLCY-TYEFVANHIIILKKDSKY--------------SDQEFKTLNGKTVLIRSQNGIVL 107

Query: 124 LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTL 183
              G P++++ KI   ++  NFNDYL+GS YF L+HIDKPLM D ++ NDEL+ F   + 
Sbjct: 108 TGDGFPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVK-NDELQVFGVRS- 165

Query: 184 HDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAE----EP 239
                 ++  + PL  D++Q E S FE +   +     RF     E +    A     + 
Sbjct: 166 ------TNTSSLPLSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDS 219

Query: 240 NETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKG 299
               F +    A+  ++  + F+    L + +H Y+E+NLYD +W QIT L   DDE + 
Sbjct: 220 LVDFFDKFNYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQL-YRDDEIEA 278

Query: 300 TR----IKNISIEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSE 351
           T     +K I+I ++   FY      F L  +T  EK++ ++T+   +L   +S +EK++
Sbjct: 279 TYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTK 338

Query: 352 NLIATLQILTNMDN-PIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIF 410
            ++ TLQ LT+    P  ++        +  IDADTLI L++L++CRS++   +LK ++F
Sbjct: 339 IIMDTLQTLTDYSEFPDADIE-------DVTIDADTLIGLMVLVVCRSQVK--NLKSHLF 389

Query: 411 YLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKS-----------YSEIIEK 459
           YL+ F+ DEN I FG+++Y +ST E V+  FE+     K++S           +  +  K
Sbjct: 390 YLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCK 449

Query: 460 LIKVDDLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNIL 519
            +  D LK       +   L  R+  GES L  CI          LL ++E    +++IL
Sbjct: 450 AVSFDSLKS------YRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDIL 503

Query: 520 DDANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINE 579
           DD  + G+TLLMQ L   N +++ VL+ +L ++C+  ++ EY+N+ +++ R   HYL  +
Sbjct: 504 DDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQD 563

Query: 580 LEILKIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQM 639
           L++   IG + +W+ +D+ G TPLF IFR YD P+Y ++++  F     WY   G  F  
Sbjct: 564 LQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNF 623

Query: 640 SDHYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKL 699
           S H D K N++LH++++NI+IL          ID+N+ N KG TPLM+YVKY+RL NVK 
Sbjct: 624 SAHKDTKGNTLLHVMKTNIEILLEQEN-----IDVNEVNKKGLTPLMVYVKYNRLDNVKC 678

Query: 700 ILGDDRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNA 759
           IL D+RL+  ++Q+ L+  CFDY  +  I  ELG HA +  T FG +  H+   R   N 
Sbjct: 679 ILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAE-KTKFGEVVAHTF--RFENNR 735

Query: 760 TF-SLTFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENN 818
            F  +T    D+E +  TV   ++AI  LL+V  +++ +S LP+D +++ L ++   +  
Sbjct: 736 WFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEI--GKTG 793

Query: 819 KIIVRKIEMLR 829
            + V K+E+ R
Sbjct: 794 LVSVGKLEVHR 804

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  494 bits (1272), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 341/1141 (29%), Positives = 597/1141 (52%), Gaps = 121/1141 (10%)

Query: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63
            YHLP LLNPL+N++FNCP P  SPLKKL+ + KDK FIL+VP TE LL Y D  T + L 
Sbjct: 3    YHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLT 62

Query: 64   DLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNNFLV 123
            +LCY N +F+ +H L+  +               R+  +E F T+NG +++++ ++    
Sbjct: 63   ELCY-NYEFVASHTLVQLQE-------------ARVTELE-FQTINGKSVVIRPQSG--- 104

Query: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTL-- 181
            +++  P+ +K +I+R ++L +FNDYL G T F L++ID+PL+ + I L   L  F     
Sbjct: 105  IITAQPSAKKCRIQRCELLRSFNDYLLGRTAFALLYIDRPLVGE-IELITPLRVFGPQEQ 163

Query: 182  TLHDNDGDSSPDAR-PLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN 240
             L       + DA  PL Q +  H +          +  ++ FKD     +    + +  
Sbjct: 164  PLQYQRITQTADAPLPLEQFLRLHPQ--------LGNQLDEVFKDAKERMRYIALSLKEL 215

Query: 241  ETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALD--DETK 298
              LF ++V   Y  +K +K F+ + +L  ++  Y+E+N+Y+ +W ++  L   +  D   
Sbjct: 216  VRLFHELVEKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVP 275

Query: 299  GTRI-KNISIEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENL 353
            G  I ++IS+ ++    Y    + F L  +T++EK +V++T   +KL   NS +EK+  L
Sbjct: 276  GYYITRSISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARIL 335

Query: 354  IATLQILTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYLK 413
            I+T Q LT          + ++   + +IDADTL+ L+++++CR+++   +LK ++ YL+
Sbjct: 336  ISTFQKLTT---------KTSQATLDPMIDADTLLGLMVVVVCRAQVK--NLKSHLDYLR 384

Query: 414  KFNYDENLINFGILSYTISTFEIVIYSFEN----------IVEYDKLKSYSEIIEKLIKV 463
            +F  + + + FG+L Y++ST E V+  F+           I +  + K +  +IE+ I +
Sbjct: 385  EFAQNSDDVKFGLLGYSLSTLEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIEQGIPI 444

Query: 464  DDLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDAN 523
            + LK+       E+ L  R+ + ES+L  CI   + + F D++ +Y+  F++++IL D N
Sbjct: 445  N-LKE------HEEVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVN 497

Query: 524  VEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEIL 583
                +LL+QAL   N  I+  +I+LL+ NC+N ++  YINK D   R VGHYL    EI+
Sbjct: 498  QSNCSLLIQALQAGNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIV 557

Query: 584  KIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHY 643
              +GK+V+WK++DL   TPLFT+ R YD P+Y E++S  F    ++Y+  G +F  +DH 
Sbjct: 558  DRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHE 617

Query: 644  DLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGD 703
            D   N++LHI++  I +  +    N     +NK N +G TPLM+Y KY+R+ N++ IL D
Sbjct: 618  DPLGNTLLHIIKDGIQLALSTPGAN-----VNKCNTRGMTPLMVYAKYNRIENIREILND 672

Query: 704  DRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATF-S 762
             RL+ ++ Q        DY  +  I N +G  A+  N+++G + +H++K     NA +  
Sbjct: 673  KRLILSKLQDPQSLKAIDYVKNPIILNLIGT-AMAKNSLYGCLSVHNIKYEE--NAWYLW 729

Query: 763  LTFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIV 822
            +T  L  +  +T +  +  K I SLL++  KK  +S LP+D  ++ L  L       +I 
Sbjct: 730  ITSSLSPESYKTSSYAL--KDIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKSGIISVIN 787

Query: 823  RKIEMLRNQSXXXXXXXXXXXXXXXDIGIDYLSLIT-DETKLLGWVTNENTKLKHNVNKT 881
             +  ML                       DY ++ +  E++L  W+     K K N    
Sbjct: 788  LENSMLLEALTFSLSIIQQRE--------DYKNVFSYTESELSTWLRASMVKQKPN---- 835

Query: 882  HGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHL 941
              ++  ++PE+I+ IQ+FLKF++ E   +      L+KL+ F H KS D++ S+      
Sbjct: 836  --KRDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIECSQ------ 887

Query: 942  VKSIKNDQIAQATNRSLEPIIEMQSLENQYYNNTL------IRDELDFLKACTLILTGNI 995
                   +I  +    +  ++  + L    ++N            +DF+  C   LT  I
Sbjct: 888  -------RILYSQGEIIASVVPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMCLDSLTSKI 940

Query: 996  EDILRTQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGG 1055
             ++L +++  WW LYGE+  L K Y + FP     N+ +++           ++ G F  
Sbjct: 941  VEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSE-----------DSKGFFVS 989

Query: 1056 LIENQRNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRN 1115
             +E++R K   KL++ +     +L+ L  E+   HE+LAEE++ ++  K   +   +++ 
Sbjct: 990  YMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKA 1049

Query: 1116 W 1116
            +
Sbjct: 1050 Y 1050

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  491 bits (1264), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 345/1132 (30%), Positives = 598/1132 (52%), Gaps = 83/1132 (7%)

Query: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63
            YH+P LLNPL+N++FNCP+P NSPL+KL+  +K K+F+L+VPP E LL+Y D +  + L+
Sbjct: 6    YHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLTLK 65

Query: 64   DLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNNFLV 123
            +LCY   +F+ +HI+L                   L +  ++ +LN + +L+K  N   +
Sbjct: 66   ELCYE-FEFVASHIILDTDNSSNNLQVKGKNSNETLDN--RYKSLNNNQLLIKNNNIIPL 122

Query: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTL 183
              + S  ++K KI  I++LPNFN+YL GS  + +++ D P     +    E+E F     
Sbjct: 123  DFNNSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLP-KIEIESFYISKK 181

Query: 184  HDNDGDSSP---DARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN 240
              N+  ++       PL QD++Q  +S F +IIN +  WN  F  ++ ++K+        
Sbjct: 182  ESNNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTSL 241

Query: 241  ETLFKQIVAVAYNELKSNKIFKGFGH-LRRLIHEYLEINLYDHLWLQITTLCALDDETKG 299
               F++IV  AY ++K  +IF  F + L  LI EYLE + Y+ +W  I     +D++   
Sbjct: 242  PIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDR-NMIDNQFLH 300

Query: 300  TRIKN-ISIEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLI 354
            T + + +SI++++ + Y    + F L  + K+E+ +  +T+   K+    S +EK + LI
Sbjct: 301  TEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILI 360

Query: 355  ATLQILTNMDN----PIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIF 410
              LQ LT+ D+    P+             ++DADTL+NL +L+ICRS++    L+ +++
Sbjct: 361  DALQKLTSYDDVHYEPL-------------MVDADTLMNLFLLVICRSKVPF--LRNHLY 405

Query: 411  YLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSY-------SEIIEKLIKV 463
            YL+ F+ DEN + FG+L Y ISTFE  +   ++    +K            E+I K+   
Sbjct: 406  YLQNFSTDENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSE 465

Query: 464  DDLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDAN 523
             D       + ++    FR++ GESIL  CI + + E   ++L+++E++F +++ILDD +
Sbjct: 466  ADHSTFQVKL-YKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDILDDED 524

Query: 524  VEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEIL 583
            +EGTTLLM+AL   N   + +++++L  +CS  ++++Y N+ D   R   HY+ N++++L
Sbjct: 525  IEGTTLLMKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVL 584

Query: 584  KIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHY 643
            K IG + NWK +D  G TPL TI R YDQ  Y+++I T F     WY     K    DH 
Sbjct: 585  KRIGLFFNWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHN 644

Query: 644  DLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGD 703
            D K+N++LHIL+ +I +L  Y       I+IN  N K  TPLM YVKY+R+SN++ I+ D
Sbjct: 645  DSKENTLLHILKCDIQVLLKYD-----NININAHNLKYITPLMTYVKYNRVSNIQEIIRD 699

Query: 704  DRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSL 763
            +RL+  +YQ+  +  C+D+  ++ I  +LG  +++ N++F     +SL+V    N+ + L
Sbjct: 700  ERLILGKYQKHTFLDCYDFVKNTIIFEDLGVRSVR-NSMFNLFSAYSLRVE---NSNWVL 755

Query: 764  TFPLPDKENETG-TVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIV 822
             F   D   ++  T ++ +K + +++K   K   +  +P   ++  L  +     N    
Sbjct: 756  YFTFKDTNQDSYITKSVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPN---- 811

Query: 823  RKIEMLRNQSXXXXXXXXXXXXXXXDIGIDY-LSLITDETKLLGWVTNENTKLKHNVNKT 881
              I+ L+N++               D   D+   L  +   L  W+  +  K KH   K 
Sbjct: 812  NGIQKLKNRAFLNLISNYFGTLIETD---DFDTELFKNPESLTKWI--KAGKRKH---KK 863

Query: 882  HGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHL 941
                K +  +DIN+I+SF++FN+ EL  +   +  L+KL  F+ LK  DV ES   F + 
Sbjct: 864  ENYYKRMTLDDINMIKSFVQFNINELGKLNRTLAILKKLCTFLALKINDVNESYKLFRNF 923

Query: 942  VKSIKNDQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILRT 1001
               ++   I+    + ++ +I+ +  ++ +    ++ D++ FL+ CT+ ++ N  D+++ 
Sbjct: 924  GALLQQKDISNQM-KKIDGLIKPKYFQSIF---LILLDQISFLEICTIHMSDNFNDLIKN 979

Query: 1002 QIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQR 1061
             IP W  ++  L  L K Y + F      N L               N  +     +N+R
Sbjct: 980  DIPEWHSVHFILSNLKKQYKRDFSDFDSRNGL---------------NENILSRYTKNKR 1024

Query: 1062 NKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAII 1113
              A K++  +I +     + +   I+  HE LAEE NK++ FK  FFK  I+
Sbjct: 1025 EAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVIL 1076

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  489 bits (1259), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 361/1143 (31%), Positives = 588/1143 (51%), Gaps = 93/1143 (8%)

Query: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63
            Y +P L NPL+N++FNCP+P  SP KKLY  L+DK F+LLVP    LL Y D+ + I   
Sbjct: 3    YFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFR 62

Query: 64   DLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQ------FDTLNGDNILVKW 117
            +LCY   DF+ AHIL+  K               +++S  Q        +LNG  +L+  
Sbjct: 63   ELCY-TYDFVAAHILILDKNSST----------DKISSSNQKNGDVYLKSLNGKEVLL-- 109

Query: 118  RNNFLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELEC 177
            R +  + + G  +++K ++    +L NFNDYL GS +F ++HID PL      L DEL+ 
Sbjct: 110  RQSLCIPIKGYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKG 169

Query: 178  FDT---LTLHDNDGDSSPDARP-LIQ--DMSQHERSQFENIINTNDTWNKRFKDWMNEYK 231
            F+    L  H  D D     +P L+Q  + ++ +R +F  +      W    + ++ +Y+
Sbjct: 170  FEESRELPFHSQDKD-----KPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQ 224

Query: 232  DSTTAEEPNETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLC 291
                 +     LF  IV + YN LK  + F+ F +L  + +EY+E  LY  +W ++    
Sbjct: 225  AMEPLQNIGSELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQE-- 282

Query: 292  ALDDETKGTR-IKNISIEEIDDKFYEM----FPLDFITKLEKNMVRSTNSINKLNGKNSF 346
               D+    R +  +S++ +D  FY      F L  I  +E  MV++ +    +   NS+
Sbjct: 283  HYRDKILDFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSY 342

Query: 347  NEKSENLIATLQILT--NMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVD 404
            ++K + +  TL I+T  N D+ I    ++N      LIDADTL++L  L++CR+ +  V 
Sbjct: 343  SKKVDVIFKTLNIITGKNSDDTI----RDNTLPKLPLIDADTLVSLFALLLCRAGVEDVF 398

Query: 405  LKRNIFYLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYD----KLKSYSEIIEKL 460
            L  ++ YL+ F  DEN + FG L YT+ST E  +  F  +   D    +L+  S + + L
Sbjct: 399  L--HVQYLQSFYKDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFL 456

Query: 461  IKV----DDLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMD 516
            IK+    DDL  +P   +++ +  +R+  GESIL   I N + E   + L+++E+IF +D
Sbjct: 457  IKIRSQHDDL--IPIN-QFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLD 513

Query: 517  NILDDANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYL 576
            ++L D +V G+TLL++ L  RN + + +LI +   +C+N +++ Y NK DK  R + HY+
Sbjct: 514  DLLYDTDVSGSTLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYI 573

Query: 577  INELEILKIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLK 636
             +E+EIL+ IGKY+NW  +DL GRT LFTIFR YDQ  Y   I    D  L WY  N + 
Sbjct: 574  TDEIEILEKIGKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDII 633

Query: 637  FQMSDHYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSN 696
            F++SDH DL  +S+LHIL+S + +L  +      ++DIN  N KG TPLM YVKY+R+ N
Sbjct: 634  FKVSDHTDLFGDSLLHILKSQVSLLLKFE-----DLDINIPNLKGMTPLMTYVKYNRIDN 688

Query: 697  VKLILGDDRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSS 756
            +K IL D RL+  + Q++ Y  C DY  + T+ N L    L  + +F   YI   +   S
Sbjct: 689  IKTILEDGRLIIKKLQKDKYLNCLDYGKNFTVFNLLAA-KLSKDVIFENAYISYARYEKS 747

Query: 757  TNATFSLTFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKE 816
                + L   +   + E  T  IK+K   +L+  ++K  +   +P   ++  L K+    
Sbjct: 748  ---HWYLCISVQKDDLEYTTNIIKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGH 804

Query: 817  NNKIIVRKIEMLRNQSXXXXXXXXXXXXXXXDIGIDYLSLITDETKLLGWVTNENTKLKH 876
            N    +  I  L+ ++               +  ID L+L+ DE  ++ W++++  + + 
Sbjct: 805  N----ILPIRRLKIKNYLNFLSHGLSALLYFE-KIDPLTLL-DENLIIKWISSKLQQQEK 858

Query: 877  NVNKTHGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRL 936
            +++  H   K L  EDIN I++F  F+ +E+      +++  KL  F  +K+ D+  S  
Sbjct: 859  SIDD-HSSFKPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYD 917

Query: 937  AFVHLVKSIKNDQIAQATN--RSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGN 994
                L     N++I++     +S+ P +    +   YY    +  ++ F+K CTLILT  
Sbjct: 918  ILERLGSYFSNNEISRTLGDLQSISPHVHSSMV---YYE---LSQDILFMKKCTLILTSK 971

Query: 995  IEDILRTQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFG 1054
            +   ++ ++  W K   +LLE  K Y+  F             Q + E  N   N  VF 
Sbjct: 972  LASFIKDKLSIWLKKNTKLLEHRKEYSIKFL------------QSNEETGNLSENTSVFR 1019

Query: 1055 -GLIENQRNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAII 1113
                   R +  ++LK  + +L+  L+ LG EI  KHE LAEE + Y+  K  F    ++
Sbjct: 1020 YAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKFNSNLLV 1079

Query: 1114 RNW 1116
            R +
Sbjct: 1080 RKF 1082

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  488 bits (1256), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 333/1129 (29%), Positives = 581/1129 (51%), Gaps = 96/1129 (8%)

Query: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63
            YHLP LLNPL+N++FNCP P+ SPLKKL+ ++K + FILLVP T+ LL Y D  + + L 
Sbjct: 3    YHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLS 62

Query: 64   DLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNNFLV 123
            +LCY N DF+ +HIL+  +                  + +++ TLNG++++++ +   ++
Sbjct: 63   ELCY-NYDFVASHILIQLQESK--------------VTEQEYRTLNGNSVIIRSQAGIVM 107

Query: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTL 183
                 P  +K +++  +VL NFNDYL    YF L+HID+PL+  ++R NDEL+ F +  +
Sbjct: 108  ---SKPELRKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVR-NDELQVFGSYEM 163

Query: 184  HDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAE----EP 239
            H+      P     I  +S++    FE  I        +   +    +     E    + 
Sbjct: 164  HN------PSKSKTINTISENH-IPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDK 216

Query: 240  NETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALD--DET 297
               +FK +V   Y  +K +K F+ +  L  +  EY+E+N+Y+ +WL++  L      D  
Sbjct: 217  LIKIFKDLVIDVYGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRV 276

Query: 298  KG-TRIKNISIEEIDDKFYE----MFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSEN 352
             G +  K IS+  +    Y      F L  +T++EK +V++T+   KL+  NS NEK++ 
Sbjct: 277  SGYSSTKYISLNNVATILYPEGTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKI 336

Query: 353  LIATLQILTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYL 412
            +++T QILT          +      +  IDADTLI L+++++CRS++   +LK ++ YL
Sbjct: 337  VVSTFQILTT---------KMEYTSIDPTIDADTLIGLMLVVLCRSQVK--NLKSHLEYL 385

Query: 413  KKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSYSEIIEKLIKVDDLKKVPKT 472
            ++F    + + FG+  Y++ST E V+  FE     +KLK    + E      DL +    
Sbjct: 386  REFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFWDLIRSGVA 445

Query: 473  IKWEQF---LTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTL 529
            +    +   L  RS   ES L  CI   + +   ++L++Y+E   ++++L D N   +TL
Sbjct: 446  VSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTL 505

Query: 530  LMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKY 589
            L+QAL   + +I+ +LI++++ NC+N +  EY+N+ +   R V HYL     I++ IG Y
Sbjct: 506  LIQALETGHDEIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLY 565

Query: 590  VNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNS 649
            ++W+++D+   TPLF I R YDQ +Y E++S  F+    +    G  F  +DH D   NS
Sbjct: 566  LDWRKKDVNMHTPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNS 625

Query: 650  ILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFN 709
            +LHI++  I  + +        I++NK N KG TPLM+Y KY+R+ N++ IL D RL+ +
Sbjct: 626  LLHIMKGGIQSILSQPN-----INVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVS 680

Query: 710  RYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPLPD 769
            + Q        DY  +  I N +G H +  N+++G +    +K   +    + L   +  
Sbjct: 681  KIQNPQTLKAIDYVKNPMILNLIGTH-IAKNSLYGLLSADGIKFEDN---CWYLWITVKF 736

Query: 770  KENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEMLR 829
             +N   T+   VK I  LL+   KK  ++ LP+D I+ +L     K   K  +  +  L 
Sbjct: 737  SDNSYSTLRQSVKNIQGLLQFYNKKHPMNFLPIDHILSIL-----KNIGKPGILPVINLE 791

Query: 830  NQSXXXXXXXXXXXXXXXDIGIDYLSLIT-DETKLLGWVTNENTKLKHNVNKTHGEKKSL 888
            N                 +   +Y++++  +E+ L  W+   N K + N      + + +
Sbjct: 792  NSIFLGLLTQLLSVIGQRN---EYMAVLRYNESDLSTWLRTNNFKPRAN------KDERI 842

Query: 889  KPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKND 948
            +PE+++ IQSFLKFN+ E   +      L KL+ F  LK+ D++ ++      ++ + N 
Sbjct: 843  EPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQMEIVSN- 901

Query: 949  QIAQATNRSLEPIIEMQSL-ENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNWW 1007
                    S+ P +E   +  N+ Y+    +  ++F+  C   L+  I+ +L +++  WW
Sbjct: 902  --------SVGPSVEKTFIGSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWW 953

Query: 1008 KLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKK 1067
            +LYGEL  L + Y + FP +            S++VS +  + G F   IE +R K   K
Sbjct: 954  RLYGELSSLRREYQRNFPSDF----------KSSDVSGE-ESKGFFESYIEGKRQKTEDK 1002

Query: 1068 LKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNW 1116
            L+  +      L+ L  E+ + HE LAEE++ ++ FK   ++  +++ +
Sbjct: 1003 LQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTY 1051

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  486 bits (1250), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 332/1139 (29%), Positives = 573/1139 (50%), Gaps = 117/1139 (10%)

Query: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63
            Y+LP LLNPL+N++FNCP P NS LKK++++++   F+L+ PPTE LL Y D ++ + L+
Sbjct: 3    YYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLPLQ 62

Query: 64   DLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNNFLV 123
            DLCY    F+  HI+L               G   L   E++ TL+G  IL++ +   + 
Sbjct: 63   DLCY-ATGFVSDHIVL-------------LDGREGLQE-EEYKTLSGKTILLRSQQGIIF 107

Query: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTL-- 181
              +    R++ +I+R ++L NFN+YL+G T F ++H+D PL   + R  DE +CF     
Sbjct: 108  TAAAFDTRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLAR-RDEWQCFRVTKN 166

Query: 182  TLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYK----DSTTAE 237
              H N   +S        ++S       E ++  N  + +   D +   +     S T  
Sbjct: 167  QEHTNGPKNSGKLSHGDNNIS------LEQLLRINPEYGESLNDIVKAQRISLNSSVTGT 220

Query: 238  EPNETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTL---CALD 294
                + F Q    A + +++   F+   +L   +HEY+E+NLYD  W Q+T       ++
Sbjct: 221  THLASHFVQTCKKALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIE 280

Query: 295  DETKGTRIKNISIEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKS 350
              +  + +K+IS+ ++    Y    E F L  IT+ EKN+  +  S  K+   N  + K+
Sbjct: 281  SSSDYSLLKHISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKA 340

Query: 351  ENLIATLQILTNM----DNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLK 406
            + +I TLQ L+      D  +              IDADTL++L ++++C +++   DL+
Sbjct: 341  KVIIETLQTLSRSLLVDDRAVT-------------IDADTLVSLFVVVVCHAQVK--DLR 385

Query: 407  RNIFYLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSYSE--------IIE 458
             ++FYL++F  D NL+ FGIL+Y +ST E V+  FE+  +   L+ Y          I E
Sbjct: 386  SHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYFESPEKVASLEKYCRANLSHWKSISE 445

Query: 459  KLIKVDDLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNI 518
              I ++    VP     +  L  R+  G+S L  C+ + +TE+F  +    E  F ++++
Sbjct: 446  GSIDLNADTTVP----LDDLLKIRTSDGQSCLAVCLQHRRTEEFELIKNTREAWFPLEDL 501

Query: 519  LDDANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLIN 578
            L D   +G+ LL+  L     +++++LIN L+ NC+  +++ ++N  +K+ R+ GHYL++
Sbjct: 502  LHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMH 561

Query: 579  ELEILKIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQ 638
              +++ ++G  +NW+QRD  G TPLF I R YD+P+Y +++S  +   +        +F+
Sbjct: 562  APQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFR 621

Query: 639  MSDHYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVK 698
            +S+H D K N++LH+++S++ IL      + F ID+N  N KG TPLM+YV+Y+R+ NV+
Sbjct: 622  VSNHTDDKGNTLLHVIKSDVSILLA----DPF-IDVNATNAKGLTPLMVYVRYNRIGNVR 676

Query: 699  LILGDDRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTN 758
             IL D RL+  ++Q   Y +CFDY  +  +  ELGK+A      F  I +HS+K R    
Sbjct: 677  TILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASYLPFEFS-INVHSVK-REGDE 734

Query: 759  ATFSLTFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENN 818
                +T    +K+         ++ I + L +      ++ +P+D +++ L  L+  ++ 
Sbjct: 735  WVLWITVTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTFVPVDELLRELRALS--QSR 792

Query: 819  KIIVRKIEMLRNQSXXXXXXXXXXXXXXXDIGIDYLSLITDETKLLGWVTNENTKLKHNV 878
             +I+ K++  R                        LS+++ E       T+ N  L  + 
Sbjct: 793  ILILNKMDTKRFLKRCSVT----------------LSMVSQERLFADAFTDSNLNLSSSR 836

Query: 879  NKTHGEK-----KSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKE 933
                 E      K ++PE++  IQS LKFN+ E+  +   +  ++KL  F  LK  D+ E
Sbjct: 837  GLGSSESFTQNMKMMEPEEVRSIQSILKFNLSEISALKTAMLLMKKLAVFEGLKGKDLSE 896

Query: 934  SRLAFVHLVKSIKNDQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTG 993
            + + F       K   + Q   +S +  + +Q+     ++   I + +   + C+ +L  
Sbjct: 897  ACMTF-----GAKCKYVTQGKIQSFDHFLNVQA--PNLFDFEGIANNIALCELCSSLLCK 949

Query: 994  NIEDILRTQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVF 1053
            +I  +L   IP WW  YGELL L + Y K FP          +  H +E      N G+F
Sbjct: 950  HIGQVLNDDIPKWWHTYGELLSLRREYKKSFPD--------ANRPHVSE------NSGLF 995

Query: 1054 GGLIENQRNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAI 1112
            G  IE +R K  +     I+     L  +  +I + +E LA ELN ++ FK  F K AI
Sbjct: 996  GSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFLKSAI 1054

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  476 bits (1225), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 348/1127 (30%), Positives = 575/1127 (51%), Gaps = 86/1127 (7%)

Query: 16   SIFNCPNPSNSPLKKLYASL--KDKSFILLVPPTETLLNYTDTKTKIQLEDLCYHNVDFI 73
            +I NC  P++SPLKKLY  L  KDK +++LVPPTE LL Y+D ++  +L DLCY   +F 
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDK-YLILVPPTELLLYYSDKESNSELHDLCY-TPNFA 76

Query: 74   GAHILLPPKXXXXXX---XXXXXXGYTRLASIEQFDTLNGDNILVKWRNNFLVLLS--GS 128
             AHILL                     +   +     ++     + W+N  +   +  G 
Sbjct: 77   SAHILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGD 136

Query: 129  PNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELEC---FDTLTLHD 185
              + + KI  I+ +P FN+Y++ +   I +     +  D + LN  LEC    D   L  
Sbjct: 137  QIKNRAKILDIESIPIFNNYMKTTDNTITI-----MYIDDVFLNGTLECNLRSDIDLLRS 191

Query: 186  NDGDSSPDA-RP-LIQDMS-----QHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEE 238
                S P A RP LI   S        ++ F++I+  N  W+ +F+    +++     ++
Sbjct: 192  PSMRSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDD 251

Query: 239  PNETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETK 298
                +F  I+   + E+ S+ +FK    LR +I+EY+E+NL+D +W  I  +   + E  
Sbjct: 252  LPIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNK-EVEID 310

Query: 299  GTRIKNISIEEIDDKF----YEMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLI 354
                 NISI ++D +F    Y  F L+ +   E+N+  ++ S+ K+   +++  K+  LI
Sbjct: 311  LNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILI 370

Query: 355  ATLQILTNMDNPIGELNQENEKGANNL----IDADTLINLLILIICRSEINIVDLKRNIF 410
             TL+ LT      G  + +N+ G  +     IDAD L+NL +L+ CR++I   +LK ++ 
Sbjct: 371  LTLRTLTGNKENDG-YSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIK--NLKCHLS 427

Query: 411  YLKKFNYDENLINFGILSYTISTFEIVIYSFENIVE---YDKLKSYSEIIEKLIKVDDLK 467
            YL+ F  +++   FGIL Y +ST E V+  FE + E   Y KL  +    E+L+KV    
Sbjct: 428  YLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSST 487

Query: 468  KVPKT-------IKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILD 520
            K  +T        K+E  L +R   G+S+L  CI + + +    +L +YE +F ++++L 
Sbjct: 488  KKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLA 547

Query: 521  DANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINEL 580
            D +++G+TLL+QA+ + N   + +L+N+L  NC+  +++ YIN+ D   R  GH+L NEL
Sbjct: 548  DESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNEL 607

Query: 581  EILKIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMS 640
            E+LK++GKY+NW Q+D  G+TPLFTIFR YDQ NYDE++S   +   NWY  NG  F   
Sbjct: 608  EVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYL 667

Query: 641  DHYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLI 700
            DH D K N++LHIL+ N+ IL          I++N  N  G TPLM  ++Y R  N++ +
Sbjct: 668  DHVDKKGNTLLHILKCNLPILLADK-----HINVNATNRSGQTPLMTSIRYKRTENIRDL 722

Query: 701  LGDDRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNAT 760
            L D RL  +  Q+    T FD++ D  I++ LG+H L N+     +Y H+LK  +S    
Sbjct: 723  LCDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLA-VYAHTLKYTNS-RWN 780

Query: 761  FSLTFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKI 820
             SLT  L D      T N  +K +  +L+V+ K +    LP+  +++ L+          
Sbjct: 781  LSLTVKLKDA---PKTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNR------ 831

Query: 821  IVRKIEMLRNQSXXXXXXXXXXXXXXXDIGIDYLSLITDETKLLGWVTNENTKLKHNVNK 880
             +R  E++R +                 I +  L++   E   + WV     K+  +V+K
Sbjct: 832  -IRFSELMRIKVLEMLPFISFCLSALVHIKVLDLNVFQTEENAIKWV-----KMNGSVDK 885

Query: 881  THGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVH 940
               +   + PEDI++IQ+FLKFN+ E+      ++  EKL  F  LKS D+  S   +V 
Sbjct: 886  KTNQTSDITPEDISMIQNFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVT 945

Query: 941  LVKSIKNDQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILR 1000
            +V  + + +       S E   ++ S+  +      +  ++ +LK C   L  +I  I  
Sbjct: 946  IVSQLSSKRFRSTLKYSAED-TKLLSVRAE----KALLSKITYLKICAQKLHNHILSITT 1000

Query: 1001 TQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQ 1060
            T I NWW +YGELL  +KHY + FP               A V+ +  +  +   +   +
Sbjct: 1001 TMISNWWHIYGELLNAHKHYTRAFP-------------ELANVTTENRDLALHRMISNPK 1047

Query: 1061 RNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVF 1107
            R K  ++L   I  +   L  +G++I + HE+ AEE++++++ K  F
Sbjct: 1048 RIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFIDLKTKF 1094

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  456 bits (1173), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 334/1168 (28%), Positives = 576/1168 (49%), Gaps = 132/1168 (11%)

Query: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63
            Y+LP LLNPL+N++FNCP P NSPL+K++  ++ + F L+ P  E LL Y D ++   L+
Sbjct: 3    YYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSSLQ 62

Query: 64   DLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNNFLV 123
            DLCY +  F+  HILL               G    +  E++ TL+G  I ++ +   L 
Sbjct: 63   DLCY-SASFVSDHILL--------------LGGGGCSHEEEYKTLSGKTITLRNQQKALF 107

Query: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTL 183
               G   R++ ++   ++L NFN+Y QGS+ + ++H+D PL   + R  DE   F     
Sbjct: 108  TGEGFDARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLAR-RDEWPGFKAYRF 166

Query: 184  HDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPNE-- 241
               D  S+  +       S   ++  E ++  + ++  +    +   + + ++   N   
Sbjct: 167  ASTDTTSANSSLA----ASTEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADN 222

Query: 242  --TLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTL---CALDDE 296
                F Q    A   ++ ++ F+ F +LR  IHEY+E+NLYD  W Q+T       ++++
Sbjct: 223  LAAHFMQTCEKALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQ 282

Query: 297  TKGTRIKNISIEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSEN 352
            +  + ++NISI ++    Y    + F +  +T++EKN+  +   + +L   NS + K++ 
Sbjct: 283  SDFSILRNISISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKV 342

Query: 353  LIATLQILTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYL 412
            ++ TLQ ++          + N+K  +  +DADTL++LL++++C++E+   DLK ++FYL
Sbjct: 343  IVETLQTVSRSL-------EINDKVIS--VDADTLVSLLVVVVCQAEVK--DLKSHLFYL 391

Query: 413  KKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLK----------SYSEII-EKLI 461
            ++F  D N I FGIL+Y +ST E V+  FE+    +KLK          SY E + +  +
Sbjct: 392  QEFAKDSNSITFGILAYGMSTLEAVLSYFES---REKLKLLEKHCSSNASYWEALADGKL 448

Query: 462  KVDDLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDD 521
             +  L   P  +K    L  R+  G S L  C+ N Q   FL L   +E  F ++++L+D
Sbjct: 449  PLGSLN--PSEVK--DILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLND 504

Query: 522  ANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELE 581
              VEG+ LL+Q L      +S   I +L R+C+  ++  ++N ++++ R+ GHYL++ L+
Sbjct: 505  ETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALD 564

Query: 582  ILKIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSD 641
            ++  +GK++NW+QRD  G TPLF I R YD  +YD ++   +     W    G +F++S 
Sbjct: 565  LIVKVGKFINWEQRDCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSK 624

Query: 642  HYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLIL 701
            H D K N++LH+++SN+ ++      +   +++N  N KG TP+M+Y +Y+RL N+K IL
Sbjct: 625  HQDNKGNTLLHVIKSNVSVVL-----DDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSIL 679

Query: 702  GDDRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATF 761
             D RL+  + Q   Y TCFDY  +  +  ELGKHA      + +I  H++K        +
Sbjct: 680  RDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFFLPQSY-QIRAHNIKFEGDEWVLW 738

Query: 762  -SLTFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRI---IKVLVKLTSKEN 817
             +L   +P+   +   +   +K I S L    K + ++ +P + +   + +L K+     
Sbjct: 739  MTLVGSVPNAPAK--VIQRSLKFIQSFLISFSKTNSMTFIPAESLAEELSLLAKMKIISI 796

Query: 818  NKIIVRKIEMLRNQSXXXXXXXXXXXXXXXDIGIDYLSLITDETKLLGWVTNENTKL--- 874
            N++  +    LR  S                     LSLI  + +      N +  L   
Sbjct: 797  NRLETK--HFLRRASVV-------------------LSLICRQEEFEHIFNNPSGSLVNA 835

Query: 875  -----KHNVNKTHGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSI 929
                 +   N T+G    ++PE++  IQ  +KFN  E+  +      L+KL  F  LK  
Sbjct: 836  AEHVQEQEANSTYG---MIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGK 892

Query: 930  DVKESRLAFVHLVKSIKND---QIAQATNRSLEPIIEMQSLENQY-YNNTLIRDELDFLK 985
            D++ S   F    +S  N+    I ++TN        +   E  Y  NNT +      L+
Sbjct: 893  DLERSHTMF----QSHGNNFTKIIGRSTNVFGSLKHSLPQCEFGYLANNTAL------LE 942

Query: 986  ACTLILTGNIEDILRTQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSN 1045
              + +L   I+ IL   IP+WWK YGEL+ L   YNK FP +                  
Sbjct: 943  LSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVRPRV------------- 989

Query: 1046 DVNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKG 1105
               N G     IE +R +  + L   I++   +L      + R +E LA ELN ++ FK 
Sbjct: 990  -AENTGFISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKA 1048

Query: 1106 VFFKKAIIRNWRRGDLEAVNDDLITFTE 1133
             F+  A I+     +++ + + L+   E
Sbjct: 1049 EFWVSATIKEHAAMNIKWLQEQLVCLEE 1076

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  445 bits (1144), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 266/737 (36%), Positives = 430/737 (58%), Gaps = 43/737 (5%)

Query: 377  GANNL-IDADTLINLLILIICRSEINIVDLKRNIFYLKKFNYDENLINFGILSYTISTFE 435
            G NN+ +DADTLI+L +L++CRSE     LK +++YL+ F+ + +   FGIL Y +ST E
Sbjct: 11   GLNNMTMDADTLISLFVLVVCRSEQK--HLKSHLYYLQNFSNNSSSTKFGILGYAVSTLE 68

Query: 436  IVIYSFE-------NIVEYDKLKSYSE-IIEKLIKVDDLKKVPKTIKWEQFLTFRSDTGE 487
             V+  FE       N+ + + L   ++ +++KL   +   +V     ++  LT+R++ G+
Sbjct: 69   AVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQ 128

Query: 488  SILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTLLMQALIYRNFKISMVLIN 547
            SIL  CITN++    LD+L +YE  F ++++L+D  ++G+TLL++++   N + + VLI 
Sbjct: 129  SILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIK 188

Query: 548  LLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKYVNWKQRDLVGRTPLFTIF 607
            ++L NC+ ++++ YINK DK+ R V HYL +E++ILK IG Y++WK+++  G+TPLF+IF
Sbjct: 189  IMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIF 248

Query: 608  RGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNSILHILRSNIDILFTYSKR 667
            R YDQPNY+E++ T FDI   WY ++   F   DH D K NS+LH+L++NI IL   +K 
Sbjct: 249  RSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTK- 307

Query: 668  NHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFNRYQRELYTTCFDYATDST 727
                +DIN+ NYKG TPLM+YVKY RLSN+  I  D RL+  + Q   + TCFDYA D +
Sbjct: 308  ----LDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHS 363

Query: 728  ISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPLPDKENETGTVNIKVKAIISL 787
            + +++G+  ++ +++FG IY HSL+   + NAT ++T  + + E    T  I +K I  L
Sbjct: 364  VLSKIGERGVK-DSLFGLIYFHSLRYH-NLNATTNIT-SVSNAEKPFATTVINMKTIQGL 420

Query: 788  LKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEMLRNQSXXXXXXXXXXXXXXX 847
            L+ I K +  + LPL+  I  +  L   +   I    +  L +Q                
Sbjct: 421  LRSILKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPE 480

Query: 848  DIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEKKSLKPEDINIIQSFLKFNVKEL 907
            +       L TDE  +L W+   NT  ++         K+++PE+IN+IQSFL+FN  E+
Sbjct: 481  N-------LFTDEASILYWM-RINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEI 532

Query: 908  YNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKNDQIAQATNRSLEPIIEMQSL 967
             +   ++  L K+L FI+LKS D +++      + + + N + + A     + II   ++
Sbjct: 533  SSFKASLNILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSA----FKGIITNHNM 588

Query: 968  ENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNWWKLYGELLELNKHYNKLFPPN 1027
             ++     L+ + + FL+ CT+ L+  ++ IL  +IPNWWK YGE L L+K Y K FP  
Sbjct: 589  FSELSLAALLEN-VRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFP-- 645

Query: 1028 HYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSLEILGNEIF 1087
                     N    + ++D ++    GG IE +R ++ ++L   I      L+ LG+EIF
Sbjct: 646  ---------NMVKPKSASDTSSRAPLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIF 696

Query: 1088 RKHEMLAEELNKYMEFK 1104
              HE LAEEL+ YMEF+
Sbjct: 697  VAHERLAEELSNYMEFR 713

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  449 bits (1155), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 348/1178 (29%), Positives = 580/1178 (49%), Gaps = 111/1178 (9%)

Query: 6    LPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLEDL 65
            +P LLNPL++++FNC +   SPL+K+Y+SL D  FILLVPPT  L  Y D  TK  L +L
Sbjct: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60

Query: 66   CYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQ--FDTLNGDNILVKWRNNFLV 123
            C H+ +F+ +HIL                  +RL ++ +  F T NG  I   +    L 
Sbjct: 61   C-HSPEFVSSHIL---TRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLY 116

Query: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRL--NDELECFDTL 181
               G   R   +I + + L +F +YLQGS+ FIL++ID+PL+ D  RL   ++L+CF  L
Sbjct: 117  TTDGFSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLI-DTNRLLKCEDLDCFPNL 175

Query: 182  TLHDNDGDSSPDARPLIQDMSQHERSQFENIINT--NDTWNKRFKDWMNEYKDSTTAEE- 238
            T+     +++P  R L    S     Q   ++N+  +  +N +F+     Y+   T  E 
Sbjct: 176  TI-----NTTPSTRSLANLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQSES 230

Query: 239  ---PNETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDD 295
               P    F++ +   Y+ L ++  F     +R+LI EY+E N+YD +W  +      + 
Sbjct: 231  MLIPG---FRKTIDKIYDGLDNS--FHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEG 285

Query: 296  ETKGTR-----IKNISIEEIDDKFYEM----FPLDFITKLEKNMVRSTNSINKLNGKNSF 346
            E +         + IS++++D  FY+     F L  I +LEKN+ ++T S   L+  +++
Sbjct: 286  EKEKQSESSDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTY 345

Query: 347  NEKSENLIATLQILTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLK 406
             EK   L+ TLQIL+     +G        G    I ADTL++L IL+I R+++   +++
Sbjct: 346  VEKCRVLVETLQILSKPVKRVG--------GYQVPITADTLVSLFILLIKRTKMK--NIR 395

Query: 407  RNIFYLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSYSEIIEK----LIK 462
             +++YL+ F+ DEN I FG+L Y IST E VI   E I E DK +   + IEK    L +
Sbjct: 396  CHLYYLQNFHQDENSIKFGLLGYAISTLEAVICYLETI-ETDKERL--DCIEKNDANLEE 452

Query: 463  VDDLKKVPKTI--------KWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVD-YEEIF 513
               L    K +        K+     +R+  G S L  CI N + + F +LL + YE  F
Sbjct: 453  FLTLLTRSKCVSNEGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYF 512

Query: 514  SMDNILDDANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVG 573
            + +++L+D   EGTTLLMQ+L + N +I+  L +++L+N + +++  Y  K DK+ RN+G
Sbjct: 513  AFEDLLEDQTTEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIG 572

Query: 574  HYLINELEILKIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAE- 632
            HY+  +  +L+ IGKY+ W  +D  G+TPL  IFR YDQ  YD ++ T F I + WY+  
Sbjct: 573  HYICGQQTLLQKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTV 632

Query: 633  NGLKFQMSDHYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYH 692
               KF   DH D K N++LHI++ NI  L         ++DINK N +G +PL     Y 
Sbjct: 633  KNSKFCFRDHTDSKGNTLLHIIKCNISFLLQSP-----DVDINKVNSQGLSPLTNNAMYD 687

Query: 693  RLSNVKLILGDDRLLFNRYQRELYTTCFDYA---TDSTISNELGKHALQNNTVFGRIYIH 749
            R  NV+ +L D RL+F         + FD+     ++  +  L  + L N   F  I   
Sbjct: 688  RGENVEALLKDPRLIF---------SSFDFLKQYPNTKSAPILSHYCLDNEAPFRNIIAS 738

Query: 750  SLKVRSSTNATFSLTFPLPDKENE-TGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKV 808
                R S   +  LT    +   E  G+   ++K + +L +++ K+   +  PL+ ++  
Sbjct: 739  HFDFRISNKRSVVLTSRSKEDAQELIGSEAFELKNLKALFRLLLKQHPFTFFPLEELLDE 798

Query: 809  LVKLTSKENNKIIVRKIEMLRNQSXXXXXXXXXXXXXXXDIGIDYLSLITDETKLLGWVT 868
            L  +    +++ +++                        D  ++   L T   + +  + 
Sbjct: 799  LSVVEKTASSRSLMKS---------SFCSKVLKKLTYCLDSMVEMELLPTAALQSVALLE 849

Query: 869  NENTKLKHNVN----KTHGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFI 924
                K K  V+    K   + K ++PE I  I +FLK+ ++ L  +   +  L K     
Sbjct: 850  RHIAKEKVTVDEEKLKRRSKDKKMQPESIGTITTFLKYILESLLKLKGTIIELRKFSILS 909

Query: 925  HLKSIDVKESRLAFVHLVKSIKNDQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFL 984
             LKS D+ ES+     L   + + +I +A  R     I+ + L  Q ++  L+  ++ F 
Sbjct: 910  KLKSKDISESKNIVCTLGAEVSSKKIGRAMVRY--STIDNKFLGEQSFD--LLVFQIHFF 965

Query: 985  KACTLILTGNIEDILRTQIPNWWKLYGELLELNKHYNKLFP--------PNHYNNTLATD 1036
            ++C   +  +I+ +L  +IP WWK YG+LLEL+K    +          PN  NN   + 
Sbjct: 966  ESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPSVLARESDHKQTPNASNNVGTST 1025

Query: 1037 NQHSAEVSNDVNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEE 1096
              H++ +       GV G  IE +R K  ++ +  I  L+  L++L NEI   + ++  E
Sbjct: 1026 TDHTSGM-------GVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDNEIDTNNTLVVIE 1078

Query: 1097 LNKYMEFKGVFFKKAIIRNWRRGDLEAVNDDLITFTEK 1134
               ++ F+  F   A++  W + ++  +   L+   EK
Sbjct: 1079 YCIFINFQSKFIHSAMLEKWVKLNINLLKKSLLDSKEK 1116

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
           similarities with uniprot|Q04257 Saccharomyces
           cerevisiae YML002W and some similarities with
           uniprot|Q04257 Saccharomyces cerevisiae YML003W
           Hypothetical ORF
          Length = 1067

 Score =  358 bits (919), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 247/791 (31%), Positives = 413/791 (52%), Gaps = 111/791 (14%)

Query: 4   YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63
           YHLP LLNPLLN+IFNCP+P  S LK++++ L D+ F +LVP TETLL + D ++ ++L 
Sbjct: 3   YHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELA 62

Query: 64  DLCYHNVDFIGAHILL---PPKXXXXXXXXXXXXGYTRLASIEQFDTLNGDNILVKWRNN 120
           +LCYH  DF+ +HI++   P K               R      F TLNG  + +++RN+
Sbjct: 63  ELCYH-YDFVASHIVVIKDPTKDVPDQ----------RSIYNTDFTTLNGRKLSIRYRNS 111

Query: 121 FLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDT 180
            +V   G   R+KI I+ I +LP FNDYL+GS Y  ++HI  PL  D++ L DEL+ F  
Sbjct: 112 TIVTGDGFTERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPL-DELQVFSK 170

Query: 181 LTLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFK---------------- 224
           +     +  S  +  PL  D  Q +   FE  I +     +R                  
Sbjct: 171 VA---GNKYSKQEQAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISV 227

Query: 225 -----DWMNEYKDSTTAEEPNETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINL 279
                +W+N  +DS           +QI+++       +K       L  +I++Y+E+ L
Sbjct: 228 IGIRTEWLNT-RDS----------IRQIISL-------DKRLNHLEDLDAMIYDYVELKL 269

Query: 280 YDHLWLQITTLCA---LDDETKGTRIKNISIEEIDDKFY----EMFPLDFITKLEKNMVR 332
           +  +  Q++ +     L+       +++IS+ ++   FY    + F L  + +LEK++  
Sbjct: 270 FTDIQQQLSEIVEDQELEHRFDFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVND 329

Query: 333 STNSINKLNGKNSFNEKSENLIATLQILTNMDNPIGELNQENEKGANNLIDADTLINLLI 392
           +   +  ++ K + + K E L  T+++L+   N I               DADTL++L +
Sbjct: 330 ALEYLKSIDLKTTHSGKLEVLSTTMRLLSREINGIS-------------TDADTLLSLFV 376

Query: 393 LIICRSEINIVDLKRNIFYLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKS 452
           L+ICRS++    L R + YL  F   E  I FG+  Y +STFE  +  F      D + S
Sbjct: 377 LLICRSQV--TGLVRTLTYLTNFEISETSIKFGLQGYVLSTFEAALSFFHQ----DTVDS 430

Query: 453 YSEIIEKLIKVDDLKKVPKTIK---------WEQFLTFRSDTGESILFSCITNNQTEKFL 503
            ++      K    KK+  +I+             L  R+D+GES+L  CI ++  E   
Sbjct: 431 LTK------KCASNKKIWASIQKHSKVEAELLSSNLRIRTDSGESLLSICIQSHNNEVLT 484

Query: 504 DLLVDYEEIFSMDNILDDANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYIN 563
            LL ++E  F +++ILDD +   +TLL+QAL  +N + + +L  ++L++C+  ++  Y+N
Sbjct: 485 TLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSEIILKSCTESEVRSYLN 544

Query: 564 KIDKFNRNVGHYLINELEILKIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVF 623
             +  NR   HY++ ++ +L+ +G+Y NW+ +D+ G TPLF +FR YD  NYDE+++ V 
Sbjct: 545 SPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVL 604

Query: 624 DITLNWYAENGLKFQMSDHYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFT 683
           D  + WYA N   F    H D K N++LH+++S I+ L         ++++NK + KG T
Sbjct: 605 DQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLP-----DVNVNKPDSKGLT 659

Query: 684 PLMIYVKYHRLSNVKLILGDDRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVF 743
           PLMIY +Y+R++N++ I+ D+RLL +  Q+ L  T  D+  +  ++  +       +  F
Sbjct: 660 PLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKTIL------DATF 713

Query: 744 GR--IYIHSLK 752
            R  + IHSL+
Sbjct: 714 NREPVVIHSLR 724

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 107/228 (46%), Gaps = 22/228 (9%)

Query: 888  LKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKN 947
            L+PE+IN IQ+FLK+N+ E   +   +  L+KL     +K  DV   R +F+    S+ N
Sbjct: 838  LEPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFL----SLGN 893

Query: 948  DQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNWW 1007
                +   +S E      S +  YY  T     L++L+   + L  N E +L  +   WW
Sbjct: 894  QMSQKGVAKSFENTNCAWSYDLSYYEFT---RNLEYLEHSVVTLLNNFESLL-AKTTLWW 949

Query: 1008 KLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKK 1067
            K +GEL+EL K + K FP +    + A              N       IE +R+K   K
Sbjct: 950  KHFGELMELKKEWKKNFPNDKAPPSSA--------------NRNFIDTYIEGKRSKFRNK 995

Query: 1068 LKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRN 1115
            L   +     +L+ +G EI   HE +A  +N ++EFK  F+   I+++
Sbjct: 996  LSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKS 1043

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  358 bits (920), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 360/1231 (29%), Positives = 581/1231 (47%), Gaps = 190/1231 (15%)

Query: 9    LLNPLLNSIFNCPNPS--NSPLKKLYASLKDKSFILLVPPTETLLNYTDTKT-------- 58
            +LNPL+  +F+       N PLKKL+  LK   F+LL PPT+ LLNY D+          
Sbjct: 5    ILNPLIEVLFHSEGTDTLNGPLKKLFEKLKLLKFVLLAPPTDILLNYLDSSNITPRNPYN 64

Query: 59   ---KIQLEDLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIEQ--FDTLNGDNI 113
                  LEDLC ++ DFI +HILL                 +++   +Q   +++NG  I
Sbjct: 65   GSNAKPLEDLCMNSYDFIASHILLYD---------------SKVIKNDQCVMESINGKTI 109

Query: 114  LVK-------WRNNFLVLLSGSPN----RQKIKIERIQVLPNFNDYLQGSTYFILVHIDK 162
             +K         N  +++++ S N    ++ +KI ++ +  NFN YLQG   + + +ID 
Sbjct: 110  TIKRVTGNGALNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDY 169

Query: 163  PLMKDVIRLNDELECFDTL---------------TLHDNDGDSSPDAR---PLIQDMSQH 204
            PL  ++I+ N+ L  FD                  L +   D +   R    L  D+SQ 
Sbjct: 170  PLYPNIIK-NEFLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQS 228

Query: 205  ERSQFENIINTNDT-WNKRFKDWMNEYKDSTTAEEPNETL---------------FKQIV 248
            +R  F  +I  +   W    +  +N Y+ +T   E  E L                + I 
Sbjct: 229  DRGGFTKLIKDDRVIW----QPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDIN 284

Query: 249  AVAYNELKSNKIFKGFGH--LRRLIHEYLEINLYDHLWLQITTLCALDDETKGTRIKNIS 306
               + +LK  K +    H  L  LI+E++EI L+D +W +I+     + +   +++ NIS
Sbjct: 285  CDLFEQLKDEKRYNFLSHDNLMELIYEFIEIKLHDDIWGRIS-FKFTESDFDFSKLSNIS 343

Query: 307  IEEIDDKFYEM-----FPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQILT 361
            + ++   FY       F L  I  +EK + R+     K     +F EKS  LI TLQILT
Sbjct: 344  VNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILT 403

Query: 362  NMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYLKKFNYDENL 421
                             N L DADTLI LL ++ICR  + + +LK ++FYL+ F  D N 
Sbjct: 404  ----------------INKLTDADTLIGLLSIVICR--LKVRNLKSHLFYLQNFAADPNT 445

Query: 422  INFGILSYTISTFEIVIYSFENIVEYDK--LKSYSEIIEKLIK--VDDLKKVPKTIKWEQ 477
            I FGIL Y+IST E + Y F++I    K  L ++ + +  L    ++++K +   I    
Sbjct: 446  IKFGILGYSISTLEAITYYFDHISHSHKADLIAFCDKLHNLYDTILNNIKSLDNDI---- 501

Query: 478  FLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTLLMQALIYR 537
             L++RS  GES+L  CI NN+ + FL+LL  YE  F +++ILDD+++ G++LLMQA  Y 
Sbjct: 502  -LSYRSQNGESLLSLCIINNKMDIFLELLTTYEHSFPIEDILDDSDLNGSSLLMQACKYN 560

Query: 538  NFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHY--LINELEILKIIGKYVNWKQR 595
            N+  S +L+ +L  +C+ +++  ++NK DKFNR+V HY  + N + IL   G  ++W+ +
Sbjct: 561  NYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELK 620

Query: 596  DLVGRTPLFTIFRGYDQPNYDE-VISTVFDITLNWYAENGLKFQMSDHYDLKDNSILHIL 654
            D+   TPL TIF+ + + NY+E  I  +F + L WY  +   F +  H D   N++LH++
Sbjct: 621  DIKKLTPLLTIFKVH-KVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVM 679

Query: 655  RSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFNRYQRE 714
            +  I+ L    +     I+IN  N KG +P M+Y K +R  N+++IL +  L+ +  Q  
Sbjct: 680  KDYINCLIENPELCE-TININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLP 738

Query: 715  LYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVR--SSTNATFSLTF----PLP 768
               T  +   +S +++ L  H L+    F  I +HSL+    SS+ +  SL +     + 
Sbjct: 739  FLITSTN-LYNSKVNHLLATHFLR-TLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISIL 796

Query: 769  DKENETGTVN--------IKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKI 820
            +KE+E  T +        +K+K I SLL    +K + S LPL   ++    L  K NN I
Sbjct: 797  EKESEFPTSHPSICRTKTLKLKTIKSLLHHFIRKYKYSSLPLKSALEFCNDLI-KSNNSI 855

Query: 821  -------------IVRKIEMLRNQSXXXXXXXXXXXXXXXDIGIDYLSLITDETKLLGWV 867
                         ++ K+E+  N                 D      +L+ DE KL  ++
Sbjct: 856  SWTSNRHFLPLSLLIDKLEIQYNLKLISNCLNFLFITTDFD-----FTLLFDELKLQAFL 910

Query: 868  TNENTKL-----------KHNVNKTHGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKT 916
               N KL           K+N ++T    K+ +PEDIN IQ+F+KFN+ EL N    + T
Sbjct: 911  KINNKKLKESNSSNKFSHKNNSDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITT 970

Query: 917  LEKLLNFIHLKSIDVKESRLAFVHLVKSIKNDQIAQATN--RSLEPIIEMQSLENQYYN- 973
            ++ +   I  K +D+  S+  F      I  + +++      + +P+I       ++Y+ 
Sbjct: 971  IKDVSILIKYKIMDLNSSQFFFQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDY 1030

Query: 974  ----------NTLIRDELDFLKACTLILTGNIEDILRTQIPNWWKLYGELLELNKHYNKL 1023
                      N L+ + L F +     L  + ED+    I  WW  YG LL+    YNK 
Sbjct: 1031 NSYDYKVEFLNKLLEN-LIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNK- 1088

Query: 1024 FPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSLEILG 1083
                HY N     N +    +   +    F  +   +RN  +     +I      L    
Sbjct: 1089 ----HYPNRKIDINNNFESFNTMFDKRVNFDSITHFERNIIL-----NIKNTSTLLRRFN 1139

Query: 1084 NEIFRKHEMLAEELNKYMEFKGVFFKKAIIR 1114
            N+I   HE LA ELN +M FK  F ++ II+
Sbjct: 1140 NKIKFLHENLAIELNNFMNFKNKFIREYIIK 1170

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  253 bits (645), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 248/795 (31%), Positives = 393/795 (49%), Gaps = 127/795 (15%)

Query: 339  KLNGKNSFNEKSENLIATLQILTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRS 398
            KL    SF+EK + L++T  ILT+    + +L           IDAD L+N +++II R 
Sbjct: 247  KLRESLSFDEKIDILLSTFNILTS---KLPQLE----------IDADNLLNFMLIIINRV 293

Query: 399  EINIVDLKRNIFYLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSYSEIIE 458
            ++N  +L  +  YL+ FN+ +N  +FGIL+Y IST   V+Y  +N    DK K Y++ I+
Sbjct: 294  KLN--NLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDN--NLDKFKRYTDAIQ 348

Query: 459  KLIKVDDLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEI--FSMD 516
                     K+      E+ L +R++ GES L  CI     +   +LL   E I  F M+
Sbjct: 349  D-------SKIS-----EEKLKYRNENGESYLCHCIITKDNDTLRELLFSSEYIKNFPME 396

Query: 517  NILDDANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYL 576
            +ILDD  ++G+TLLM A+   N   + +LIN+++ N +  +I  Y+N +D+ NRNVGH++
Sbjct: 397  DILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNGTPDEIRTYVNSVDENNRNVGHFI 456

Query: 577  INELEILKIIGKYVNWKQRD-LVGRTPLFTIFRGYDQP--NYDEVISTVFDITLNWYAEN 633
             N+  +L  IG Y+NW  +D   G+TPLF IFR YDQ   +Y ++    F      +A +
Sbjct: 457  TNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFR-----FAMD 511

Query: 634  GLKFQMSDHYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHR 693
               FQ+  H D  +N++LHIL++NI ++       H  + IN  N  G TPLM++ KY R
Sbjct: 512  SGDFQLKKHIDNSNNTLLHILKTNIQMILP-----HASLFINSPNSLGMTPLMVFCKYRR 566

Query: 694  LSNVKLILGD---DRL-LFNRYQ-RELYTTCFDYATDSTISNELGKHALQNNTVFGRIYI 748
            L N++++L     DR+ +F   Q    ++ CF    D  I N LGK A++N ++FG  + 
Sbjct: 567  LYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFGNCFT 626

Query: 749  HSL-----KVRSSTNATFSLTFPLP-DKENETGTVNIK-VKAIISLLKVIRKKSQI-SLL 800
            HSL     K +      +S+   L  +K+ +T   NIK +KA+I++  V+   S + S L
Sbjct: 627  HSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINM--VLTSNSHVSSFL 684

Query: 801  PLDRIIKVLVKLTSKENNKIIVRKIEMLRNQSXXXXXXXXXXXXXXXDIGIDYLSLITDE 860
            PL ++   L  + S  + K    KI  + N +                  I +L L+  E
Sbjct: 685  PLYKVFNELNGIASMISTK---SKILFINNLNVILDT-------------ILFLELVPRE 728

Query: 861  TKLLGWVTNENTKLKHNVNKTHGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKL 920
              +L     +  + +  +     + K L+ EDIN+I +FLKFN+ EL      VK + + 
Sbjct: 729  GFILEARLKDYLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILRQ 788

Query: 921  LNFIHLKSIDVKESRLAFVHLVKSIK--NDQIAQATNRSLEPIIEMQSLENQYYNNTLIR 978
            +N I+LK  D + S +  +H    +   N+ +       L  I   Q LEN       I 
Sbjct: 789  MNSINLKLFDQRISYMDLLHCPDVVVHLNNPLWNLNYNIL--ISNFQILENS------ID 840

Query: 979  DELDFLKACTLILTGNIEDILRTQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQ 1038
            + L FLK                +I  WWKL  EL+ L K              LA++  
Sbjct: 841  NTLHFLKV-----------FQNEKIRKWWKLNNELINLTK--------------LASN-- 873

Query: 1039 HSAEVSNDVNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELN 1098
                 S+D         L+ +  N+  +KL  +ID    S+  L  +IF  HE+LA E+N
Sbjct: 874  -----SDD--------DLLRSFFNRK-EKLSIEIDDKIRSINELNCDIFVSHELLAVEIN 919

Query: 1099 KYMEFKGVFFKKAII 1113
             +M+FK +F  + ++
Sbjct: 920  NFMKFKPLFITRTLV 934

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  225 bits (573), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/290 (41%), Positives = 180/290 (62%), Gaps = 17/290 (5%)

Query: 1   MEQYHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKI 60
           M  YHLPTLLNPL+N+IFNCP P  SPLKKL+A+LK + FILL PP+E LLNY D K+K+
Sbjct: 1   MSVYHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKL 60

Query: 61  QLEDLCYHNVDFIGAHILLPPKXXXXXXXXXXXXGYTRLASIE-QFDTLNGDNILVKWRN 119
            L DLCY N +FI ++ILL                Y    S +  ++TL+G  ++++W+N
Sbjct: 61  PLHDLCY-NAEFINSYILL-----------MTENSYINTNSRDSHYETLDGKTVVIQWKN 108

Query: 120 NFLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFD 179
           N +  L+G   R+++KI   ++LPNFNDY +G+  FI++ ID+PL  + +  ND L+CF 
Sbjct: 109 NVIHALNGFHIRRRLKILETKILPNFNDYFEGAADFIILFIDQPLNCEFVP-NDYLQCFH 167

Query: 180 TLTLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEP 239
                  +  + P+   L  D  Q ERS FENI++ +     +     + Y+     ++P
Sbjct: 168 NYEKIPKNAHAMPN---LSIDSFQQERSSFENILHIHPARLTQLGQLFSSYRTLAPGDDP 224

Query: 240 NETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITT 289
           + ++F+ IV  A++ +KS+ +FK F +L  LIH+Y E+NLYD +W ++TT
Sbjct: 225 SRSIFESIVQQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLTT 274

>YBR107C Chr2 complement(453793..454530) [738 bp, 245 aa] {ON}
           IML3Protein with a role in kinetochore function,
           localizes to the outer kinetochore in a Ctf19p-dependent
           manner, interacts with Chl4p and Ctf19p
          Length = 245

 Score = 38.5 bits (88), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 20/107 (18%)

Query: 602 PLFTIFRGYDQPNYDEVISTVFDITLNWY-AENG-----LKFQMSDHYDLKDNSILHILR 655
           P+F  + G D  N         ++ L W  AE G     +KF+      L D SI+H+ +
Sbjct: 84  PMFLCYCGTDNRN---------EVVLQWLKAEYGVIMWPIKFEQKTMIKLADASIVHVTK 134

Query: 656 SNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILG 702
            NI+ +  +S + +FE +   +N + F+     ++  R S   L LG
Sbjct: 135 ENIEQITWFSSKLYFEPETQDKNLRQFS-----IEIPRESCEGLALG 176

>Kpol_455.8 s455 (8478..9851) [1374 bp, 457 aa] {ON} (8478..9851)
           [1374 nt, 458 aa]
          Length = 457

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 77/162 (47%), Gaps = 27/162 (16%)

Query: 325 KLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQILTNMDNPIGELNQENEKGANNLIDA 384
           KL+K +  S N +NK+N   +  +K  N++   ++L      I + N+ +  G      A
Sbjct: 195 KLDKFITISGNELNKINKFKAPRDKMVNILNACKVLFG----ILKHNKLDHNG------A 244

Query: 385 DTLINLLILIICRSEINIVDLKRNIFYLKKFNYDENLINFGILSYTISTFEIVI------ 438
           D+ I LLI  I +   NI  L  N+ Y+++F Y E  I  G  SY IS+ +  I      
Sbjct: 245 DSFIPLLIFTILKG--NIEHLASNVKYIERFRY-EGFIR-GESSYYISSLQAAIDFIISL 300

Query: 439 ----YSFENIVEYDKL-KSYSEIIE--KLIKVDDLKKVPKTI 473
                +  + VE+DKL +   E IE  K IK D++    K I
Sbjct: 301 DKSSLTITDEVEFDKLYEENRETIEHKKRIKEDEIIASGKKI 342

>Suva_4.354 Chr4 complement(622959..623696) [738 bp, 245 aa] {ON}
           YBR107C (REAL)
          Length = 245

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 15/87 (17%)

Query: 602 PLFTIFRGYDQPNYDEVISTVFDITLNWY-AENGL-----KFQMSDHYDLKDNSILHILR 655
           P+F  + G +  N++EV+       L W  AE G+      F  +    L D SI+H+ +
Sbjct: 84  PMFVCYCGTN--NHNEVV-------LQWLKAEYGIIMWPITFDQTMMIKLADASIVHVTK 134

Query: 656 SNIDILFTYSKRNHFEIDINKRNYKGF 682
            N++ +  +S + +FE     +N K F
Sbjct: 135 ENVEQITWFSSKFYFEPSTQDKNLKQF 161

>CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112w
          Length = 1110

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 20/32 (62%)

Query: 670 FEIDINKRNYKGFTPLMIYVKYHRLSNVKLIL 701
           F   INK N +G TPLMI V  + L  VKL+L
Sbjct: 594 FGAKINKFNKEGMTPLMIAVGRNHLGTVKLLL 625

>KAFR0A03010 Chr1 (617730..619091) [1362 bp, 453 aa] {ON} Anc_8.876
           YML097C
          Length = 453

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 64/123 (52%), Gaps = 15/123 (12%)

Query: 319 PLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQILTNMDNPIGELNQENEKGA 378
           P    T+L+K +  +   +NK+NG  +  +K   ++ + +++  +      L++E     
Sbjct: 194 PNKLYTRLDKFVELAGKELNKVNGFKAPRDKMVCILNSCRVIFGLLKH-HRLDKEG---- 248

Query: 379 NNLIDADTLINLLILIICRSEINIVDLKRNIFYLKKFNYDENLINFGILSYTISTFEIVI 438
                AD+ I LLI II +   +I +L  NI Y+++F Y++ L   G  SY +S+++   
Sbjct: 249 -----ADSFIPLLIFIILKG--DIANLVSNIRYIERFRYEKFLR--GEESYYLSSYQ-AA 298

Query: 439 YSF 441
           Y+F
Sbjct: 299 YNF 301

>Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 27/37 (72%), Gaps = 4/37 (10%)

Query: 764 TFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLL 800
           +F +PD+E   G++    +A+ SLLK++RKK +I++L
Sbjct: 385 SFIVPDEEKYEGSI----RALTSLLKILRKKDKIAIL 417

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 32.0 bits (71), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 54/114 (47%), Gaps = 16/114 (14%)

Query: 103 EQFDTLNGDNILVKWRNNFLVLLSGSPNRQKIKIERIQVLP-------------NFNDYL 149
           E F T NG + ++KWR N + +   SP    I  ++I+ +P             + ND++
Sbjct: 69  ETFST-NGRSTVIKWRQNPMEVDIPSPRSIAITRKQIEKIPLSTRLNSSYDENASVNDFI 127

Query: 150 QGSTYFI--LVHIDKPLMKDVIRLNDELECFDTLTLHDNDGDSSPDARPLIQDM 201
             +      L+ +   +++ +I+ NDEL   +  +L+D   D + D   L++ +
Sbjct: 128 DITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSI 181

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 132,066,955
Number of extensions: 6505459
Number of successful extensions: 26543
Number of sequences better than 10.0: 163
Number of HSP's gapped: 27340
Number of HSP's successfully gapped: 172
Length of query: 1146
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1025
Effective length of database: 39,606,813
Effective search space: 40596983325
Effective search space used: 40596983325
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)