Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0H006707.342ON4832559571e-124
Skud_12.2707.342ON6262737377e-90
Smik_12.2647.342ON6122657305e-89
NDAI0D006107.342ON4862667206e-89
Suva_10.3007.342ON6182637262e-88
YLR206W (ENT2)7.342ON6132677228e-88
KAFR0L014607.342ON5502597108e-87
Skud_4.947.342ON4472566941e-85
YDL161W (ENT1)7.342ON4542566881e-84
Suva_4.837.342ON4622566872e-84
TDEL0C020507.342ON5012556894e-84
Smik_4.757.342ON4602556845e-84
ZYRO0F11550g7.342ON5382556714e-81
CAGL0A03872g7.342ON5102546685e-81
TPHA0D045607.342ON4872576343e-76
Kwal_56.246107.342ON5082686275e-75
KLTH0H01430g7.342ON5022686162e-73
KNAG0C038007.342ON4472615964e-71
Kpol_2001.707.342ON5332545869e-69
SAKL0F10934g7.342ON4982585849e-69
KLLA0C16731g7.342ON4782565812e-68
TBLA0E004807.342ON5991355691e-65
KAFR0B008907.342ON4141275282e-61
Ecym_47317.342ON5142124993e-56
KNAG0B026507.342ON6461315003e-55
TBLA0E020407.342ON7012554935e-54
ACL157C7.342ON5151904687e-52
KLTH0D16896g4.346ON4011292211e-18
Kwal_47.168574.346ON3821292173e-18
TBLA0E047604.346ON4261312156e-18
KNAG0M003804.346ON4031292148e-18
NDAI0D032004.346ON4351302122e-17
KLLA0B04587g4.346ON4001292077e-17
KAFR0B067404.346ON3991292077e-17
SAKL0G17952g4.346ON4151292078e-17
TDEL0D007104.346ON3751292059e-17
Suva_12.2164.346ON4101292061e-16
Kpol_1001.24.346ON4181312042e-16
Skud_10.3494.346ON4101292014e-16
YJR125C (ENT3)4.346ON4081292005e-16
ZYRO0B14784g4.346ON4241302005e-16
Smik_10.4184.346ON4091291996e-16
NCAS0A062104.346ON4231291989e-16
AER155C4.346ON3641301971e-15
TPHA0B004004.346ON3991311971e-15
CAGL0H04323g4.346ON4121231971e-15
Ecym_11334.346ON3921301863e-14
SAKL0H25762g4.17ON2621361663e-12
TBLA0B062204.346ON3391281507e-10
Kwal_55.206114.17ON2541331461e-09
TDEL0G017404.17ON2571301433e-09
Kpol_388.54.17ON2681141362e-08
KLLA0D03949g4.17ON2251201263e-07
Ecym_84074.17ON2541361273e-07
KLTH0E05874g4.17ON2551221193e-06
TPHA0F002304.17ON2801211177e-06
TBLA0G006504.17ON4231111152e-05
ZYRO0G07876g4.17ON2591001113e-05
Suva_10.354.17ON2471201104e-05
CAGL0E03806g4.17ON2601261071e-04
ACL061C4.17ON2341151033e-04
Skud_12.304.17ON2471201006e-04
YLL038C (ENT4)4.17ON2471031007e-04
YHR161C (YAP1801)5.84ON637791010.001
Smik_12.194.17ON247103980.001
SAKL0H02530g5.84ON66997960.004
Skud_8.2255.84ON62188960.004
KAFR0I014604.17ON275138930.005
NDAI0H002804.17ON310137930.007
NCAS0B036608.335ON416113930.008
NCAS0C058404.17ON267101910.011
KAFR0B058008.335ON38297910.012
Smik_8.2455.84ON62779920.013
TBLA0H012108.335ON49198900.017
Kpol_344.88.335ON384115880.031
TBLA0B057705.84ON68079880.037
ZYRO0F13684g8.335ON40798870.040
NDAI0J009308.335ON418113870.042
KLTH0G11902g8.335ON399121850.066
KNAG0A051008.335ON42198850.069
CAGL0E01199g8.335ON41298840.094
Kwal_YGOB_27.112618.335ON404113840.097
TPHA0C007408.335ON38597820.15
TBLA0A040408.335ON415120820.17
KLLA0D16654g8.335ON39998820.17
Kwal_27.11263singletonOFF27597800.22
KNAG0J028704.17ON329137760.72
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0H00670
         (483 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    373   e-124
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   288   7e-90
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   285   5e-89
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   281   6e-89
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   284   2e-88
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   282   8e-88
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   278   8e-87
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   271   1e-85
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   269   1e-84
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   269   2e-84
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   270   4e-84
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   268   5e-84
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   263   4e-81
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   261   5e-81
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   248   3e-76
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   246   5e-75
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   241   2e-73
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   234   4e-71
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   230   9e-69
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   229   9e-69
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   228   2e-68
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   223   1e-65
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   207   2e-61
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   196   3e-56
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   197   3e-55
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   194   5e-54
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   184   7e-52
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    90   1e-18
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    88   3e-18
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    87   6e-18
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    87   8e-18
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    86   2e-17
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    84   7e-17
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    84   7e-17
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    84   8e-17
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    84   9e-17
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    84   1e-16
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    83   2e-16
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    82   4e-16
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    82   5e-16
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    82   5e-16
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    81   6e-16
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    81   9e-16
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    80   1e-15
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    80   1e-15
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    80   1e-15
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    76   3e-14
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    69   3e-12
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    62   7e-10
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    61   1e-09
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    60   3e-09
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    57   2e-08
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    53   3e-07
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    54   3e-07
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    50   3e-06
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    50   7e-06
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    49   2e-05
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    47   3e-05
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    47   4e-05
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    46   1e-04
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    44   3e-04
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    43   6e-04
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    43   7e-04
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    44   0.001
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    42   0.001
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    42   0.004
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    42   0.004
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    40   0.005
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    40   0.007
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    40   0.008
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    40   0.011
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    40   0.012
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    40   0.013
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    39   0.017
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    39   0.031
TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa] ...    39   0.037
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    38   0.040
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    38   0.042
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    37   0.066
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    37   0.069
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    37   0.094
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    37   0.097
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    36   0.15 
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    36   0.17 
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    36   0.17 
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    35   0.22 
KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.1...    34   0.72 

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  373 bits (957), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 190/255 (74%), Positives = 190/255 (74%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRA 180
           IIRVKAKELTS            TINLK                       EDQDELQRA
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDEDQDELQRA 180

Query: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           LEESRLTAEEDERRRRQMAQYDDQDPDLQTA                             
Sbjct: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTALQLSKEEEELKKLQEMQRLQQQQGQMNQP 240

Query: 241 XGYFDIFGNPISPDE 255
            GYFDIFGNPISPDE
Sbjct: 241 QGYFDIFGNPISPDE 255

 Score =  230 bits (587), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 120/165 (72%), Positives = 120/165 (72%)

Query: 319 PLQTGSXXXXXXXXXXXXXXVESTQAYTASXXXXXXXXXXXXXXXXXXXXTRTGNQSITD 378
           PLQTGS              VESTQAYTAS                    TRTGNQSITD
Sbjct: 319 PLQTGSNNPFAMNNFNNKPAVESTQAYTASAPQLNQQPAQQQPQQQPLKQTRTGNQSITD 378

Query: 379 KYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDPKNNPFLNSQ 438
           KYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDPKNNPFLNSQ
Sbjct: 379 KYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDPKNNPFLNSQ 438

Query: 439 YTGLPSTNIVSTQTGYGFGNAPSXXXXXXXXXXXRPDQGFSLIDL 483
           YTGLPSTNIVSTQTGYGFGNAPS           RPDQGFSLIDL
Sbjct: 439 YTGLPSTNIVSTQTGYGFGNAPSQQQQQQQQQQQRPDQGFSLIDL 483

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  288 bits (737), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 149/273 (54%), Positives = 172/273 (63%), Gaps = 18/273 (6%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           M KQFVRSAKNMVKGYS+TQVLVRDAT+ND+  PS + L +LAQRS+DSVDFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXED---QDEL 177
           IIRVKAKEL S            ++N +                            QDEL
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180

Query: 178 QRALEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXX 237
           ++ LEESR+TA+EDE+RRR++AQYDD+DPD Q A                          
Sbjct: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQPL 240

Query: 238 XXX---------------XGYFDIFGNPISPDE 255
                               Y+DIFGNPIS DE
Sbjct: 241 SQMPVPVQQQQQQQQQQLPAYYDIFGNPISQDE 273

 Score =  169 bits (429), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 78/92 (84%), Positives = 87/92 (94%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQSI+DKY+ LN LLATGTG+DTFGNTGE RIPAQHT+TGTFINSQGTGY+QVT++
Sbjct: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAP 460
           PKNNPFL++QYTGLPSTNIV TQTGYGFGN P
Sbjct: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQP 545

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  285 bits (730), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 172/265 (64%), Gaps = 13/265 (4%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKNM+KGYS+TQVLVRDAT+ND+  PS + L +LAQRS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXED---QDEL 177
           IIRVKAKEL S            ++N +                            Q++L
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSYQNDL 180

Query: 178 QRALEESRLTAEEDERRRRQMAQYDDQDPDLQTA----------XXXXXXXXXXXXXXXX 227
           ++ALEESR+TA+EDE+RRR++AQYDD+DPD Q A                          
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQNQQQSL 240

Query: 228 XXXXXXXXXXXXXXGYFDIFGNPIS 252
                          Y+DIFGNPIS
Sbjct: 241 SQMQVPVQQQQEQPAYYDIFGNPIS 265

 Score =  170 bits (431), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 79/92 (85%), Positives = 86/92 (93%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQSI+DKY+ LNTLLATGTG DTFGNTGE RIPAQHT+TGTFINSQGTGY+QV N+
Sbjct: 429 TRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVINE 488

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAP 460
           PKNNPFL++QYTGLPSTNIV TQTGYGFGN P
Sbjct: 489 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQP 520

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  281 bits (720), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 157/266 (59%), Positives = 179/266 (67%), Gaps = 13/266 (4%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKNM+KGYSTTQVLVRDATSND+SNPSFE+LYE+++RSFDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWCK+NLYIIKTL+EF+ EDD   D+  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRA 180
           IIRVKAKELT+            +INLK                        D+D LQ+A
Sbjct: 120 IIRVKAKELTALLQDDERLKEERSINLKNNRRSERKNRSRRGTNATRRGTKSDED-LQKA 178

Query: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           LEESR+TAEEDERRRR++AQYD+QD D QTA                             
Sbjct: 179 LEESRITAEEDERRRRELAQYDNQDTDYQTALQLSKEEEELKKLQELQRLQQLQQQQQQQ 238

Query: 241 XG-----------YFDIFGNPISPDE 255
                        Y+DIFGNPISP+E
Sbjct: 239 MQFQQQPQQQEQVYYDIFGNPISPEE 264

 Score =  159 bits (402), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 83/89 (93%), Gaps = 1/89 (1%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQSI+DKY++LN LLA+GTGIDTFGNTG+QRIPAQHTQTGTFINSQGTGY+Q+ ND
Sbjct: 368 TRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVND 427

Query: 429 P-KNNPFLNSQYTGLPSTNIVSTQTGYGF 456
           P K NPFLN+QYTGLPS+NIV + TGYGF
Sbjct: 428 PVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  284 bits (726), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 148/263 (56%), Positives = 168/263 (63%), Gaps = 11/263 (4%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKNMVKGYS+TQVLVRDAT+ND   PS + L +LAQRS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXE-------D 173
           IIRVKAKEL S            T+N +                                
Sbjct: 121 IIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPPTY 180

Query: 174 QDELQRALEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXX 233
           Q++L++ALEESR+TA+EDE RR +MAQYDD DPD Q A                      
Sbjct: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFQAALQLSKEEEELKQLQELQKQQQL 240

Query: 234 XXXX----XXXXGYFDIFGNPIS 252
                        Y+DIFGNPIS
Sbjct: 241 QSQLQMPPQQQAAYYDIFGNPIS 263

 Score =  170 bits (430), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 79/92 (85%), Positives = 85/92 (92%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQSI+DKY+ LN LLATGTG DTFGNTGE RIPAQHT+TGTFINSQGTGY+QV N+
Sbjct: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAP 460
           PKNNPFLNSQYTGLPST+IV TQTGYGFGN P
Sbjct: 497 PKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQP 528

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  282 bits (722), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 172/267 (64%), Gaps = 15/267 (5%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKNM+KGYS+TQVLVRDAT+ND+  PS + L +LAQRS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXED---QDEL 177
           IIRVKAKEL S            ++N +                            QD+L
Sbjct: 121 IIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSYQDDL 180

Query: 178 QRALEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXX------------XXXXXXXXXX 225
           ++ALEESR+TA+EDE+RRR++AQYDD+DPD Q A                          
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQSL 240

Query: 226 XXXXXXXXXXXXXXXXGYFDIFGNPIS 252
                            Y+DIFGNPIS
Sbjct: 241 SQFQAPLQQQQPQQQPAYYDIFGNPIS 267

 Score =  176 bits (445), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 88/92 (95%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQSI+DKYS LNTLLATGTGIDTFGNTGE RIPAQHT+TGTFINSQGTGY+QVTN+
Sbjct: 428 TRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 487

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAP 460
           PKNNPFL++QYTGLPSTNIV TQTGYGFGN P
Sbjct: 488 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQP 519

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  278 bits (710), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 143/259 (55%), Positives = 168/259 (64%), Gaps = 4/259 (1%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYS+TQVLVRDATSND    + + L ++A RS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYW+H+ KSLTVLDYLVRFGSENCVLWCKENLY+IKTLREFR+EDD G DQGQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRA 180
           IIRVKAKELTS              N +                        D D+LQR 
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDDDDLQRV 180

Query: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXX----XXXXXXXXXXXXX 236
           +EES+ TAEEDERRR+++A+YD++DP+ Q A                             
Sbjct: 181 IEESKKTAEEDERRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQQQQLQMLQQQ 240

Query: 237 XXXXXGYFDIFGNPISPDE 255
                 Y+D+FGNPIS DE
Sbjct: 241 QTSANVYYDVFGNPISYDE 259

 Score =  157 bits (398), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 84/92 (91%), Gaps = 1/92 (1%)

Query: 370 RTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND- 428
           RTGN+ IT+KYS+LN LLA GTG+DTFGNTG++RIPAQHT+TGTFINSQGTGY+QVTN+ 
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAP 460
            KNNPFLN+QYTGLPS+NIV + TGYGFGN P
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGFGNQP 480

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  271 bits (694), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 143/256 (55%), Positives = 167/256 (65%), Gaps = 15/256 (5%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKN+VKGYS+TQVLVR+ATSND    S + L ELA++S+DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWCKENLYIIKTL+EFRHEDD G DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRA 180
           I+RVKAKELT+             +N+K                       ED D+LQRA
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNMNIK-------GRSRKGRKRRGTGRNDEDDDDLQRA 173

Query: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++ SR+TAEEDERRR+       QD D +TA                             
Sbjct: 174 IDASRMTAEEDERRRK-------QDEDYETALQLSKEEEELKRLQDLQRMQQVHAQQQQQ 226

Query: 241 XG-YFDIFGNPISPDE 255
              Y+DIFGNPI+P+E
Sbjct: 227 QPMYYDIFGNPITPEE 242

 Score =  171 bits (434), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 85/115 (73%), Positives = 93/115 (80%), Gaps = 4/115 (3%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQS+TDKY +LN LLATGTGIDTFGN G+ R+PAQHT+TGTFINSQGTGYRQV+ND
Sbjct: 337 TRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSND 396

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSXXXXXXXXXXXRPDQGFSLIDL 483
           PK NPFLNSQYTGLPSTNIV TQTGYGFGN P               QG++LIDL
Sbjct: 397 PKQNPFLNSQYTGLPSTNIVPTQTGYGFGNQPQQQSQNNRSNS----QGYTLIDL 447

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  269 bits (688), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 166/256 (64%), Gaps = 15/256 (5%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKN+VKGYS+TQVLVR+ATSND    S + L ELA++S+DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWC+ENLYIIKTL+EFRHEDD G DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRA 180
           I+RVKAKELT+             +N+K                       E+ D+LQRA
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNIK-------GRNRKGRRRRGTGRSDENDDDLQRA 173

Query: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           +  SRLTAEEDERRR+       QD D +TA                             
Sbjct: 174 ISASRLTAEEDERRRK-------QDEDYETALQLSKEEEELKRLQDLQRMQQQQGQQQLQ 226

Query: 241 XG-YFDIFGNPISPDE 255
              Y+DIFGNPI+P+E
Sbjct: 227 QPMYYDIFGNPITPEE 242

 Score =  163 bits (412), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 92/114 (80%), Gaps = 4/114 (3%)

Query: 370 RTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDP 429
           RTGNQS+TDKYS+LN LLATGTGIDTFGN GE RIPAQHT+TGTFINSQGTGYRQV++DP
Sbjct: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDP 404

Query: 430 KNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSXXXXXXXXXXXRPDQGFSLIDL 483
            +NPFLNSQYTGLPST++V TQTGYGFGN                 +G++LIDL
Sbjct: 405 NHNPFLNSQYTGLPSTSVVPTQTGYGFGNQSQQQSQNNGSNN----RGYTLIDL 454

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  269 bits (687), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 166/256 (64%), Gaps = 15/256 (5%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQ VRSAKN+VKGYS+TQVLVR+ATSND +  S + L ELA++S+DS DFFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWCKENLYIIKTL+EFRH+DD G DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRA 180
           I+RVKAKELTS             +N+K                       ED D+LQRA
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIK-------GRNRGGRRRRRTNRSSEDDDDLQRA 173

Query: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++ SR+TA+EDERRR+       QD D +TA                             
Sbjct: 174 IDASRMTADEDERRRK-------QDEDYETALQLSKEEEELKRLQDLQRIQAQQQQQQQQ 226

Query: 241 XG-YFDIFGNPISPDE 255
              Y DIFGNPI+P+E
Sbjct: 227 QPMYCDIFGNPITPEE 242

 Score =  174 bits (441), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 93/115 (80%), Gaps = 4/115 (3%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQS+TDKYS+LN LL TGTGIDTFGN G+ R+PAQHT+TGTFINSQGTGYRQV+ND
Sbjct: 352 TRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND 411

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSXXXXXXXXXXXRPDQGFSLIDL 483
           PK+NPFLNSQYTGLPSTN+V  QTGYGFGN P               QG++LIDL
Sbjct: 412 PKHNPFLNSQYTGLPSTNVVPAQTGYGFGNQPQQQSQTNGTNS----QGYALIDL 462

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  270 bits (689), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 142/255 (55%), Positives = 168/255 (65%), Gaps = 10/255 (3%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKN+VKGYS+ QVLVR+AT+N++  PS + L ELA++++DSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWC+ENLY+IKTL EFR++DDGG DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRA 180
           IIRVKAKELT+             +N K                          D+LQRA
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDGF------DDDLQRA 174

Query: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           L+ESRLTAEEDERRR+ +   DD   DLQ A                             
Sbjct: 175 LDESRLTAEEDERRRKMLGSEDD---DLQAALQLSKEEEELKRLQEMQKLQQQQTQQQPS 231

Query: 241 XGYFDIFGNPISPDE 255
             Y+DIFGNPISP+E
Sbjct: 232 Q-YYDIFGNPISPEE 245

 Score =  158 bits (400), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 79/115 (68%), Positives = 89/115 (77%), Gaps = 2/115 (1%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
            RTG+ ++T+KY +LN LLATGTGIDTFGNTG+ RIPAQHT+TGTFINSQGTGYRQVT +
Sbjct: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSXXXXXXXXXXXRPDQGFSLIDL 483
           PK NPFL SQYTG+PS+NIV   TGYGFGN PS             DQG SLIDL
Sbjct: 449 PKKNPFLQSQYTGIPSSNIVPAHTGYGFGNQPSQQNQAQQHQTA--DQGVSLIDL 501

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  268 bits (684), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 166/255 (65%), Gaps = 13/255 (5%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKN+VKGYS+TQVLVR+ATSND    S + L ELA++S+DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWCKENLYIIKTL+EFRHEDD G DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRA 180
           I+RVK+KELT+             +N+K                       ++ ++LQRA
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIK------GRNRKGRSRRGTGRSSNDNDNDLQRA 174

Query: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           L+ SR+TAEEDE+RR+        D D +TA                             
Sbjct: 175 LDASRMTAEEDEKRRK-------MDEDYETALQLSKEEEELKRLQDLQRMQQLQTQQQQQ 227

Query: 241 XGYFDIFGNPISPDE 255
             Y+DIFGNPI+P+E
Sbjct: 228 PMYYDIFGNPITPEE 242

 Score =  165 bits (417), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 94/115 (81%), Gaps = 4/115 (3%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQS+TDKY++LN LLATGTGIDTFGN G+ R+PAQHT+TGTFINSQGTGY+QV+ND
Sbjct: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSXXXXXXXXXXXRPDQGFSLIDL 483
           PK NPFL+ QYTGLPSTN+V TQTGYGFGN P              +QG++LIDL
Sbjct: 410 PKYNPFLSGQYTGLPSTNVVPTQTGYGFGNQPQQQSQNNHLN----NQGYALIDL 460

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  263 bits (671), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 139/255 (54%), Positives = 164/255 (64%), Gaps = 12/255 (4%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           M  QFVRSAKN +KGY++ QVLVRDAT+N+   PS ++L ELA RS+DSV+FFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+ENLYIIKTLREFRH+DDG  D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRA 180
           IIRVKAKELT+             + ++                        D  E+QRA
Sbjct: 121 IIRVKAKELTNLLMDDER------LRMERGEDKGAPPRMMSPSPPTPRRNSYD-SEMQRA 173

Query: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXX--XXXXXXXXXXXXXXXX 238
           L+ SRLTAEEDERRR+ +   +++D DL+TA                             
Sbjct: 174 LDASRLTAEEDERRRKTL---NNEDADLETALQLSKEEEELKRLQELQKAQQDQQRLSQM 230

Query: 239 XXXGYFDIFGNPISP 253
              GY+DIFGNPISP
Sbjct: 231 QPQGYYDIFGNPISP 245

 Score =  142 bits (357), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 61/90 (67%), Positives = 78/90 (86%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
            RTGNQSI+DKY+ LN LLA  TG+DTFGN G+ RIPAQHT+TGTFINSQGTG++Q +N+
Sbjct: 423 VRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYSNE 482

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGN 458
           PK NPFL +Q+TG+P++++V + TGYGFGN
Sbjct: 483 PKKNPFLPTQFTGIPTSSVVPSHTGYGFGN 512

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  261 bits (668), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 144/254 (56%), Positives = 169/254 (66%), Gaps = 1/254 (0%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           M  Q VRSAKNMVKGYS+TQV+VRDAT+ND+++PS  +L +LA +++D+V+FFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDD-GGADQG 119
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED+  G+D+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 QIIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQR 179
           QIIRVKAKELTS             +N                            D+LQ+
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRNAYDDDLQK 180

Query: 180 ALEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           ALEESR+TAEE+E RRR+ AQY++QDPDL  A                            
Sbjct: 181 ALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSKEEEELKKLQDMQRMQELQAQQQQ 240

Query: 240 XXGYFDIFGNPISP 253
              Y+DIFGNPISP
Sbjct: 241 QNVYYDIFGNPISP 254

 Score =  169 bits (427), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 77/89 (86%), Positives = 85/89 (95%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQSI+DKYS+LN LLA+GTGIDTFGNTGE RIPAQHT+TGTFINSQGTGY+QVTN+
Sbjct: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFG 457
           PKNNPFL+SQYTGLPSTNIV + TGYGFG
Sbjct: 421 PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  248 bits (634), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 165/257 (64%), Gaps = 19/257 (7%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MS QFVRS KN+VKGYS+TQVLVR+AT+N+ + P+ +LL ++A++++DS DFFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDD--GGADQ 118
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWCKENLY+IKTL EFR+ED+  GG DQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 GQIIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQ 178
           GQIIRVKAKELT+             +N +                        D+D LQ
Sbjct: 121 GQIIRVKAKELTALLMDDERLREERRLNNRRDRNRNRRPPARNGS---------DED-LQ 170

Query: 179 RALEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXX 238
           RALEESR TAEEDER+RR     +  D DLQ A                           
Sbjct: 171 RALEESRRTAEEDERKRR----LNQDDSDLQAALQLSKEEEELKRLQELQSSMHMQQQQP 226

Query: 239 XXXGYFDIFGNPISPDE 255
               Y+D+FGNPIS +E
Sbjct: 227 V---YYDVFGNPISYEE 240

 Score =  149 bits (376), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 80/88 (90%)

Query: 370 RTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDP 429
           RTGN+ +T+KY++LN LLA+GTGIDTFGNTGE RIPAQHTQTGTFINSQGTGYRQ + + 
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434

Query: 430 KNNPFLNSQYTGLPSTNIVSTQTGYGFG 457
           K NPFL++QYTGLPS+NI+ TQTGYGFG
Sbjct: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  246 bits (627), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 135/268 (50%), Positives = 163/268 (60%), Gaps = 25/268 (9%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSK  +R AKN+V GYSTTQVL+R+ATSND   PS +++ E+A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W KENLY+IKTLREF HED+ G DQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRA 180
           I+RVKA+ELT+            ++  K                       ED+D LQRA
Sbjct: 121 IVRVKARELTALLLDDERLREERSLRTK-----------NRKPRRRPTAGSEDED-LQRA 168

Query: 181 LEESRLTAEEDE-RRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           +EESRLTAE++E  RRR++  YD+   DLQTA                            
Sbjct: 169 MEESRLTAEQEEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQ 228

Query: 240 XXG------------YFDIFGNPISPDE 255
             G            Y+D+FGNPIS +E
Sbjct: 229 MFGLSQQQTQAQQPMYYDVFGNPISAEE 256

 Score =  157 bits (396), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 78/115 (67%), Positives = 92/115 (80%), Gaps = 1/115 (0%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQSIT+K+S+LN LLA+GTG+DTFGNTG+ RIPAQHT+TG FINSQGTGY+QV++ 
Sbjct: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSXXXXXXXXXXXRPDQGFSLIDL 483
           PK+NPFL  QYTGLPSTN+V + TGYGFGN P+             DQG SLIDL
Sbjct: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFGNQPNQNQQNQNQSNG-ADQGMSLIDL 508

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  241 bits (616), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 135/268 (50%), Positives = 161/268 (60%), Gaps = 27/268 (10%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSK  +R AKN+V GYSTTQVL+R+ATSND   PS +L+ E+A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W KENLYIIKTLREF HED+ G DQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQ--DELQ 178
           I+RVKA+ELT+               L+                        D   D++Q
Sbjct: 121 IVRVKARELTAL--------------LQDEERLREERELKGRNRRPRRRKNSDSYDDDMQ 166

Query: 179 RALEESRLTAEEDE-RRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXX 237
           RALEESR+TAE++E  RRR++  YD+   DLQTA                          
Sbjct: 167 RALEESRMTAEQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQMQQAQ 226

Query: 238 XXXXG----------YFDIFGNPISPDE 255
               G          Y+D+FGNPIS +E
Sbjct: 227 QQMFGLQQQQTQQPMYYDVFGNPISAEE 254

 Score =  155 bits (393), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 78/117 (66%), Positives = 91/117 (77%), Gaps = 3/117 (2%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQS+TDK+S LN LLA+GTG+DTFGNTG+ RIPAQHT+TGTFINSQGTGY+QV+N 
Sbjct: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446

Query: 429 P--KNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSXXXXXXXXXXXRPDQGFSLIDL 483
           P  K+NPFL  QYTGLPST++V + TGYGFGN  +             DQG SLIDL
Sbjct: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQ-NVQKQTNQNRANGADQGVSLIDL 502

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  234 bits (596), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 127/261 (48%), Positives = 160/261 (61%), Gaps = 28/261 (10%)

Query: 5   FVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLN 64
            +RSAKN+VKGYS T+VLVRDAT+N+++NPS ELL +LA +S++SV+FFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQIIRV 124
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+ENLYIIKTLREF HED GG D+G+IIRV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRALEES 184
           KAKELTS             +N++                        D+D LQRA+EES
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKRRSGGSRERNNRS-----DED-LQRAIEES 174

Query: 185 RLTAE----------EDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXX 234
           + TAE            E  R+   Q   ++ DL+                         
Sbjct: 175 KRTAEEEERRRRNGASSEADRQAALQLSREEEDLRRLQEQARLAQQQQQQQQQQPM---- 230

Query: 235 XXXXXXXGYFDIFGNPISPDE 255
                   Y+D+FGNPI+P+E
Sbjct: 231 --------YYDVFGNPITPEE 243

 Score =  167 bits (422), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 78/90 (86%), Positives = 83/90 (92%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TR+GNQ+I+DKYS LN LLA+GTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQV ND
Sbjct: 338 TRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNND 397

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGN 458
            K NPFLN QYTGLPSTNIV TQTG+GFGN
Sbjct: 398 DKPNPFLNGQYTGLPSTNIVPTQTGFGFGN 427

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  230 bits (586), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 134/254 (52%), Positives = 158/254 (62%), Gaps = 15/254 (5%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           M KQFVRSAKN+VKGYS+TQV+VR+ATSND+  P  + L  LA++++DSV+FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWCKENLYII+TL+EF + DD   DQGQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRA 180
           IIRVKAKELTS                +                        D DELQRA
Sbjct: 121 IIRVKAKELTSLLNDEE----------RLRDERGMNRRGGRRERARPRRRPSDDDELQRA 170

Query: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           +EES+ TAE+D+RRRR       ++ DLQTA                             
Sbjct: 171 IEESKRTAEDDDRRRRMRDD---EEADLQTALQLSKEEEELKRLQELQRLQQQQQQQQQQ 227

Query: 241 XG--YFDIFGNPIS 252
               Y+DIFGNPIS
Sbjct: 228 QQPMYYDIFGNPIS 241

 Score =  171 bits (433), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 79/90 (87%), Positives = 84/90 (93%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQ ITDK+ +LN LLA+GTGIDTFGNTGE RIPAQHT+TGTFINSQGTGYRQVTND
Sbjct: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGN 458
           PKNNPFLNSQYTGLPSTNIV + TGYGFGN
Sbjct: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  229 bits (584), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 135/258 (52%), Positives = 161/258 (62%), Gaps = 12/258 (4%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSK  +R+AKN+V GYS+ QVLVR+ATSN+ + P+ + L ELA++++D+V+FFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +ENLYIIKTLREF HED+ G D GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRA 180
           IIRVKAKELTS               L                        E  D+LQRA
Sbjct: 121 IIRVKAKELTSLLRDEER--------LTEERNMRKKRRGKTRRPERSRGGEEYDDDLQRA 172

Query: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTA---XXXXXXXXXXXXXXXXXXXXXXXXXX 237
           LEESRLTAEE+ERRRR  +  +D D D QTA                             
Sbjct: 173 LEESRLTAEEEERRRRTDSGSNDDD-DFQTALQLSKEEEELRRLRNLQMQQQQTAMFQQQ 231

Query: 238 XXXXGYFDIFGNPISPDE 255
                Y+D+FGNPI+P+E
Sbjct: 232 QQQPMYYDVFGNPITPEE 249

 Score =  157 bits (396), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 91/125 (72%), Gaps = 10/125 (8%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQSI+ KY+ LN LLA+GTG+DTFGNTG+ RIPAQHT+TG FINSQGTGY+QVTND
Sbjct: 374 TRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTND 433

Query: 429 -PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSXXXXXXXXXXX---------RPDQGF 478
            PKNNPFL +QYTGLPST++V + TGYGFGN                        PDQG 
Sbjct: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFGNQQLSSQQGQQLQQQQQQQQQQRGNPDQGI 493

Query: 479 SLIDL 483
           SLIDL
Sbjct: 494 SLIDL 498

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  228 bits (581), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 132/256 (51%), Positives = 152/256 (59%), Gaps = 14/256 (5%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSK F+RSAKN+V GYS  QVLVR ATSND   PS + L ELA+R+FD+V+FFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDD-GGADQG 119
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WCKENLYIIKTLREF H D+    D G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 QIIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQR 179
           +I+RVKAKELT+             + LK                          D+LQR
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGGRKNRRDDNED---------DDDLQR 171

Query: 180 ALEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           ALEESR+TAEE+ERRR+Q+    D D  LQ A                            
Sbjct: 172 ALEESRITAEEEERRRKQLMMQGD-DSSLQAALELSKEEEELRRLQQLQAQQQAALWQQQ 230

Query: 240 XXG---YFDIFGNPIS 252
                 Y+DIFGNPIS
Sbjct: 231 QQQQPMYYDIFGNPIS 246

 Score =  153 bits (387), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 70/90 (77%), Positives = 82/90 (91%), Gaps = 1/90 (1%)

Query: 370 RTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND- 428
           RTGNQSI+DK+S+LN LLA+GTGIDTFGNTGE R+PAQHT+TGTFINSQGTGY+Q+TND 
Sbjct: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGN 458
           PK+NPFL SQYTG+PS+ I  + TGYGFGN
Sbjct: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGFGN 449

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  223 bits (569), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 121/135 (89%), Gaps = 4/135 (2%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQF+RS KNMVKGYS+TQ+LVRDAT+ND + PS ++L ++A++++DSVDFFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED----DGGA 116
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WCKENLY+IKTL+EFR +D    + G 
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 117 DQGQIIRVKAKELTS 131
           DQGQI+RV+A ELTS
Sbjct: 121 DQGQIVRVRATELTS 135

 Score =  160 bits (406), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%)

Query: 370 RTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDP 429
           RTGNQ I+DKY+ LNTLLATGTGIDTFGNTG+ RIPAQHT TGTFINSQGTGY+Q  NDP
Sbjct: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYINDP 530

Query: 430 KNNPFLNSQYTGLPSTNIVSTQTGYGFGNAP 460
           KNNPF+++QYTGLPSTN+V + TGYGFGN P
Sbjct: 531 KNNPFMSNQYTGLPSTNVVPSYTGYGFGNQP 561

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  207 bits (528), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 111/127 (87%)

Query: 5   FVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLN 64
            +RSAKN+VKGYS+TQ LVRDATSN   NP  + L ELA+ ++++++FFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQIIRV 124
            KGKYW+HV KSL VLDYLVRFGSENCV+WCKENLYIIKTLREF +ED+ G DQGQ++RV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KAKELTS 131
           +AKELTS
Sbjct: 121 RAKELTS 127

 Score =  158 bits (399), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTG+QSI+DKYS LNTLLATGTGIDTFGNTG QRIPAQHT+TGTFINSQGTGY+QV+ +
Sbjct: 314 TRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVSTN 373

Query: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNA 459
             NN FLNSQYTGLPS+NIV +QTGYGFGN+
Sbjct: 374 GFNNVFLNSQYTGLPSSNIVPSQTGYGFGNS 404

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  196 bits (499), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 136/212 (64%), Gaps = 10/212 (4%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQ +RSAKN++ GYS  QVLVR+ATSND   PS + + ELA+R++ +V+FFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDD-GGADQG 119
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W +EN++II+ L EF H D+  G D G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 QIIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQR 179
           Q+IRVKAKEL +             + L                         D D L+R
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDGV-------DPD-LKR 172

Query: 180 ALEESRLTAEEDERRRRQMAQYDDQDPDLQTA 211
           ALEESR+TAEE+ERRR+   + +D + +LQ A
Sbjct: 173 ALEESRITAEEEERRRKLAEKTEDAE-ELQAA 203

 Score =  159 bits (401), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 93/117 (79%), Gaps = 7/117 (5%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQSI+DKY +LN LLATGTGIDTFGNTG+ RI +QHT+T TFINS GTG++QV+N+
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 429 -PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSXXXXXXXXXXXRP-DQGFSLIDL 483
            PK+NPFL +QYTGLPSTNIV + TGYGFGNA S           +P DQG SLIDL
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASS-----FQQTASKPNDQGMSLIDL 514

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  197 bits (500), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 89/131 (67%), Positives = 110/131 (83%), Gaps = 1/131 (0%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MS+QFVRSAKN++KGYS+TQVLVRDAT+ND   P  + L ++A  SFDSVDFFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDG-GADQG 119
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W +++L+++K LR FR  DDG G DQG
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 QIIRVKAKELT 130
           QI+RVKA++L 
Sbjct: 121 QIVRVKARDLV 131

 Score =  145 bits (365), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 69/91 (75%), Positives = 77/91 (84%), Gaps = 3/91 (3%)

Query: 371 TGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTN--- 427
           TGNQ +T+KYS+LN LLA GTG+DTFGN G QRIPAQHTQTGTFINSQGTG++QV +   
Sbjct: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555

Query: 428 DPKNNPFLNSQYTGLPSTNIVSTQTGYGFGN 458
           DP +NPFLNSQYTGLPST IV   TGYGFGN
Sbjct: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFGN 586

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 42/86 (48%), Gaps = 4/86 (4%)

Query: 173 DQDELQRALEESRLTAEEDERRRRQMAQYDDQDPDLQTA----XXXXXXXXXXXXXXXXX 228
           D D+LQRA+EES+ T +EDE RRRQ++ YD++DP+ Q A                     
Sbjct: 204 DDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNLQHLQRLQQ 263

Query: 229 XXXXXXXXXXXXXGYFDIFGNPISPD 254
                         Y D+FGNP+S D
Sbjct: 264 QQQQQQQQQQLNTAYLDVFGNPVSQD 289

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  194 bits (493), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 109/255 (42%), Positives = 144/255 (56%), Gaps = 11/255 (4%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MS QFVRS KNM KGYS TQVLVRDAT+N+ S  S ++L +L + S+D+ +F +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W ++N   ++ LR+F + D  G DQGQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQDELQRA 180
           +IRVKA EL               +N++                       ED++++ RA
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180

Query: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           LEES+ TAEEDE RRR+  + + Q  DL+ A                             
Sbjct: 181 LEESKKTAEEDEARRRKDQEREKQ--DLKEAVKLSKEEDELKRLQDEANNKPQ------- 231

Query: 241 XGYFDIFGNPISPDE 255
             YFD  GNPIS +E
Sbjct: 232 --YFDENGNPISQEE 244

 Score =  116 bits (291), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/113 (53%), Positives = 71/113 (62%), Gaps = 7/113 (6%)

Query: 371 TGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDPK 430
           TGN  I+ KYS LN LLA GTGIDTFGN G  RIPAQHT+TGTFINSQGTGY+QVT+   
Sbjct: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSSSS 655

Query: 431 NNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSXXXXXXXXXXXRPDQGFSLIDL 483
             P L +QYTGLP+   V   +       PS           +  QGF+L+DL
Sbjct: 656 PIPLLPTQYTGLPAQTAVHVPS-------PSPLQPSEKEHQTQQTQGFTLVDL 701

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  184 bits (468), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 122/190 (64%), Gaps = 11/190 (5%)

Query: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60
           MSKQ +RSAKN+V GYS  Q+LVR+ATSN+   PS + + ELA+RS+ +V+FFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDG-GADQG 119
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W +ENLY+ + L EF H D+  G D G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 QIIRVKAKELTSXXXXXXXXXXXXTINLKXXXXXXXXXXXXXXXXXXXXXXXEDQD-ELQ 178
           QIIRVKA+EL +             + L                        ED D +LQ
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRL---------GRNPRNRQASVPPPAEDLDPDLQ 171

Query: 179 RALEESRLTA 188
           RALEESR+TA
Sbjct: 172 RALEESRITA 181

 Score =  159 bits (401), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 95/117 (81%), Gaps = 4/117 (3%)

Query: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428
           TRTGNQSITDKYS+LNTLLA+GTG+DTFGNTG+ RIPAQHT+TGTFINSQGTGY+QV N+
Sbjct: 401 TRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNE 460

Query: 429 -PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSXXXXXXXXXXXRP-DQGFSLIDL 483
            PK+NPF+ +QYTGLPSTN+V + TGYGFGNA             +P +Q  SLID+
Sbjct: 461 PPKHNPFIATQYTGLPSTNMVPSHTGYGFGNA--GNGFQQSGNSNKPNEQNISLIDI 515

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 78/129 (60%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+NMV  Y+  +  VR+AT+N+    S  L+ +++Q +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K    WR + K+L +LDYL+R G+E  +   + NL +IK L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +A EL
Sbjct: 135 NVRNRAHEL 143

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 78/129 (60%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+ ++AQ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K    WR + K+L +LDYL+R G+E  +   + NL +IK L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +A EL
Sbjct: 135 NVRNRAHEL 143

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 87.4 bits (215), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 80/131 (61%), Gaps = 1/131 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+ ++AQ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K G  WR + K+L +L+YL+  G+E  +   + +L +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGA 134

Query: 121 IIRVKAKELTS 131
            +R +A+ +TS
Sbjct: 135 NVRSRAQAMTS 145

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 87.0 bits (214), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 79/129 (61%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  ++  +  VR+AT+N+    S  L+ ++AQ +++  +  E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K G  WR + K+L +LDYL+R GSE  +   +  L I++ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGV 134

Query: 121 IIRVKAKEL 129
            +R +AK++
Sbjct: 135 NVRNRAKQI 143

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 80/130 (61%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+ ++AQ +++  + +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + +L +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGI 134

Query: 121 IIRVKAKELT 130
            +R +AK L 
Sbjct: 135 NVRNRAKLLV 144

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 84.3 bits (207), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 77/129 (59%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+  +AQ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K    WR + K+L +L+YLV+ GSE  +   + NL ++K L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +A +L
Sbjct: 135 NVRNRASQL 143

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 84.3 bits (207), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 79/129 (61%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+ ++AQ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K G  WR + KSL +LDYL+R GSE  +   + ++ +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +AK L
Sbjct: 135 NVRNRAKAL 143

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 84.3 bits (207), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 78/129 (60%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+ +++  +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   + NL +IK L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +A+EL
Sbjct: 135 NVRNRAQEL 143

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 83.6 bits (205), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 78/129 (60%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+ +++Q +++  +  EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           RL +K    WR + K+L +LDYL+R  SE  +   + ++ +IK L  F + D  G DQG 
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +AK L
Sbjct: 135 NVRNRAKAL 143

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 78/129 (60%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+ +++Q +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ +IK L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R + K L
Sbjct: 135 NVRTRVKAL 143

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 80/131 (61%), Gaps = 1/131 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  L+ +++Q +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   + +L +IK L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELTS 131
            +R KA+ LT+
Sbjct: 135 NVRNKAQSLTA 145

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 78/129 (60%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+ +++Q +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ +IK L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R + K L
Sbjct: 135 NVRTRVKTL 143

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 78/129 (60%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+ +++Q +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R + K L
Sbjct: 135 NVRTRVKAL 143

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 78/130 (60%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+  +AQ +++  +  EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   + ++ ++K L  F + D  G DQG 
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGI 169

Query: 121 IIRVKAKELT 130
            +R +AK LT
Sbjct: 170 NVRTRAKALT 179

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 81.3 bits (199), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 78/129 (60%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+ +++Q +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R + K L
Sbjct: 135 NVRTRVKAL 143

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 80.9 bits (198), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 78/129 (60%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+ ++AQ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ ++K L+ F + D  G DQG 
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +   L
Sbjct: 135 NVRNRVTTL 143

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 77/130 (59%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  L+ ++AQ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K    WR + KS+ +L+YLV+ GSE  +   + NL +I+ L  F + D  G DQG 
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELT 130
            +R + K L 
Sbjct: 135 NVRNRTKALV 144

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 78/131 (59%), Gaps = 1/131 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  L+ ++AQ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K    WR + KSL + DYL++ GSE  +   + ++ +IK L  F + D  G DQG 
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELTS 131
            +R KA+ L +
Sbjct: 135 NVRNKAQSLVA 145

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 75/123 (60%), Gaps = 1/123 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N+    S  L+ ++AQ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K G  WR + K+L +L+YL++ GSE  +   + ++ I+K L  F + D  G DQG 
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGV 134

Query: 121 IIR 123
            +R
Sbjct: 135 NVR 137

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 75/130 (57%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT+N++      L+ ++AQ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K    WR + KS+ +L+YL+  GSE  +   +  L +IK L  F + D  G DQG 
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELT 130
            +R + + L 
Sbjct: 135 NVRNRTQALV 144

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 78/136 (57%), Gaps = 15/136 (11%)

Query: 5   FVRSAKNMVKGYSTTQVLVRDATSNDA-SNPSFELLYELAQRSFDSVDFFEIMDMLDKRL 63
           F+RS +NM  G STT+V V+ AT +D  S  +  L+ E++  ++ +    EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWR-------HVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFR---HEDD 113
           +  G Y +       H+ K+LT++ YL+  GS + V W ++  Y++ TLREF     +D 
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDR 118

Query: 114 GGADQGQIIRVKAKEL 129
             A+Q +++ +K  +L
Sbjct: 119 KMAEQVRMLSIKLSKL 134

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 2/128 (1%)

Query: 2   SKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDK 61
           +K+F R A+N +   +  +  VR+AT+ND    S  L+ ++   +F+     +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120
           R  +K G  WR + KS+ +L YL+  GS   V   K NL +IK L  F   DD G +Q  
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSS 134

Query: 121 IIRVKAKE 128
            I  KA E
Sbjct: 135 KIS-KATE 141

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 74/133 (55%), Gaps = 12/133 (9%)

Query: 5   FVRSAKNMVKGYSTTQVLVRDATSNDASN-PSFELLYELAQRSFDSVDFFEIMDMLDKRL 63
            +++ +N+  G S+T+V  R+AT++D  N  +  L+ EL+  ++      EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  N-----DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQ 118
           +        K   H+ K+LT++ YL+  GS+  V+W +  LY+I TL+EF    +GG+  
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEF----NGGSRT 116

Query: 119 GQIIRVKAKELTS 131
            + +  + + L S
Sbjct: 117 KERMASQIRNLAS 129

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 72/130 (55%), Gaps = 8/130 (6%)

Query: 8   SAKNMVKGYSTTQVLVRDAT-SNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDK 66
           S + +V+  STT++ V+ AT  N++S  +  L+ E++  ++      EI+ ++ KRL   
Sbjct: 6   SVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRLMGH 63

Query: 67  G-----KYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQI 121
           G     K   H+ K+LT++ YL+  GS + + W + N+ ++  L+EF  +D      GQ 
Sbjct: 64  GRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKIGQQ 123

Query: 122 IRVKAKELTS 131
           IR  +++L +
Sbjct: 124 IRAMSQDLCT 133

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 62/114 (54%), Gaps = 10/114 (8%)

Query: 8   SAKNMVKGYSTTQVLVRDATS-NDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDK 66
           S +N V+  S T+  V++AT  N+ S  +  L+ E++  ++      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 67  GKY-----WRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFR--HEDD 113
            K        H+ K++T++ YL+  GS + + W + N+ I + L++F   HEDD
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDD 117

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 69/120 (57%), Gaps = 10/120 (8%)

Query: 15  GYSTTQVLVRDAT-SNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDKGKYWRH- 72
           G STTQ+ V+ AT SN++   +  L+ EL+  ++      EI +++ KRL +     ++ 
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 73  ------VAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQIIRVKA 126
                 V K+LT+++YL+  GSE  VLW + +L  I+ L+++   +D   D+ ++ ++K+
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSND--KDKSKVKQIKS 128

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 72/136 (52%), Gaps = 15/136 (11%)

Query: 5   FVRSAKNMVKGYSTTQVLVRDATSNDASNPSF-ELLYELAQRSFDSVDFFEIMDMLDKRL 63
           F+ S +++  G S+T V V+ AT +   N ++  L+ E+A  ++      EI  +L KRL
Sbjct: 3   FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL 60

Query: 64  NDKGKYWR-------HVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED---D 113
              G Y +       ++ K+LT++ +LV  GSE C+ W + +L +I++ ++F   D    
Sbjct: 61  --VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKK 118

Query: 114 GGADQGQIIRVKAKEL 129
              +Q Q++  K  +L
Sbjct: 119 QMVNQIQLLSCKLCQL 134

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 62/122 (50%), Gaps = 6/122 (4%)

Query: 15  GYSTTQVLVRDATSNDA-SNPSFELLYELAQRSFDSVDFFEIMDMLDKRL---NDKGKYW 70
           G S T++  ++AT++D  S  +  L+ E++  ++ S    EI  ++ KRL   N K  + 
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRLSGNNRKSSHK 70

Query: 71  R--HVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQIIRVKAKE 128
              H+ K+LT+  YL+  GS   V W +  +Y+I +L+EF     G       IR  A  
Sbjct: 71  NAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFTIGSRGQERMAVQIRSLAST 130

Query: 129 LT 130
           L+
Sbjct: 131 LS 132

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 62/121 (51%), Gaps = 8/121 (6%)

Query: 8   SAKNMVKGYSTTQVLVRDATSND-ASNPSFELLYELAQRSFDSVDFFEIMDMLDKRL--- 63
           S +N V+  S T+  VR AT +D  S  +  L+ E++  ++      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGY 63

Query: 64  --NDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQI 121
              +  K   H+ K+LT++ YL+  GS + + W + N+ + + L+ F  ++      GQ 
Sbjct: 64  SKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMGQQ 123

Query: 122 I 122
           I
Sbjct: 124 I 124

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 58/111 (52%), Gaps = 8/111 (7%)

Query: 8   SAKNMVKGYSTTQVLVRDATS-NDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDK 66
           S +N V+  S T++ VR AT  N+ S  +  L+ E++  ++ +    EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRLTGY 63

Query: 67  GKYWRH-----VAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED 112
           GK   H     + K+LT++ YL+  GS   + W  EN  + + ++ F   D
Sbjct: 64  GKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSD 114

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 6/100 (6%)

Query: 13  VKGYSTTQVLVRDATSND-ASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDKG---- 67
           V G S+T++ VR AT+ D  +  +  L+ E++  ++      EI  +L +RL+  G    
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 68  -KYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLR 106
            K   H+ K+LT++ YL+  GSE  V W + NL   + L+
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLK 108

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 61/120 (50%), Gaps = 7/120 (5%)

Query: 17  STTQVLVRDATSND-ASNPSFELLYELAQRSFDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ ATS D  S  +  L+ E++  ++      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQIIRVKAKEL 129
              V K+LT++ YL+  GS   + W K N+ +I+ L +F+ +D      G+ IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSRNL 132

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 67/126 (53%), Gaps = 10/126 (7%)

Query: 8   SAKNMVKGY--STTQVLVRDATS-NDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLN 64
           S  +  KG+  S T++ VR AT  N+ +  +  L+ E++  ++      +++ ++ KRL+
Sbjct: 2   SLMHTFKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLS 61

Query: 65  -----DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQG 119
                +  +   HV K+LT++ YL+  GS + + W K + Y+I+ L  F  E    +D+ 
Sbjct: 62  GVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF--EAQSSSDEP 119

Query: 120 QIIRVK 125
            + +++
Sbjct: 120 MVNQIR 125

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 55/115 (47%), Gaps = 6/115 (5%)

Query: 15  GYSTTQVLVRDATS-NDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDKG-----K 68
           G S T   VR AT  N+    S  L+ E+   ++      ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  YWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQIIR 123
              H+ K+LT+ +YL+  GSE+ V W +    +++ L++F   ++  +     IR
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQIR 125

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 59/120 (49%), Gaps = 7/120 (5%)

Query: 17  STTQVLVRDATSND-ASNPSFELLYELAQRSFDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ ATS D  S  +  L+ E++  ++      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQIIRVKAKEL 129
              V K+LT++ YL+  GS   + W K N+ +I+ L  F  +D     + + IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRDERKREEIRKLSRNL 132

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 54/103 (52%), Gaps = 7/103 (6%)

Query: 17  STTQVLVRDATSND-ASNPSFELLYELAQRSFDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D  S  +  L+ E++  ++      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED 112
              V K+LT++ YL+  GS   + W K N+ +I+ L +F+ +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQD 115

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
          YAP1801Protein involved in clathrin cage assembly;
          binds Pan1p and clathrin; homologous to Yap1802p,
          member of the AP180 protein family
          Length = 637

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 3/79 (3%)

Query: 22 LVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
          LV+ AT   ++ P  + L  +   + +  DF+EI+  LD R+ND    W  V KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRFGSENCVL-WCKENL 99
           ++R GS++  L +   NL
Sbjct: 65 LMIREGSKDVALRYYSRNL 83

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 54/103 (52%), Gaps = 7/103 (6%)

Query: 17  STTQVLVRDATSND-ASNPSFELLYELAQRSFDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D  S  +  L+ E++  ++      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED 112
              V K+LT++ YL+  GS   + W K N+ +++ L +F+ +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQD 115

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 4/97 (4%)

Query: 22  LVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT    + P  + +  +   + DS +F EIM  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLVRFGSENCVL-WCKENLYIIKTLREFRHEDDGGAD 117
            ++R G  +  + +   +L   + LR+  H      D
Sbjct: 65  LMMRDGDRDVTIKYLSHHLEFFQ-LRDVFHSKLSSGD 100

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 22  LVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT   ++ P  + L  +   +    DF+EI+  LD R+ND    W  V K+L V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82  YLVRFGSENCVL-WCKENL--YIIKTLR 106
            ++R G ++  L +   NL  + I+ +R
Sbjct: 65  LMMREGKKDVALRYYSRNLEFFSIENIR 92

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 68/138 (49%), Gaps = 14/138 (10%)

Query: 5   FVRSAKNMVKGYSTTQVLVRDAT-SNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRL 63
           F  S +N+V  YS T++ VR AT  N+    +  L+ E++  ++ +    EI+ +L K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  -------NDKG----KYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED 112
                  N  G    K    V K+ T++ YL+  GS + + W K N  +++ L +    +
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILAKVDSNN 120

Query: 113 DGGADQGQIIRVKAKELT 130
               D+   I  +A+++T
Sbjct: 121 HITDDEDLHILNQAQKIT 138

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 72/137 (52%), Gaps = 17/137 (12%)

Query: 8   SAKNMVKGYSTTQVLVRDATS-NDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLND- 65
           + KN V+  + T+  V+ AT  N+ +  +  L+ E++  ++      +I+ ++ KRL+  
Sbjct: 6   TVKNFVQ--TPTESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSA 63

Query: 66  --KGKYWRH-----VAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLRE---FRHEDDGG 115
               K   H     + K+LT++ YL+  GS   + W + N Y+++ + +   F+ +D+  
Sbjct: 64  TSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQDN-S 122

Query: 116 ADQGQI--IRVKAKELT 130
           AD   I  I+V A+++T
Sbjct: 123 ADSKMIGQIKVIAEDMT 139

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 51/113 (45%), Gaps = 24/113 (21%)

Query: 6   VRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ DA  P+ + L ++ +  +  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWC 95
                               G  WR V K L V+D+L+   SE    N VL C
Sbjct: 79  HIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSC 131

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 13  VKGY--STTQVLVRDATSNDAS-NPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDKGKY 69
           VK +  S T+  V+ AT+ D +   +  L+ E++  ++      EI+ +L KRL+   + 
Sbjct: 7   VKSFVQSPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRK 66

Query: 70  WRH-----VAKSLTVLDYLVRFGSENCVLWCKENLYIIKTL 105
             H     + K+LT++ YL+  GS   V W + N  +I  L
Sbjct: 67  TSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNL 107

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 20/97 (20%)

Query: 7   RSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ VR AT+ DA  P+ + L ++ +  F  V  + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K LTV++YL+
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
          YHR161C (REAL)
          Length = 627

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 22 LVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
          LV+ AT   ++ P  + L  +   +    DF+EI+  L+ R+ND    W  V KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRFGSENCVL-WCKENL 99
           ++R G+++  L +   NL
Sbjct: 65 LMIREGAKDVALRYYSRNL 83

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLND 65
            R A+NM+  Y   Q+ +R AT+ D+  P+ + L ++     + V   +I+D + KRL D
Sbjct: 20  ARYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQIL-LDRNKVPLRKIVDYIMKRLMD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V KSL VL +L+
Sbjct: 79  HINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLL 116

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 24/115 (20%)

Query: 7   RSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDK 66
           R  +NM+  Y   Q+ +R AT+ DA  P+ + L ++ +  + SV  + + + + KR+ D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWCKEN 98
                              G  WR + K L V++YL+   SE    N V  C EN
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLEN 134

>TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa]
          {ON} Anc_5.84 YGR241C
          Length = 680

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 22 LVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
          LV+ AT    + P  + +  +   S D  DF EI+  L  R++D    W  V KSL V  
Sbjct: 7  LVKGATKIKMAPPKQKYIDPILMGSTDPRDFHEIIRALYSRISDSA--WTVVYKSLIVTH 64

Query: 82 YLVRFGSENCVL-WCKENL 99
           L+R G ++  L +   NL
Sbjct: 65 LLIREGEKDITLDYLSNNL 83

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 45/98 (45%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLND 65
            R A+NM+  Y   QV VR AT+ D+  P+ + L ++ +  +  V  + I +   KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K LTV++YL+
Sbjct: 79  HIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 52/113 (46%), Gaps = 24/113 (21%)

Query: 6   VRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ DA  P+ + L ++ +  +  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWC 95
                               G  WR V K LTV++YL   V  G E N V+ C
Sbjct: 79  HIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRC 131

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 37.4 bits (85), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 53/121 (43%), Gaps = 28/121 (23%)

Query: 6   VRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D+  P+ + L+++ +  +  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-----NCVLWCKEN 98
                               G  WR V K L VL+YL   V  GSE     +C+L  K  
Sbjct: 79  HIASRPKNFYEKARKQYVNYGSEWRVVLKCLVVLEYLLLNVDNGSELDQVTSCLLTHKHI 138

Query: 99  L 99
           L
Sbjct: 139 L 139

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ DA  P+ + L ++ +  +  V  + + + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K LTV+++L+
Sbjct: 79  HIATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLM 116

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 37.0 bits (84), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV VR AT+ D+  P+ + L ++ +  +  V  + I + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K L V++YL+
Sbjct: 79  HIAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 51/113 (45%), Gaps = 24/113 (21%)

Query: 6   VRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D+  P+ + L+++ +  +  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWC 95
                               G  WR V K L VL+YL   V  GSE + V+ C
Sbjct: 79  HIASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGC 131

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDK 66
           R  +NM+  Y   Q+ VR A++ DA  P+ + L ++ +  + SV  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 28/120 (23%)

Query: 7   RSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ DA  P+ + L ++ +  +  V  + + + + KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRY-QVPLYLMTEYILKRIVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYL---VRFGSE-----NCVLWCKENL 99
                              G  WR V K L V+D+L   V  G E     +C+L  K  L
Sbjct: 80  IAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFLFLNVEEGEELNQVKSCMLTHKHIL 139

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ +R AT+ D+  P+ + L ++ +  ++ V  F + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYE-VSMFLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K L +L+YL+
Sbjct: 79  HMAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLL 116

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ D+  P+ + L+++ +  +  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K L VL+YL+
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLL 116

>KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.17
           YLL038C
          Length = 329

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 61/137 (44%), Gaps = 17/137 (12%)

Query: 8   SAKNMVKGYSTTQVLVRDAT--SNDASNPSFELLYELAQRSFDSVDFFEIMDMLDKRLND 65
           S +N V   STT++ V+ AT  S   S+ +  ++ E++  ++      EI  +L KR + 
Sbjct: 6   SVRNFVN--STTELKVKQATDDSEVLSSSTGTVMNEISVLTYSPKTLKEIQSVLRKRFHL 63

Query: 66  KGKYWRHVA--------KSLTVLDYLVRFGSENCVLWCKENLYIIKTLR-----EFRHED 112
                R V         K+LT++ +L+  GS   V W K N+   + L+     EF   D
Sbjct: 64  MSTLPRKVLHRSCLIVLKTLTLILFLLNNGSNAFVSWIKSNVGAFEPLQNVPITEFSFTD 123

Query: 113 DGGADQGQIIRVKAKEL 129
                  + IR  A ++
Sbjct: 124 KADLPMYEQIRQSASDI 140

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,361,451
Number of extensions: 1246005
Number of successful extensions: 3906
Number of sequences better than 10.0: 96
Number of HSP's gapped: 3931
Number of HSP's successfully gapped: 137
Length of query: 483
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 370
Effective length of database: 40,524,141
Effective search space: 14993932170
Effective search space used: 14993932170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)