Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G038702.283ON38936519500.0
YNL035C2.283ON38934612841e-177
NDAI0G006302.283ON39734112751e-175
Skud_14.2982.283ON38934612641e-174
Smik_14.2962.283ON38934612471e-171
Suva_14.3112.283ON38934612411e-170
ZYRO0A01804g2.283ON37634611801e-161
SAKL0E07766g2.283ON39834811751e-160
KLTH0G10296g2.283ON42634911641e-158
KAFR0H033402.283ON36734611571e-158
TBLA0B059202.283ON40334511501e-156
KNAG0H020402.283ON39934911421e-155
Kwal_27.115502.283ON40734711311e-153
TDEL0G021402.283ON39235711131e-151
Kpol_1003.342.283ON38835011031e-149
KLLA0E08449g2.283ON42234811041e-149
Ecym_33212.283ON40934510841e-146
ADL218C2.283ON40334510721e-144
CAGL0G01628g2.283ON37634610431e-140
TPHA0C033702.283ON41335210141e-135
KNAG0E009806.9ON4141811542e-10
Kpol_1045.786.9ON3921151311e-07
TBLA0A071206.9ON4072481302e-07
KLTH0E12694g8.548ON4181741292e-07
Kwal_27.120708.548ON4181271274e-07
KLTH0C11550g6.9ON398931257e-07
KLLA0D00814g6.9ON4082061241e-06
KLLA0E23541g8.548ON4171711222e-06
CAGL0B03575g6.9ON4191351203e-06
TBLA0H036508.548ON4191871203e-06
ZYRO0F00462g6.9ON3931101194e-06
Kpol_1041.202.401ON5152101186e-06
Ecym_70428.548ON4141711161e-05
AEL250C8.548ON4171781142e-05
SAKL0E00814g6.9ON3981231113e-05
KNAG0F038707.534ON4651331114e-05
KAFR0L003206.9ON3912121096e-05
NDAI0C055108.548ON4191321071e-04
ACR017W6.9ON423861052e-04
KAFR0I008408.548ON4131981033e-04
Skud_5.336.9ON4011841034e-04
Kpol_1024.398.548ON4171851024e-04
Skud_4.637.310ON12732021034e-04
NCAS0F019702.401ON5112111025e-04
TPHA0L017208.548ON4191151016e-04
ZYRO0A08690g2.401ON516178990.001
Suva_4.537.310ON1271178990.001
Ecym_80617.310ON1228175980.002
Suva_5.126.9ON401132960.002
YMR131C (RRB1)2.401ON511198960.003
NDAI0K029006.9ON438188960.003
NCAS0E037507.310ON1276185970.003
Kpol_467.202.469ON581124950.003
Skud_13.2912.401ON509198950.003
NDAI0J003307.534ON472118950.003
TPHA0G026502.401ON516162950.004
CAGL0J01265g2.469ON517124950.004
TDEL0G033402.401ON514198940.004
KLTH0D05346g2.469ON507125940.005
Suva_13.3112.401ON510198930.006
Smik_13.3292.401ON509197930.006
Ecym_30126.9ON39780920.007
KAFR0A064804.122ON568183930.008
TDEL0C066901.34ON765156920.009
TDEL0A075506.340ON515160920.010
TDEL0C023607.310ON1264177920.010
NDAI0H027502.401ON512211910.012
KAFR0A006902.469ON508128900.014
KNAG0E021802.401ON517211900.014
ZYRO0F05808g7.310ON1282177910.015
Smik_13.2772.469ON513150880.022
NCAS0F001906.9ON411112880.024
KNAG0A036708.548ON426200880.025
Smik_5.316.9ON427132880.027
TPHA0D044807.310ON134052880.028
Kwal_56.223456.9ON39668870.029
TDEL0A024502.469ON510124880.029
TBLA0H030601.247ON730169880.031
Suva_16.606.276ON52673870.033
Suva_13.2702.469ON513150860.039
Skud_16.326.276ON522137860.040
YMR093W (UTP15)2.469ON513150860.041
SAKL0C13266g3.25ON459135860.043
Kwal_26.77362.469ON507125860.048
Skud_13.2492.469ON513149850.054
TPHA0M001906.9ON391141850.060
KNAG0E024702.469ON509124850.060
KLLA0A08822g4.122ON582167850.066
Smik_4.457.310ON1270178850.069
KLLA0E07085g3.25ON452142840.076
TPHA0L016908.544ON832123840.078
Kpol_1028.546.325ON905182840.081
ABL096W3.259ON446194830.088
YDL195W (SEC31)7.310ON1273178840.088
Kpol_1060.246.276ON48654830.094
CAGL0H08932g6.239ON902161840.095
YEL056W (HAT2)6.9ON401133830.10
Smik_6.4516.276ON523139830.11
ZYRO0G03146g2.469ON510124830.11
Kwal_56.244787.310ON1296109830.12
Kwal_47.173108.133ON553101830.12
ADR090W7.310ON1233140830.12
Kwal_26.76552.450ON74339820.14
CAGL0G04345g1.247ON711123820.14
TBLA0B092502.401ON526177820.14
Skud_10.1021.247ON708119820.15
TBLA0B046805.49ON1549171820.15
KAFR0F010606.276ON553123810.16
NCAS0G011206.276ON49454810.18
AEL314W1.247ON715123810.18
SAKL0A01276g6.340ON515160810.19
NDAI0F012406.276ON52454800.21
NCAS0B021708.548ON414174800.22
TPHA0I018808.544ON103466810.22
Smik_12.2798.435ON817178800.24
TPHA0A003803.22ON131084800.25
KNAG0D007406.276ON50454800.25
KLTH0H02134g7.310ON129965800.26
TPHA0G031002.469ON509124800.26
Skud_16.4827.534ON46550790.27
SAKL0C13332g3.22ON135364800.27
Kpol_1036.658.316ON371207790.27
TBLA0G014904.122ON73295800.28
ZYRO0A13068g8.548ON397308790.29
Kpol_1038.203.22ON131379800.29
ZYRO0C14762g6.143ON37626790.30
CAGL0A00605g4.122ON64095790.32
KLTH0D10648g8.651ON44954790.33
SAKL0F10384g7.310ON126159790.33
YPL247C6.276ON52357790.35
TPHA0J018906.135ON68997790.36
YLR222C (UTP13)8.435ON817178790.36
KLTH0D04950g2.450ON78039790.36
ZYRO0F11484g7.338ON29480770.38
Kpol_1019.307.310ON1252167790.41
AFL157C6.276ON43853780.41
AER263C6.340ON513118780.42
TPHA0M018306.340ON515160780.43
TBLA0E038902.253ON143939780.43
ADL184W3.25ON449122780.43
AAR057W6.325ON922216780.44
ADR242C2.401ON521197780.44
KAFR0A003802.401ON516211780.45
Kwal_55.220763.22ON128663780.45
ABL044C2.469ON518124780.46
Skud_7.5615.104ON59361780.46
TDEL0A068906.276ON447186770.48
KLTH0F19294g3.25ON451135770.50
KLLA0F19734g8.288ON113357780.51
TPHA0D035906.276ON59858770.53
Suva_10.3027.338ON29780760.54
KLTH0D10186g8.631ON421111770.55
Suva_10.3168.435ON818175770.55
CAGL0H00781g6.276ON51352770.57
Smik_16.4427.534ON470132770.58
TBLA0I012202.469ON511124770.58
TDEL0B020108.435ON805176770.59
TBLA0A023106.276ON53149770.60
ZYRO0G10406g4.119ON39136760.63
SAKL0E03080g2.469ON515122760.63
Kpol_530.397.338ON29480760.65
Skud_12.2727.338ON29780760.66
KNAG0A012303.22ON132172770.68
YLR208W (SEC13)7.338ON29780750.69
Ecym_80727.322ON1201138770.69
TBLA0H002303.22ON133355770.70
Kwal_26.87008.651ON38154760.72
Ecym_74032.469ON517122760.72
NDAI0H022402.469ON514146760.73
NCAS0D046106.340ON515160760.74
TPHA0F005204.77ON713101760.75
KLTH0F19338g3.22ON129063760.77
SAKL0D03740g3.259ON478107750.83
NDAI0D006307.338ON30080750.85
SAKL0E03520g2.450ON96636760.86
Smik_12.2667.338ON29780750.87
NCAS0F014502.450ON90836760.87
SAKL0H22396g4.122ON555124750.91
TBLA0F021407.310ON1300140760.93
NCAS0B078401.247ON58959750.98
NCAS0C053105.631ON34980741.0
Kpol_1010.257.442ON1048107751.0
KLLA0E20967g3.22ON132193751.1
YPR178W (PRP4)7.534ON46545741.1
CAGL0M04081g3.25ON455153741.1
Kwal_55.220673.25ON451135741.1
KNAG0D027205.49ON1541128751.2
Suva_7.2794.122ON566129741.2
ABL024W2.450ON73441741.3
TBLA0B040708.631ON417114741.3
KLLA0A04653g4.77ON700188741.3
SAKL0B09306g3.419ON830163741.4
CAGL0D05588g5.201ON47737741.4
TBLA0I025708.435ON848147741.5
TPHA0K007807.405ON36179731.5
Ecym_20243.22ON131759741.6
NDAI0I015206.135ON644103731.6
Ecym_21396.276ON43551731.6
CAGL0A00561g4.119ON41260731.6
KAFR0A058004.275ON940138731.7
NCAS0A078602.469ON51055731.7
KAFR0K019007.405ON36347721.7
NDAI0B017107.180ON454185731.8
KNAG0I028406.340ON519166731.8
KNAG0C034907.405ON362148721.8
CAGL0G03399g7.405ON36958721.8
Kwal_27.122398.585ON31665721.8
Kwal_56.245967.338ON29480721.9
TPHA0G018408.631ON43173721.9
Skud_2.3218.548ON422261721.9
NCAS0C044503.25ON461175721.9
NCAS0A105003.259ON47836721.9
Kwal_33.151365.201ON473188722.0
ZYRO0E08184g6.276ON50651722.0
Kpol_2000.391.107ON44336722.0
KAFR0L014407.338ON30480722.0
Kwal_27.105737.442ON1015173732.0
CAGL0K03377g2.450ON97844732.0
KAFR0L013207.310ON1240216732.1
SAKL0H07150g8.651ON44181722.1
NCAS0D033306.135ON624132722.1
TBLA0B087303.25ON461138722.1
Skud_4.4018.316ON376220722.1
NDAI0I014406.143ON38339722.2
NCAS0H007007.338ON29780712.2
KAFR0E031808.544ON814197722.4
Ecym_71055.201ON484184722.4
NCAS0I024903.95ON62634722.4
KNAG0F023506.143ON38867712.4
Kwal_23.53517.534ON47477722.4
ACR097W8.631ON46759722.4
KLLA0F17237g2.401ON52359722.4
CAGL0M05335g8.544ON806188722.5
TPHA0P014903.25ON459142712.5
AGR180W8.435ON806232722.5
NCAS0F033405.429ON44841712.5
TPHA0F007704.122ON631147722.5
SAKL0A02970g6.276ON41552712.5
ZYRO0B10450g5.201ON482124712.6
Kpol_2001.687.338ON29599702.8
ZYRO0C08976g7.275ON55087712.8
NDAI0J010408.316ON39867712.8
ZYRO0C15994g3.344ON504241712.9
NDAI0E044407.356ON58158713.0
KAFR0F033404.119ON40943713.0
YDR142C (PEX7)8.316ON375220713.0
Ecym_83368.651ON456140713.0
Ecym_70388.544ON800176713.1
Skud_12.2858.435ON817175713.2
ADL186C3.22ON136159713.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G03870
         (389 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283    755   0.0  
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...   499   e-177
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...   495   e-175
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...   491   e-174
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...   484   e-171
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...   482   e-170
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...   459   e-161
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...   457   e-160
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...   452   e-158
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...   450   e-158
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...   447   e-156
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...   444   e-155
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...   440   e-153
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...   433   e-151
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...   429   e-149
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...   429   e-149
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...   422   e-146
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...   417   e-144
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...   406   e-140
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...   395   e-135
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    64   2e-10
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    55   1e-07
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    55   2e-07
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    54   2e-07
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    54   4e-07
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    53   7e-07
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    52   1e-06
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    52   2e-06
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    51   3e-06
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    51   3e-06
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    50   4e-06
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    50   6e-06
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    49   1e-05
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    49   2e-05
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    47   3e-05
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    47   4e-05
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    47   6e-05
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    46   1e-04
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    45   2e-04
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    44   3e-04
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    44   4e-04
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...    44   4e-04
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    44   4e-04
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    44   5e-04
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....    44   6e-04
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    43   0.001
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    43   0.001
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    42   0.002
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    42   0.002
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    42   0.003
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      42   0.003
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    42   0.003
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    41   0.003
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    41   0.003
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      41   0.003
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    41   0.004
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    41   0.004
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    41   0.004
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    41   0.005
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    40   0.006
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    40   0.006
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    40   0.007
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    40   0.008
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    40   0.009
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    40   0.010
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    40   0.010
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    40   0.012
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    39   0.014
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    39   0.014
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    40   0.015
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    39   0.022
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    39   0.024
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    39   0.025
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    39   0.027
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    39   0.028
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    38   0.029
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    39   0.029
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    39   0.031
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    38   0.033
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    38   0.039
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    38   0.040
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    38   0.041
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    38   0.043
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    38   0.048
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    37   0.054
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    37   0.060
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    37   0.060
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    37   0.066
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    37   0.069
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    37   0.076
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    37   0.078
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    37   0.081
ABL096W Chr2 (217132..218472) [1341 bp, 446 aa] {ON} Syntenic ho...    37   0.088
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    37   0.088
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    37   0.094
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    37   0.095
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    37   0.10 
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    37   0.11 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    37   0.11 
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    37   0.12 
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    37   0.12 
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    37   0.12 
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    36   0.14 
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    36   0.14 
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    36   0.14 
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    36   0.15 
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    36   0.15 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    36   0.16 
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    36   0.18 
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    36   0.18 
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    36   0.19 
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    35   0.21 
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    35   0.22 
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    36   0.22 
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    35   0.24 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    35   0.25 
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    35   0.25 
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    35   0.26 
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    35   0.26 
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    35   0.27 
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    35   0.27 
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    35   0.27 
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    35   0.28 
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    35   0.29 
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    35   0.29 
ZYRO0C14762g Chr3 complement(1148438..1149568) [1131 bp, 376 aa]...    35   0.30 
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    35   0.32 
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    35   0.33 
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    35   0.33 
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    35   0.35 
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    35   0.36 
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    35   0.36 
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    35   0.36 
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    34   0.38 
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    35   0.41 
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    35   0.41 
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    35   0.42 
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    35   0.43 
TBLA0E03890 Chr5 complement(977425..981744) [4320 bp, 1439 aa] {...    35   0.43 
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    35   0.43 
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    35   0.44 
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    35   0.44 
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    35   0.45 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    35   0.45 
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    35   0.46 
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    35   0.46 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    34   0.48 
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    34   0.50 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    35   0.51 
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    34   0.53 
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    34   0.54 
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    34   0.55 
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    34   0.55 
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    34   0.57 
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    34   0.58 
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    34   0.58 
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    34   0.59 
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    34   0.60 
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    34   0.63 
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    34   0.63 
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    34   0.65 
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    34   0.66 
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    34   0.68 
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    33   0.69 
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    34   0.69 
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    34   0.70 
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    34   0.72 
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    34   0.72 
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    34   0.73 
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     34   0.74 
TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.7...    34   0.75 
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    34   0.77 
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    33   0.83 
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    33   0.85 
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    34   0.86 
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    33   0.87 
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    34   0.87 
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    33   0.91 
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    34   0.93 
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    33   0.98 
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    33   1.0  
Kpol_1010.25 s1010 complement(55113..58259) [3147 bp, 1048 aa] {...    33   1.0  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    33   1.1  
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    33   1.1  
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    33   1.1  
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    33   1.1  
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    33   1.2  
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    33   1.2  
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    33   1.3  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    33   1.3  
KLLA0A04653g Chr1 complement(417313..419415) [2103 bp, 700 aa] {...    33   1.3  
SAKL0B09306g Chr2 complement(788332..790824) [2493 bp, 830 aa] {...    33   1.4  
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    33   1.4  
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    33   1.5  
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    33   1.5  
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    33   1.6  
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    33   1.6  
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    33   1.6  
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    33   1.6  
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    33   1.7  
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    33   1.7  
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    32   1.7  
NDAI0B01710 Chr2 (407575..408939) [1365 bp, 454 aa] {ON} Anc_7.1...    33   1.8  
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    33   1.8  
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    32   1.8  
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    32   1.8  
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    32   1.8  
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    32   1.9  
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    32   1.9  
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    32   1.9  
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      32   1.9  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    32   1.9  
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    32   2.0  
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    32   2.0  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    32   2.0  
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    32   2.0  
Kwal_27.10573 s27 complement(399825..402872) [3048 bp, 1015 aa] ...    33   2.0  
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    33   2.0  
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    33   2.1  
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    32   2.1  
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     32   2.1  
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    32   2.1  
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    32   2.1  
NDAI0I01440 Chr9 (343925..345076) [1152 bp, 383 aa] {ON} Anc_6.1...    32   2.2  
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    32   2.2  
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    32   2.4  
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    32   2.4  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    32   2.4  
KNAG0F02350 Chr6 (441601..442767) [1167 bp, 388 aa] {ON} Anc_6.1...    32   2.4  
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    32   2.4  
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    32   2.4  
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    32   2.4  
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    32   2.5  
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    32   2.5  
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    32   2.5  
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    32   2.5  
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    32   2.5  
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    32   2.5  
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    32   2.6  
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    32   2.8  
ZYRO0C08976g Chr3 complement(684862..686514) [1653 bp, 550 aa] {...    32   2.8  
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    32   2.8  
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    32   2.9  
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    32   3.0  
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    32   3.0  
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    32   3.0  
Ecym_8336 Chr8 (677880..679250) [1371 bp, 456 aa] {ON} similar t...    32   3.0  
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    32   3.1  
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    32   3.2  
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    32   3.2  
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    32   3.2  
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    32   3.2  
TDEL0A01650 Chr1 (298190..299332) [1143 bp, 380 aa] {ON} Anc_6.1...    32   3.4  
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    32   3.5  
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    32   3.5  
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    32   3.6  
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    31   3.7  
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    32   3.8  
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    31   3.8  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    32   3.8  
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    31   3.8  
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    32   3.8  
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    32   3.8  
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    32   3.9  
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    31   4.0  
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    31   4.0  
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    32   4.0  
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    32   4.1  
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    32   4.2  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    32   4.2  
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    31   4.5  
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    32   4.6  
NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {O...    32   4.6  
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    31   4.6  
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    31   4.7  
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    31   4.7  
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    32   4.7  
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    31   4.7  
SAKL0A06314g Chr1 (571580..572701) [1122 bp, 373 aa] {ON} highly...    31   4.7  
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    32   4.8  
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    31   5.0  
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    31   5.1  
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    31   5.1  
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    31   5.1  
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    31   5.1  
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    31   5.2  
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    31   5.4  
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    31   5.4  
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    31   5.5  
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    31   5.8  
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    31   6.0  
CAGL0K07095g Chr11 (698857..699972) [1116 bp, 371 aa] {ON} highl...    31   6.0  
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    31   6.1  
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    31   6.1  
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    31   6.2  
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    31   6.3  
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    31   6.4  
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    31   6.5  
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    31   6.5  
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    31   6.6  
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    30   6.6  
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    31   6.7  
Ecym_8020 Chr8 (52179..53834) [1656 bp, 551 aa] {ON} similar to ...    31   6.7  
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    31   6.8  
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    30   7.6  
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    30   7.8  
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    30   7.9  
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    30   7.9  
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    30   8.0  
KAFR0A04480 Chr1 (889486..890616) [1131 bp, 376 aa] {ON} Anc_6.1...    30   8.0  
Suva_4.491 Chr4 complement(855726..856880) [1155 bp, 384 aa] {ON...    30   8.1  
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    31   8.2  
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    30   8.3  
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    30   8.4  
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    30   8.5  
Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {O...    30   8.5  
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    31   8.6  
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    30   8.7  
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    30   8.8  
TBLA0I02420 Chr9 (556155..558566) [2412 bp, 803 aa] {ON} Anc_6.3...    30   8.9  
TBLA0I00900 Chr9 complement(167150..170167) [3018 bp, 1005 aa] {...    30   9.0  
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    30   9.1  
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    30   9.3  
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    30   9.3  
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    30   9.4  
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    30   9.5  
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    30   9.6  
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    30   9.7  
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    30   9.9  
CAGL0L01507g Chr12 (167209..171099) [3891 bp, 1296 aa] {ON} simi...    30   9.9  

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/365 (100%), Positives = 365/365 (100%)

Query: 1   MSSSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISET 60
           MSSSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISET
Sbjct: 1   MSSSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISET 60

Query: 61  SINDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLAC 120
           SINDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLAC
Sbjct: 61  SINDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLAC 120

Query: 121 GTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180
           GTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD
Sbjct: 121 GTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180

Query: 181 LSEAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMG 240
           LSEAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMG
Sbjct: 181 LSEAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMG 240

Query: 241 DVREKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRD 300
           DVREKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRD
Sbjct: 241 DVREKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRD 300

Query: 301 VYIPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTLLAPSEVVTAG 360
           VYIPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTLLAPSEVVTAG
Sbjct: 301 VYIPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTLLAPSEVVTAG 360

Query: 361 EVKQS 365
           EVKQS
Sbjct: 361 EVKQS 365

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score =  499 bits (1284), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 230/346 (66%), Positives = 284/346 (82%), Gaps = 2/346 (0%)

Query: 3   SSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62
           +SYSLV S SFGS NW LKLQP     +GLLT LSNGE+  LD ST  ++QK   SET+I
Sbjct: 2   ASYSLVESNSFGSENWCLKLQPSY--KHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAI 59

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           ND+++I  + ++  L ++A+ ++VK+FDI +   +A I ++ N PF SLDSRHGLLACGT
Sbjct: 60  NDMKVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRHGLLACGT 119

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           EL+G+DAA+YIYDIRKWD P+RSL+DSHHDDVTC+K+HP+D NILLSGSTDGYTN+YDL 
Sbjct: 120 ELQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179

Query: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242
           + EEED+LHQVIN+ASIHSCGWLSP+RIFTLSHMETFAIHELNDKSD LKEPQP+D GDV
Sbjct: 180 QDEEEDALHQVINYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGDV 239

Query: 243 REKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVY 302
           RE W CDYVVD+YPG IATGK+QE  GEL L+P +DE +D  N IVIP AH DEV+RD++
Sbjct: 240 REIWNCDYVVDIYPGLIATGKTQENCGELCLLPFKDEKVDTENGIVIPHAHGDEVVRDIF 299

Query: 303 IPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLED 348
           IP+  S M+Y+CGEDG VK+W+N  GPL++PE  WDYSK++N+L D
Sbjct: 300 IPAQHSNMLYSCGEDGCVKIWENKQGPLDIPENFWDYSKKMNVLGD 345

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score =  495 bits (1275), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 238/341 (69%), Positives = 277/341 (81%), Gaps = 2/341 (0%)

Query: 3   SSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62
           S YSL+NS SFGSNNW  K QPL   N GLL SLSNGE+H LD  T  + Q   +S  SI
Sbjct: 4   SPYSLLNSHSFGSNNWCFKFQPLDKAN-GLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSI 62

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTK-EVATIHSQGNVPFPSLDSRHGLLACG 121
           NDL+++N +     LF+TAT+ SVKIFDI+S    +AT+H+  NVPF SLDSRHGLLA G
Sbjct: 63  NDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMG 122

Query: 122 TELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           TEL+GVDA I IYDIRKWD P+RSL+DSHHDDVT LK+HP+DP +LLSGSTDGYTNVYDL
Sbjct: 123 TELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182

Query: 182 SEAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGD 241
           ++ +E+D+LHQV+N+ASIHSCGWLSP RIFTLSHMETFAIHELNDKS+ LKEPQP+D GD
Sbjct: 183 TQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGD 242

Query: 242 VREKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDV 301
           VREKWGCDYV+DVYPG+IA GKSQE  G+LKLIP   E I + +S+VIP AH DEVIRDV
Sbjct: 243 VREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDV 302

Query: 302 YIPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKR 342
           +IP   S ++Y+CGEDG V LWKNNNG LNVPEQ WDYSKR
Sbjct: 303 FIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKR 343

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  491 bits (1264), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 226/346 (65%), Positives = 282/346 (81%), Gaps = 2/346 (0%)

Query: 3   SSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62
           SSYSLV S SFGS NW LKLQP      GLLT LSNGE+  LD ++  ++QK   SETSI
Sbjct: 2   SSYSLVESNSFGSENWCLKLQPSY--KYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSI 59

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           NDL++I+ +  +  L ++A+ ++VK+FDI +   VA IH++ N PF SLDSRHGLLACGT
Sbjct: 60  NDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGT 119

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           EL+G+DAA+YIYDIR+WD P+RS++DSHHDDVTC+K+HP+D N+LLSGSTDGYTN+YDL 
Sbjct: 120 ELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179

Query: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242
           + EEED+LHQVIN+ASIHSCGWLS +RI+TLSHMETFAIHELNDKSD  KEP+P D GD+
Sbjct: 180 QDEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDI 239

Query: 243 REKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVY 302
           RE W CDYVVDVYPG IATGK+QE  GEL+L+P +DE +D  N IVIP AH DEV+RDV+
Sbjct: 240 REAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVF 299

Query: 303 IPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLED 348
           I +  S ++Y+CGEDG VK+WKNN GPLN PE  WDYS+++N+L++
Sbjct: 300 ISALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDE 345

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  484 bits (1247), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 223/346 (64%), Positives = 281/346 (81%), Gaps = 2/346 (0%)

Query: 3   SSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62
           +SYSLV S  FGS NW LKLQP     +GLLT LSNGE+  LD +T  ++Q    SET+I
Sbjct: 2   ASYSLVESNFFGSENWCLKLQPSY--KHGLLTGLSNGEIRLLDWATCKSLQNIKASETAI 59

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           NDL++I+ + ++  L ++A+ ++VK+FDI +   +ATI ++ N PF SLDSRHGLLACGT
Sbjct: 60  NDLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGT 119

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           EL+G+DAA++IYDIRKWD P+RSL+DSHHDDVTC+K+HP+D NILLSGSTDGYTN+YDL 
Sbjct: 120 ELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179

Query: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242
           + EEED+LHQVIN+ASIHSCGWLSP+RI+TLSHMETFAIHELNDKSD L+EPQP+D GDV
Sbjct: 180 QDEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDV 239

Query: 243 REKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVY 302
           R+ W CDYVVD+YPG IATGK+QE  GEL+LIP ++E I      VIP AH DEV+RD++
Sbjct: 240 RKAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIF 299

Query: 303 IPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLED 348
           I +H S M+Y+CGEDG VK+WK+  GPLN PE  WDYS+++N+L D
Sbjct: 300 ISAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGD 345

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  482 bits (1241), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 225/346 (65%), Positives = 284/346 (82%), Gaps = 2/346 (0%)

Query: 3   SSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62
           +SYSLV+  SFGS NW LKLQP     +GLLT LSNGE+  LD +T   +QK   SET+I
Sbjct: 2   NSYSLVDLNSFGSENWCLKLQPAY--KHGLLTGLSNGEICLLDWNTGKPLQKIRASETAI 59

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           ND+++I+ +  +  L ++A+ +SVK+FDI S   VA I+++ N PF SLDSRHGLLACGT
Sbjct: 60  NDMKIIDSDFVAGNLISSASIDSVKVFDIRSNDCVAKINNETNSPFLSLDSRHGLLACGT 119

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           EL+G+DAAI+IYD+RKWD P+RSLVDSHHDDVTC+K+HP+D N+LLSGSTDGYTN+YDL 
Sbjct: 120 ELQGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179

Query: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242
           + +EED+LHQVIN+ASIHSCGWLSP+RI+TLSHMETF+IHELNDKSD LKEPQP+D GD+
Sbjct: 180 QDDEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFSIHELNDKSDELKEPQPLDFGDI 239

Query: 243 REKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVY 302
           R+ W CDYVVDVYPGFIATGK+QE  GEL+L+P +DE ID  N IVIP AH DEV+RDV+
Sbjct: 240 RKAWNCDYVVDVYPGFIATGKTQEGAGELRLLPFKDEKIDTGNGIVIPHAHGDEVVRDVF 299

Query: 303 IPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLED 348
           +   ++ ++Y+CGEDG VK+WKN+ G LN P   WDYS+R+++LED
Sbjct: 300 VSEQNTDVLYSCGEDGCVKIWKNSLGCLNTPASFWDYSERISVLED 345

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score =  459 bits (1180), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 212/346 (61%), Positives = 273/346 (78%), Gaps = 4/346 (1%)

Query: 4   SYSLVNSRSFGSNNWALKLQP-LQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62
           SYSLVNS SFG+NNW L LQP  QH    LL SLSNG+VH LD  T  +I      E ++
Sbjct: 2   SYSLVNSESFGNNNWCLNLQPAYQHS---LLASLSNGQVHQLDWQTGKSIAHIKTGEVAV 58

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N L+LIN++  +   + TAT  +VKI+DI S   +ATI +  N PF SLDSRH +LACGT
Sbjct: 59  NKLKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGT 118

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           EL G DA ++IYD+RKWD P+RSLVDSHHDD+T + +HP+DPN+L+SGSTDGYTN+YDL 
Sbjct: 119 ELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178

Query: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242
           +AEEED+LHQVINFASIHSCGWL+PRRIFTLSHMETF+IHELNDKSD  KEP+P++  DV
Sbjct: 179 QAEEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDV 238

Query: 243 REKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVY 302
           RE WGCDYVVD++PG++A G SQE  G+L+++P Q E +D  N+I I  AH DEV+RDV+
Sbjct: 239 RESWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVF 298

Query: 303 IPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLED 348
           +P+ +S ++Y+CGEDG+VK W+N +GPLNV ++ WDYS+ +N+L++
Sbjct: 299 VPARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDE 344

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score =  457 bits (1175), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 207/348 (59%), Positives = 272/348 (78%), Gaps = 2/348 (0%)

Query: 4   SYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSIN 63
           SYS +++ SFG  NW L+LQPL   N GLLTSLSNG +H +D  T   I ++     SI+
Sbjct: 2   SYSKLHTASFGCENWCLQLQPLY--NRGLLTSLSNGHIHLVDWCTGEIIHEFAAHSASIS 59

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTE 123
           +L+++N+  T+S LF +A+ +SVKIFD+ ++  VAT+H+  + PF SLDSRH +LACGTE
Sbjct: 60  NLKVLNNEFTNSDLFASASKDSVKIFDVRTSSCVATLHNDKSAPFLSLDSRHDMLACGTE 119

Query: 124 LKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
           L GVDA ++IYDI+K  +P+RS VDSHHDD+T  K+HP DP +L+SGSTDGY N+YDL+ 
Sbjct: 120 LSGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTN 179

Query: 184 AEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVR 243
           ++EED+LHQVINFAS+HSCGWL+PRRI+TLSHMETFAIHELNDKSD L+EP+P++ GDVR
Sbjct: 180 SDEEDALHQVINFASVHSCGWLAPRRIYTLSHMETFAIHELNDKSDDLREPKPVEFGDVR 239

Query: 244 EKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYI 303
           + WGCDY++++ PGFIA G+SQE QGELKLI   DE +D TN + IP AH DE+IRDV I
Sbjct: 240 QPWGCDYIININPGFIAAGRSQETQGELKLIAFNDEKVDTTNVLTIPQAHGDEIIRDVLI 299

Query: 304 PSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTLL 351
           P   + M+Y+CGEDG + +WK+  GPLN+    WDYSKR N+ EDT++
Sbjct: 300 PDQTTDMLYSCGEDGCLNIWKSQTGPLNISRDFWDYSKRFNVFEDTVV 347

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score =  452 bits (1164), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 208/349 (59%), Positives = 273/349 (78%), Gaps = 2/349 (0%)

Query: 2   SSSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETS 61
           S SYS + S  FG NNW LKLQP+   N+GLLTSLSNG V  +D +T  +I +     TS
Sbjct: 19  SMSYSKLESIEFGPNNWCLKLQPIY--NSGLLTSLSNGRVELIDWATHKSILQIQTHATS 76

Query: 62  INDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACG 121
           +ND+ +IN++  +  L  TA  ++VKI+D+ S   VAT+ +  + PF SLDSRHGLL CG
Sbjct: 77  VNDMVIINNDRMNGSLIATAAEDAVKIYDLKSNDCVATLKNGKSAPFLSLDSRHGLLGCG 136

Query: 122 TELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           TEL GVDA +++YDIR W QP+RSLVDSHHDD+T +K+HP+DPN+LLSGSTDGY N+YDL
Sbjct: 137 TELSGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDL 196

Query: 182 SEAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGD 241
           ++ EE+D+LHQVINFASIHSCGWLSP+RI+TLSHMET+ IHELNDK D   EP+P+D GD
Sbjct: 197 TQQEEDDALHQVINFASIHSCGWLSPKRIYTLSHMETYGIHELNDKRDEPTEPKPVDFGD 256

Query: 242 VREKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDV 301
           VR+ W C+YV+DVYPGFIATGKS+E +GELKLIPL  E  +L ++I IP AHDDEV+RDV
Sbjct: 257 VRKPWDCNYVIDVYPGFIATGKSEEGRGELKLIPLDHEKPELQSAITIPSAHDDEVVRDV 316

Query: 302 YIPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTL 350
            +P     ++Y+CGEDG++K+WK++ GPLNVP++ W YS+++++   T+
Sbjct: 317 LVPFQHEDLLYSCGEDGSLKVWKSSAGPLNVPQEFWQYSEKIDVFSGTV 365

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score =  450 bits (1157), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 209/346 (60%), Positives = 271/346 (78%), Gaps = 2/346 (0%)

Query: 4   SYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSIN 63
           SYSLV  +SFGS+NW LK QPL   N+GLLTSLSNGEV  LD  TL  ++ + I + SIN
Sbjct: 2   SYSLVQEQSFGSDNWCLKFQPLY--NHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN 59

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTE 123
            ++LIN++  ++ LF TAT NSVKI+DI S   +ATI +    PF SLDSRH +LACGTE
Sbjct: 60  SMKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTE 119

Query: 124 LKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
           L+GVDA +YIYD+R W  PV+S VDSHHDD+T +K+HP+D N LLSGSTDGYTNVYDL++
Sbjct: 120 LQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179

Query: 184 AEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVR 243
            EE+D+L+QVIN+ASIHSCGWLSPRRI+TLSHMETF+I ELND++D L+EPQP+D GD+R
Sbjct: 180 QEEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIR 239

Query: 244 EKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYI 303
           ++W CDYV+D+YPG+IATG+SQE  G L++IP+  ET++ + +I I  AH DEVIRDV+I
Sbjct: 240 DQWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFI 299

Query: 304 PSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDT 349
           P +   ++Y+CGEDG VK WK+ +      E+ WDYS+R N+ E +
Sbjct: 300 PRNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQS 345

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score =  447 bits (1150), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 214/345 (62%), Positives = 265/345 (76%), Gaps = 6/345 (1%)

Query: 8   VNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSINDLQL 67
           +N  SFGSNNW LK +PL   N GLLTSLSNGE+  LD  T     K  I ETSIND ++
Sbjct: 6   INLTSFGSNNWCLKFKPLY--NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEI 63

Query: 68  INHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGV 127
           +N+N     L  TAT+ SVKI+D+ S   + TI ++ N PF SLDS H ++ACGTEL GV
Sbjct: 64  VNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGV 123

Query: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEE 187
           DA +YIYDIR WD P+RS VDSHHDD+T +K+HPND  +L+SGSTDGYTN+YDL+E EEE
Sbjct: 124 DAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183

Query: 188 DSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVREKWG 247
           DSLHQVIN++SIHSCGWLS RRIFTLSHMETFAIH+LNDKS+ LKEP+PI+ GD+R  WG
Sbjct: 184 DSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWG 243

Query: 248 CDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLT--NSIVIPGAHDDEVIRDVYIPS 305
           C+YV+DVYPG+IATGK++E +G+LK+ P  +E IDL   N+I+IP AH DEVIRDV+I  
Sbjct: 244 CNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINP 303

Query: 306 HDSVMMYTCGEDGNVKLWK--NNNGPLNVPEQLWDYSKRVNMLED 348
           +D   MY+CGEDGNVKLWK       L +PE  +DYS R+N+L++
Sbjct: 304 NDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLRLNVLDE 348

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score =  444 bits (1142), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 207/349 (59%), Positives = 274/349 (78%), Gaps = 3/349 (0%)

Query: 3   SSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62
           S  S + S  FGS NW  ++QPL     G+LTSLSNGEVH +D  +  +I K+   ET+I
Sbjct: 2   SQCSQIGSYFFGSENWCFQIQPLYKA--GILTSLSNGEVHLMDWKSNKSINKFKSDETAI 59

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N LQ++N +  +   F TA+ ++VK+FD+ S   + TIH++   PF SLDSR+  +ACGT
Sbjct: 60  NALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGT 119

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           ELKGVDA ++I+D+RK D P +SLVDSHHDD+T +K+HP+D N+LLSGSTDGYTN+YDLS
Sbjct: 120 ELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179

Query: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242
           + EE+DSLHQVINF SIHSCGW++P+RI+TLSHMETFAIHELN+KSD L EPQP+D GD+
Sbjct: 180 QEEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDI 239

Query: 243 REKWGCDYVVDVYPGFIATGKSQER-QGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDV 301
           R  WGCDYVVD+YPG++ATGKS E  +GELKLIPL+ E + + N+I IP AH DEVIRDV
Sbjct: 240 RAAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDV 299

Query: 302 YIPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTL 350
           +IP  +S ++Y+CGEDG + +W+NN+GPLNVPE+ W+Y   +N+L+++L
Sbjct: 300 FIPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDESL 348

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score =  440 bits (1131), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 204/347 (58%), Positives = 264/347 (76%), Gaps = 2/347 (0%)

Query: 4   SYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSIN 63
           SYS V+S +FG++NW LKLQPL   N GLL SLSNG V  +D      I +     T+I+
Sbjct: 2   SYSKVDSINFGADNWCLKLQPLY--NRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTIS 59

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTE 123
           D+ ++N++  +  L  TA  +SVKIFD+ S+  VAT+ ++ + PF SLDSRHG+LACGTE
Sbjct: 60  DMVVLNNDRNNGFLIATAAEDSVKIFDLRSSDTVATLKNEKSAPFLSLDSRHGMLACGTE 119

Query: 124 LKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
           L GVDA ++IYD++ W QP+RSLVDSHHDD+T +K+HP DPN+LLSGSTDGY N+YDL++
Sbjct: 120 LSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQ 179

Query: 184 AEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVR 243
            EE+D+LHQVINFASIHS GW +P+RI+TLSHMETF IHELNDK +   EP P D GD+R
Sbjct: 180 PEEDDALHQVINFASIHSSGWCAPKRIYTLSHMETFGIHELNDKLEEPTEPHPKDFGDIR 239

Query: 244 EKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYI 303
           + WGCDYVVDVYPGFIATGKSQE QGE+KLIP   E +DL +++ IP AH DEV+RDV +
Sbjct: 240 QSWGCDYVVDVYPGFIATGKSQEGQGEVKLIPFTGEDLDLDSAVTIPSAHGDEVVRDVLV 299

Query: 304 PSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTL 350
           P     M+YTCGEDG V  WK+N GPLNVP++ W Y+ ++++   ++
Sbjct: 300 PFQHEDMLYTCGEDGCVNAWKSNRGPLNVPQEFWSYADQIDVFSGSV 346

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score =  433 bits (1113), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 199/357 (55%), Positives = 267/357 (74%), Gaps = 2/357 (0%)

Query: 3   SSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62
           +SYS ++++ FGS+NW L LQP    N+ LLTSLSNGEVH++D  T  +++      +SI
Sbjct: 2   ASYSNLHTQDFGSDNWCLGLQPFY--NHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSI 59

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N L++I+ N      +  A+++SV I D+ S  ++A++ +  N PF SLDSRHG+LACGT
Sbjct: 60  NKLKIIDSNFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLDSRHGMLACGT 119

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           EL GVDA ++IYD+R W  P+RS VDSHHDDVT +++HP+D N+LLSGSTDGYTNVYDL 
Sbjct: 120 ELSGVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLK 179

Query: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242
           + EE+D+LHQVIN+ASIHSCGWLSP+RIFTLSHMET A+HELNDKSD L+EPQP+D GD+
Sbjct: 180 QQEEDDALHQVINYASIHSCGWLSPKRIFTLSHMETLAMHELNDKSDELREPQPLDFGDI 239

Query: 243 REKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVY 302
           REKWGC YVVD+YPG++A G SQER   LKL+ L++E I+   S+VIP AH +EV+RDV 
Sbjct: 240 REKWGCSYVVDLYPGYVAVGSSQERSSFLKLMALENEQIETEKSLVIPSAHGEEVVRDVL 299

Query: 303 IPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTLLAPSEVVTA 359
           IP  +  M+Y+CGEDG VK+WK  +   ++    WDYSK++++  +    P  +  A
Sbjct: 300 IPPQNCNMLYSCGEDGTVKIWKTKDTGFHIEPGFWDYSKKMDVFSEEATTPEAIPAA 356

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score =  429 bits (1103), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 203/350 (58%), Positives = 268/350 (76%), Gaps = 4/350 (1%)

Query: 3   SSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62
           SSYSL++S S G  +W L+LQPL    +GLL+SLSNG+V+ LD +T   I+      TSI
Sbjct: 2   SSYSLLHSNSLGRTDWCLELQPLYR--HGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSI 59

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFD--IHSTKEVATIHSQGNVPFPSLDSRHGLLAC 120
           N +++++ +  +  +F+ A +++VK+ D  +     VA ++++   PF SLDSRHG+LAC
Sbjct: 60  NRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLAC 119

Query: 121 GTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180
           GTEL GVDA I+IYDIR +D+PVR LVDSHHDDVT +K+HP+DPN+LLSGSTDGYTNVYD
Sbjct: 120 GTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD 179

Query: 181 LSEAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMG 240
           L++ EEED+LHQVIN+ S+HSCGWLSP+RI+TLSHMETFAIHELN+KSD L EP+P+D G
Sbjct: 180 LTQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFG 239

Query: 241 DVREKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRD 300
           D+R  W CDYVVDVYPG+IA GKS+E  G LK+IP  +E +++ +SI IP AH DEV+RD
Sbjct: 240 DIRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRD 299

Query: 301 VYIPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTL 350
           V+I      +MY+CGEDG+VK WK  N  L VP   WDYS ++N+L+D +
Sbjct: 300 VFISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNI 349

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score =  429 bits (1104), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 198/348 (56%), Positives = 261/348 (75%), Gaps = 4/348 (1%)

Query: 4   SYSLVNSRSFGSNNWALKLQPL-QHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62
           S++    R F  NNW LKLQPL QHG   L+TS+S+G VH LD   L TI       TSI
Sbjct: 2   SFNKYKCRYFEENNWCLKLQPLYQHG---LMTSISDGSVHLLDWGNLKTISSIQCHTTSI 58

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           ND+++IN +  +  +F TA  + VK++DI +   VA++ +    PF SLDSRH +LACGT
Sbjct: 59  NDMKVINSDFDTGAVFATAAEDGVKVWDIRARNNVASLQNDKASPFFSLDSRHNMLACGT 118

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           ELK  DA ++IYDIR W +PVRS VDSHHDD+T +K+HP D N+L+SGSTDGY N+YDL+
Sbjct: 119 ELKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLT 178

Query: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242
           + +EED+LHQVINFASIHSCGWL P+RI++LSHMETF IHELNDKSD + EP+P++ GDV
Sbjct: 179 QDDEEDALHQVINFASIHSCGWLGPKRIWSLSHMETFGIHELNDKSDEMIEPKPLEFGDV 238

Query: 243 REKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVY 302
           R+KWGCDYV+D+YP FIATGK+ E QGELK+IP Q+E +D+++++VIP AH +EVIRDV 
Sbjct: 239 RDKWGCDYVIDIYPSFIATGKTHESQGELKIIPFQNEQVDVSSALVIPDAHGNEVIRDVL 298

Query: 303 IPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTL 350
           IP + + ++Y+CGEDG V +WK+    LNVP   WDY+      E+++
Sbjct: 299 IPKNQTSLLYSCGEDGYVNVWKDTTNSLNVPHNFWDYTLPFTAFENSV 346

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score =  422 bits (1084), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 199/345 (57%), Positives = 266/345 (77%), Gaps = 3/345 (0%)

Query: 4   SYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSIN 63
           SY+  ++ SFGS+NW LKLQPL   + GLL++LSNG VH +D ++LT+IQ   +  TSI+
Sbjct: 2   SYTKCDTISFGSDNWCLKLQPLY--SRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSIS 59

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTE 123
            L++++++  S   F TA+ +SVKIFD+   + VAT+ +  N PF SLDSRHG+LACGTE
Sbjct: 60  ALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTE 119

Query: 124 LKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
           L G DA I++YD++K D P+RS  DSHHDD+T +K+H +DP++LLSGSTDGY NVYDL +
Sbjct: 120 LSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ 179

Query: 184 AEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVR 243
            EEE++LHQVINFASIHSCGWLSP+RI+ LSHMETF+IHELNDKSD L EP+P++ GD+R
Sbjct: 180 QEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIR 239

Query: 244 EKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYI 303
           + W CDYVVD++PG I TG +QE Q  L+L+P  +E +D TNSI+IP AH DEV+RD  I
Sbjct: 240 KPWNCDYVVDIFPGCIITGSTQE-QSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALI 298

Query: 304 PSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLED 348
               S + Y+ GEDGN+ LWK+N G LNVP + W+Y +++N+L D
Sbjct: 299 HKTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHD 343

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score =  417 bits (1072), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 195/345 (56%), Positives = 254/345 (73%), Gaps = 2/345 (0%)

Query: 4   SYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSIN 63
           SY L    SFG++NW L+L+PL     G+L +LSNG VH +D +T  ++      E+SIN
Sbjct: 2   SYILQQKVSFGADNWCLRLRPLYQA--GVLAALSNGHVHLVDWATGKSVLDVAAHESSIN 59

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTE 123
            LQ+++       +F TA  + VK+FDI +   VAT+      P  SLDSRHG+LA GTE
Sbjct: 60  GLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTE 119

Query: 124 LKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
           L GVDA + ++ + +W +P+R+ VDSHHDDVT +K+HP D N+LLSGSTDGY NVYDL +
Sbjct: 120 LVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179

Query: 184 AEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVR 243
           +EE+++LHQVINFASIHSCGWLSP+RI++LSHMETFAIHELNDKS+   EPQP   GDVR
Sbjct: 180 SEEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVR 239

Query: 244 EKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYI 303
           E W CDYVVDVYPGFIA G ++E  GEL+L+PL+DE +D  N+IV+P AH DEV+RDV +
Sbjct: 240 EPWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLV 299

Query: 304 PSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLED 348
           P+    ++Y+ GEDGN+ +WK+  GPLNVP   WDYSK+  +LED
Sbjct: 300 PASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score =  406 bits (1043), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 192/346 (55%), Positives = 254/346 (73%), Gaps = 8/346 (2%)

Query: 5   YSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSIND 64
           YSL  S +FGSNNW LKLQP+   +NG+LTS+S+GEVH L    L+    + + ETSIN 
Sbjct: 2   YSLAGSCNFGSNNWCLKLQPV---HNGILTSVSSGEVHLLGLD-LSKQDSFKVGETSINA 57

Query: 65  LQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTEL 124
           L  ++       LF  +  N VK+FD+   KEVAT+  +      SL S HG+LA G+E 
Sbjct: 58  LSRVDGQEN---LFAASNGNKVKVFDLRENKEVATLEQENGANVLSLGSGHGMLAYGSEQ 114

Query: 125 KGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEA 184
           +GVDA ++++DIR W +PVRS VDSH DD+T + +HP D N+LLSGSTDGYTNVYDL E 
Sbjct: 115 QGVDAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLEP 174

Query: 185 EEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVRE 244
           EEED+LHQVIN+ASIHSCGWL+PRRIFTLSHMETFAIHELNDKS+ L+EPQP+D GD+R+
Sbjct: 175 EEEDALHQVINYASIHSCGWLAPRRIFTLSHMETFAIHELNDKSEELREPQPLDFGDIRQ 234

Query: 245 KWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIP 304
            W C+YVVD+YPG+I+ G S+E +G L++IP ++E +   ++I I  AH DE++RD YI 
Sbjct: 235 PWDCNYVVDIYPGYISAGVSEEGKGALRIIPFRNEHVQAKDTITISQAHGDEIVRDTYIL 294

Query: 305 SHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTL 350
              S M+Y+CGEDG VK W+N+   L++PE  WDYS ++++L D +
Sbjct: 295 PSQSDMLYSCGEDGQVKAWRNDI-KLDIPETFWDYSTKMSLLSDEV 339

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score =  395 bits (1014), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 189/352 (53%), Positives = 266/352 (75%), Gaps = 9/352 (2%)

Query: 4   SYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSIN 63
           S  LVN  +FG++NW L+L+PL   + GLL S SNG V+ +D ++ + I+K+ + ET+IN
Sbjct: 2   SAKLVNQITFGNDNWCLELKPLY--SRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNIN 59

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKE-VATIHSQGNVPFPSLDSRHGLLACGT 122
            L++IN++  +  +F   +  SVKI+D+ +    VATI +  N  F SL+SRH +L CGT
Sbjct: 60  SLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGT 119

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           EL GVDA ++IYD+R + +PVR+ VDSHHDD+T +K+HP+D NILLSGSTDGYTN+YDL+
Sbjct: 120 ELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179

Query: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242
           + +E+++LHQVIN+ASIHSCGWLSP+RI+TLSHMETFAIHELNDKSD L EP+P+D GD+
Sbjct: 180 QEDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDI 239

Query: 243 REKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVY 302
           R +W CDYVVD+YPG++A GKS E  GELK+   ++E ++  N I+IP AH DEVIRDV+
Sbjct: 240 RGQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVF 299

Query: 303 IP----SHDSVMMYTCGEDGNVKLWK--NNNGPLNVPEQLWDYSKRVNMLED 348
           IP    ++ S ++Y+CGEDGNV +W     +  LNV +  W+ ++++++L D
Sbjct: 300 IPPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSD 351

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 89/181 (49%), Gaps = 17/181 (9%)

Query: 16  NNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTT--IQKY-NISETSINDLQLINHNP 72
           N + L   PL  G+  LL+   +  V   D ++     +QK+ NI    +ND Q   HN 
Sbjct: 178 NGYGLAFNPLIKGH--LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQW--HNF 233

Query: 73  TSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRH---GLLACGTELKGVDA 129
             S   T +  +S++I D   +K VATI+  G  PF +L   H    LLA G    GV++
Sbjct: 234 QKSLFGTVSEDSSLQIHDTRESKPVATIN--GTKPFNTLSFSHHSENLLATG----GVNS 287

Query: 130 AIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDS 189
            +Y+YD R  ++P+  L+  H D VT L +   D  I+LS   D    ++D+++   E  
Sbjct: 288 EVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQV 346

Query: 190 L 190
           L
Sbjct: 347 L 347

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 150 HHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSL 190
           H  +VT  ++ P DPNIL + S  G   +YD S   +  S+
Sbjct: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASI 170

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 77  LFTTATSNS-VKIFDIHSTKEVATIHSQGNVPFPSLD-SRHG--LLACGTELKGVDAAIY 132
           LF + + +S +K+ D  ST +V     Q    F +L  S+H   L A      G+D  IY
Sbjct: 214 LFGSVSEDSTLKLHDKRSTSKVINT-IQAKAAFNTLAFSKHSANLFAAA----GLDTNIY 268

Query: 133 IYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEE 187
           +YD R+  +P+  +   H D +TCL++HP +  IL+SG  D    ++DL+E   E
Sbjct: 269 LYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAE 322

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 113/248 (45%), Gaps = 31/248 (12%)

Query: 16  NNWALKLQPLQHGNNGLLTSLSNGEVHYLDPST---LTTIQKYNISETSINDLQLINHNP 72
           N + L   PL  G   LL+S  +G V Y +      L T+Q+ +I    IND++    N 
Sbjct: 171 NGYGLAFNPLDKGK--LLSSSDDGSVAYWNIQKSIPLLTLQETSI----INDVRW---NQ 221

Query: 73  TSSPLFTTATSNS-VKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTEL---KGVD 128
            +  LF   T +S + + D+ +      I S  ++  PS  +          L    G D
Sbjct: 222 FNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGED 281

Query: 129 AAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEED 188
           + IY+YD R  +QP+  +   H D VT L +H  +  I++SG +D    V+DL +  +E 
Sbjct: 282 SLIYLYDTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQ 340

Query: 189 SLHQVIN-----FASIHSCGWLSPRRIFTLSH--------METFAIHELNDKSDTLKEPQ 235
           +  ++ +        IH  G  SP   F++S+        +E   I ++   +++L+E  
Sbjct: 341 TSDEIEDGDVPELLMIH-AGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLREDP 399

Query: 236 PIDMGDVR 243
            ++M  +R
Sbjct: 400 LVNMNVIR 407

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 83/174 (47%), Gaps = 28/174 (16%)

Query: 32  LLTSLSNGEVHYLDPSTLTTIQKYNI-SETSINDLQLINHNPTSSP-----------LFT 79
           L TS S+G+V   D      ++KY+  S T IN L +   +P  S            L  
Sbjct: 209 LATSYSHGQVCVWD------LEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHDSLLAY 262

Query: 80  TATSNSVKIFDIHSTKEVATI----HSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYD 135
            +  N V I DI + ++  +     H    +     +    +L C  +  G    I ++D
Sbjct: 263 CSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAG---RINLWD 319

Query: 136 IRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTD-GYTNVYDLSEAEEED 188
           IR + QP+++L+  H+D ++ L+W+P +P +L +G  D G   ++DLS+ E ++
Sbjct: 320 IRNFTQPLKTLL--HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQE 371

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 13/127 (10%)

Query: 67  LINHNPTSSPLFTTATSNSVKIFDIHSTKE----VATIHSQGNVPFPSLDSRHGLLACGT 122
           ++NH+   S L      N++ + D   TK+     +  H    V     +    LL C  
Sbjct: 253 MVNHD---SLLAYCGEGNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYKDLLLCSA 309

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILL-SGSTDGYTNVYDL 181
           +  G    I ++DIR +  P+RSL   HH  V+ L+W+P+ P IL  +G  DG   ++DL
Sbjct: 310 DSAG---RINLWDIRDFSSPIRSL--DHHGSVSALQWNPHHPTILATAGQDDGLVKIWDL 364

Query: 182 SEAEEED 188
           S+  +++
Sbjct: 365 SQPVDQE 371

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (56%), Gaps = 6/93 (6%)

Query: 126 GVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL---- 181
           G D+ + +YD+RK + P+ S+   HHD VT L++ P+   IL SGS+D    ++DL    
Sbjct: 268 GTDSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIG 326

Query: 182 SEAEEEDSLHQVINFASIHSCGWLSPRRIFTLS 214
           +E ++ED+   V     +H+ G  SP   F+ S
Sbjct: 327 AEQQQEDADDGVPELLMMHA-GHKSPVNDFSCS 358

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 95/206 (46%), Gaps = 20/206 (9%)

Query: 16  NNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTI---QKYNISETSINDLQLINHNP 72
           N + L   P   G   LL++  +G V   D ++       Q +++    +ND +   H  
Sbjct: 171 NGYGLAFNPTVSGQ--LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKW--HEF 226

Query: 73  TSSPLFTTATSNSVKIFDIHSTKEVA--TIHSQGNVPFPSLDSRHGLLACGTELKGVDAA 130
            SS   T +  N++ I D +S + +   ++ S  N    S  S + L A GT     D+ 
Sbjct: 227 QSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGT-----DSN 281

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL----SEAEE 186
           +Y+YD+R+  +P+ S+   H D VT L++ P+   +L S  +D    ++DL    +E + 
Sbjct: 282 VYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQP 340

Query: 187 EDSLHQVINFASIHSCGWLSPRRIFT 212
           +D+   V     +H  G  SP   F+
Sbjct: 341 DDAYDGVPELFMMHG-GHRSPVNEFS 365

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%), Gaps = 20/171 (11%)

Query: 32  LLTSLSNGEVHYLDPSTL-TTIQKYNISE-------TSINDLQ-LINHNPTSSPLFTTAT 82
           L T  SNG+V   D +    + Q+  I E         +ND+  ++NH   +S L +   
Sbjct: 201 LATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNH---TSILASCGE 257

Query: 83  SNSVKIFDIHSTKEVATIHSQGN---VPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKW 139
           SN + + DI    ++ T+H   +   +     + ++ ++ C  + +G    + I+DIR +
Sbjct: 258 SNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQG---QLKIWDIRDF 314

Query: 140 DQPVRSLVDSHHDDVTCLKWHPNDPNILLSG-STDGYTNVYDLSEAEEEDS 189
            +P++       D ++ ++W+P  P IL +     G   ++D S  E+EDS
Sbjct: 315 KEPIKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWDAS-GEQEDS 364

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 68/135 (50%), Gaps = 12/135 (8%)

Query: 62  INDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQ---GNVPFPSLDSRHGLL 118
           IND++   H+  +    + +  +++K+FD  S++ +  I+++     + F    S   L 
Sbjct: 230 INDVKW--HSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSS--NLF 285

Query: 119 ACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNV 178
           A      G D  +Y+YDIR    P+ ++   H D VT +++ PN+  IL S  +D  T V
Sbjct: 286 AAA----GTDNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIV 340

Query: 179 YDLSEAEEEDSLHQV 193
           +DL E   E +  ++
Sbjct: 341 WDLQEIGAEQTQDEI 355

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 128 DAAIYIYDIRKWDQ---PVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180
           D+ I ++DI  +++   P  +  D+H D +  +KWH ++ +I  S S D    ++D
Sbjct: 201 DSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 81/187 (43%), Gaps = 24/187 (12%)

Query: 19  ALKLQPLQHGNNGLLTSLSNGEVHYLD---------PSTLTTIQKYNISETSINDLQLIN 69
           ++   P Q G   LL+  SNG +H  D              TI   N  +   N++  +N
Sbjct: 200 SIAWNPQQEGQ--LLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLGCNEVTWMN 257

Query: 70  -HNPTSSPLFTTATSNSVKIFDIHSTKEVATIHS---QGNVPFPSLDSRHGLLACGTELK 125
            HN   S   T   +N + +FD      V +I      G +     +  + +L    +  
Sbjct: 258 GHN---SIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLLASGDSN 314

Query: 126 GVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGST-DGYTNVYDLSEA 184
           G+   I ++DIRK ++P+R+L   H   ++ ++W P    ++ SG   DG   ++D+S  
Sbjct: 315 GI---INLWDIRKLNKPIRNLY--HGSSISTIEWSPLMNEMIASGGQEDGLVKLWDISNE 369

Query: 185 EEEDSLH 191
           EE   +H
Sbjct: 370 EEPIFIH 376

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 8/110 (7%)

Query: 77  LFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLD-SRHG--LLACGTELKGVDAAIYI 133
           +F + + +S         ++ A    Q   P+ +L  S H   L A      G D+ +Y+
Sbjct: 215 IFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA----GTDSMVYL 270

Query: 134 YDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
           YD R+  +P+  ++  H D VT L++HP +  +L+S  +D  T ++DL+E
Sbjct: 271 YDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 116 GLLACGTELKGVDAAIYIYDIR-KWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDG 174
           G L  G++    D+ I ++D+  K  +P+ +  D H D V   KWH  D NI  S S D 
Sbjct: 168 GKLLSGSD----DSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDS 223

Query: 175 YTNVYD 180
              ++D
Sbjct: 224 TLQLHD 229

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 101/210 (48%), Gaps = 28/210 (13%)

Query: 18  WALKLQPLQHGNNGLLTSLSNGEVHYLDPST---LTTIQKYNISET-SINDLQLINHNPT 73
           +AL   PL   +  LLT   +G+V++    T   +T  Q + +S   SI D+Q    + T
Sbjct: 282 YALDWSPLIR-SGALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQW---SRT 337

Query: 74  SSPLFTTATSNS-VKIFDIHSTK---EVATIHSQGNVPFPSLDSRHG-LLACGTELKGVD 128
            + +F TA  +  ++++D  S K    ++T  S  +V   S + + G LLA G +    +
Sbjct: 338 EATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDD----N 393

Query: 129 AAIYIYDIRKWD------QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
               ++D+R++       QPV +  D H   +T + +HP D +I+   S D    ++DLS
Sbjct: 394 GTWGVWDLRQFSPSNENAQPV-AQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLS 452

Query: 183 -EAEEEDSLHQVINFASIHSCGWLSPRRIF 211
            EA++E+   Q    A       + P+ +F
Sbjct: 453 VEADDEEIKQQT---AETKELAQIPPQLLF 479

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 79/171 (46%), Gaps = 21/171 (12%)

Query: 32  LLTSLSNGEVHYLDPSTLTTIQ--------KYNISETSINDLQLINHNPTSSPLFTTATS 83
           L  S S+G+V   D +     Q        ++ + +   N++  + H+  SS L      
Sbjct: 205 LAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQVDKEGANEVSWMVHH--SSILAVCGEG 262

Query: 84  NSVKIFDIHSTKEVATI-HS--QGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWD 140
           N + I D  +    +T  HS   G +     +  +  L C  + +G    + I DIR+ +
Sbjct: 263 NGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGT---LNICDIRQLE 319

Query: 141 QPVRSLVDSHHDDVTCLKWHPNDPNILLS-GSTDGYTNVYDLSEAEEEDSL 190
            PV++   SH D V+ ++W+P  P ++ S G  DG   ++DL  A+E+D L
Sbjct: 320 HPVKTW--SHLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDL--AQEDDPL 366

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 81/178 (45%), Gaps = 34/178 (19%)

Query: 32  LLTSLSNGEVHYLDPSTLTTIQKYNISETSI--------------NDLQLINHNPTSSPL 77
           + +S SNG +   D      I +Y  S+ +I              ND+  + H+  SS L
Sbjct: 209 IASSYSNGLIKVWD------ITRYQKSQPTISNPELRILQDKAGTNDVSWMVHH--SSIL 260

Query: 78  FTTATSNSVKIFDIHSTKEV----ATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYI 133
                SN++ + D  +        A+ H+ G +     +  + +L C  +  G    I +
Sbjct: 261 AACGESNTIGLLDTRAPDAFKPTKASPHT-GGINALQFNYANDMLLCAADSNG---GIAL 316

Query: 134 YDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILL-SGSTDGYTNVYDLSEAEEEDSL 190
           +D R + +P+   V +H D V+ L+W+PN P I+  +G  DG   ++D S  E EDSL
Sbjct: 317 WDCRAFSKPLS--VFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIWDTSR-EPEDSL 371

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (48%), Gaps = 13/123 (10%)

Query: 87  KIFDIHSTKEVATIHSQG-NVPFPSLD-SRHG--LLACGTELKGVDAAIYIYDIRKWDQP 142
           K   IH  +  +T+H    + PF +LD S+H   L A      G D+ +Y+YD+R     
Sbjct: 229 KTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAA----GTDSLVYLYDLRNTADA 284

Query: 143 VRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL----SEAEEEDSLHQVINFAS 198
           + ++   H D VT L++ P+   IL S  +D    ++DL    SE  +ED+   V     
Sbjct: 285 LHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMM 343

Query: 199 IHS 201
           +H+
Sbjct: 344 MHA 346

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 63/133 (47%), Gaps = 8/133 (6%)

Query: 49  LTTIQKYNISETSINDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPF 108
           + T Q+  + E    ++  ++  P  + + +    +   ++D+ S K + T+      P 
Sbjct: 295 VETAQELQLQEGHSKEVYSLSFQPDGALICSGGLDSLAMVWDLRSGKNIVTLQGHAK-PV 353

Query: 109 PSLD--SRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNI 166
             +D  S    LA G    G D  + ++D+RK +QP   L+ +H   V+ L++  N  ++
Sbjct: 354 YCVDWSSNSHQLATG----GGDGVVNVWDLRKLEQPATKLL-AHKSIVSSLRFERNRGDV 408

Query: 167 LLSGSTDGYTNVY 179
           L+SG  D   NVY
Sbjct: 409 LVSGGYDRALNVY 421

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 50/115 (43%), Gaps = 6/115 (5%)

Query: 72  PTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAI 131
           P+   + + +   + +++D+ + +E+          +       G L C     G+D+  
Sbjct: 276 PSDKYVASASFDTTWRLWDVETAQELQLQEGHSKEVYSLSFQPDGALICSG---GLDSLA 332

Query: 132 YIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
            ++D+R     V   +  H   V C+ W  N  + L +G  DG  NV+DL + E+
Sbjct: 333 MVWDLRSGKNIV--TLQGHAKPVYCVDWSSN-SHQLATGGGDGVVNVWDLRKLEQ 384

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 102/212 (48%), Gaps = 25/212 (11%)

Query: 3   SSYSLVNSRSFGSNN-WALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTT--IQKYNISE 59
           SS S V + S+  +N + L   P+  G   LL++  +G +   D +  +   ++ +  ++
Sbjct: 139 SSDSPVKTYSYHKDNGYGLSFNPISKGQ--LLSAADDGYIAMYDINAESEDPVETWQSTD 196

Query: 60  TSI-NDLQLINHNPTSSPLFTTAT--SNSVKIFDIHSTKEVATIHSQGNVPFPSLD-SRH 115
             I ND++  + + T   LF T +   N++ I+D+ +  +V +I  +   PF SL  S+H
Sbjct: 197 NCIINDIKWHHFDAT---LFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ--PFNSLAFSKH 251

Query: 116 G--LLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTD 173
              L +      G D  +Y+YD+R   + + S+   H   VT L++H +   IL+S S D
Sbjct: 252 SKNLFSAA----GTDQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSED 306

Query: 174 GYTNVYDL----SEAEEEDSLHQVINFASIHS 201
               ++DL    SE   ED+         IH+
Sbjct: 307 RRIIIWDLMEIGSEQVNEDAQDATPELMMIHA 338

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%), Gaps = 9/118 (7%)

Query: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEE 187
           +  + I+D    D PV++    H D+   L ++P     LLS + DGY  +YD++ AE E
Sbjct: 129 NGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDIN-AESE 186

Query: 188 DSLH--QVINFASIHSCGW--LSPRRIFTLSHME-TFAIHEL--NDKSDTLKEPQPID 238
           D +   Q  +   I+   W         T+S  + T +I++L   DK  +++  QP +
Sbjct: 187 DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFN 244

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 68/132 (51%), Gaps = 14/132 (10%)

Query: 62  INDLQLINHNPTSSPLFTT-ATSNSVKIFDIHSTKEVATI---HSQGNVPFPSLDSRHGL 117
           +ND+  +   P+   LF     S+++ +FD    KEV+ I      G V     + ++ +
Sbjct: 246 VNDVSWM---PSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNM 302

Query: 118 LACGTELKGVDAAIYIYDIRKWDQ-PVRSLVDSHHDDVTCLKWHPN-DPNILLSGSTDGY 175
           L    + +G+   + ++DIR  DQ P++S+  +H   ++ ++W+PN D  I  +G  DG 
Sbjct: 303 LLASADSEGL---VNMWDIRNLDQYPIKSI--NHGSSISTIEWNPNLDTIIATAGQNDGL 357

Query: 176 TNVYDLSEAEEE 187
             ++D+S  + E
Sbjct: 358 VKLWDVSNTDNE 369

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 8/86 (9%)

Query: 107 PFPSLD-SRHG--LLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPND 163
           PF +L  S+H   LLA      GVD+ IY+YD+R    P+  ++  H D VT +++ P+ 
Sbjct: 275 PFNTLSFSKHSRNLLAAA----GVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHT 329

Query: 164 PNILLSGSTDGYTNVYDLSEAEEEDS 189
             I+ S  +D    ++DL++   E S
Sbjct: 330 DGIICSSGSDRRAIIWDLTQIGAEQS 355

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 116 GLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGY 175
           G L  G++    D  + ++DI    +P +S++ SH D V  +KWH  + N+  + S D  
Sbjct: 200 GELLSGSD----DTTVALWDIEAAKKP-KSILTSHDDIVNDVKWHEFESNVFGTVSEDKT 254

Query: 176 TNVYD 180
             V+D
Sbjct: 255 LQVHD 259

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 91/198 (45%), Gaps = 38/198 (19%)

Query: 11  RSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSINDLQL--- 67
            +F ++N A+ +      N  L +S S G +   D      I KY+ S+ ++ + +L   
Sbjct: 183 ENFTNSNEAVSIAWNLQKNGTLASSYSQGSIKIWD------ITKYSCSDPTLRENELTIP 236

Query: 68  ------------INHNPTSSPLFTTATSNSVKIFDIHSTKEVATI------HSQGNVPFP 109
                       +NH+   S     + SN + +FD+ + +E+  +      HS G +   
Sbjct: 237 FDPEGCNEVTWMVNHD---SIFAACSESNKLSLFDVRTKEEMLKMTENIGTHS-GGINSC 292

Query: 110 SLDSRHGLLACGTELKGVDAAIYIYDIRKWD-QPVRSLVDSHHDDVTCLKWHPNDPNILL 168
             +  + +L    +  G    I ++DIRK D +P++S   +H+  ++ L+W+PN   IL+
Sbjct: 293 KFNYYNDMLLASADSTG---KINMWDIRKLDKEPIKSF--NHNSSISTLEWNPNLETILV 347

Query: 169 -SGSTDGYTNVYDLSEAE 185
            +G  DG   ++D +  +
Sbjct: 348 TAGQDDGLVKIWDTANGQ 365

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 90/184 (48%), Gaps = 22/184 (11%)

Query: 16  NNWALKLQPLQHGNNGLLTSLSNGEVHYLDPS----TLTTIQKYN-ISETSINDLQLINH 70
           N +AL   PL  G+  LL+   +  V   D S    + T I+ ++ +    +ND +  N 
Sbjct: 162 NGYALSFSPLIKGH--LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNF 219

Query: 71  NPTSSPLFTTATSNSV-KIFDIHSTKEVATIH-SQGNVPFPSLDSRH---GLLACGTELK 125
           N     LF T + +S+ KI DI +  E  TI  ++   PF +L   H    +LA      
Sbjct: 220 N---KDLFGTVSEDSLLKINDIRA--ENTTIDTAKCPQPFNTLAFSHHSSNILAAA---- 270

Query: 126 GVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAE 185
           G+D+ +Y+YD+R   +P+  +   H D VT L++ P+   +++S  +D    ++DL +  
Sbjct: 271 GMDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIG 329

Query: 186 EEDS 189
            E +
Sbjct: 330 AEQT 333

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 76/185 (41%), Gaps = 21/185 (11%)

Query: 9   NSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLD--------PSTLTTIQKYNISET 60
           NS+S    N AL +         L+ + S+G V   D        P        Y + E+
Sbjct: 189 NSQSLNGENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDES 248

Query: 61  SINDLQLINHNPTSSPLFTTATS-NSVKIFDIHSTKEVATIHS---QGNVPFPSLDSRHG 116
             ND   +   P  + LF   +  N + +FD      +  I +   +G +     + R+ 
Sbjct: 249 GCNDAVWM---PEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNS 305

Query: 117 LLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLS-GSTDGY 175
           LL    +  G    I ++DIRK + P+  L   H   ++ ++W+PN   +L S G  DG 
Sbjct: 306 LLLASGDSIG---NICLWDIRKKETPINIL--DHGSSISTIEWNPNLSTVLASAGQDDGL 360

Query: 176 TNVYD 180
             ++D
Sbjct: 361 VKLWD 365

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 95/202 (47%), Gaps = 27/202 (13%)

Query: 6   SLVNSRSFGSNNWALKLQPLQHGNNGLLTSL-SNGEVHYLD-------PSTLTTIQKYNI 57
           ++ ++  FGS++ ++K        + +L S  +NGE+   D       PST T +     
Sbjct: 97  TISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIWDMNKCTESPSTYTPLTPGQ- 155

Query: 58  SETSINDLQLINHNPTSSPLFTTA-TSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHG 116
           S +S++++  +  N + + +F +A +SN   I+D+ + KEV  IH     P   +  +  
Sbjct: 156 SMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEV--IHLSYTSPSSGIKQQLS 213

Query: 117 LL------------ACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDP 164
           ++            A G++    D +I ++D+R  + P+++L   H   +  L W   D 
Sbjct: 214 VVEWHPKNSTRVATATGSD---NDPSILVWDLRNANTPMQTLNQGHQKGILSLDWCDQDE 270

Query: 165 NILLSGSTDGYTNVYDLSEAEE 186
           N+LLS   D    +++   AE+
Sbjct: 271 NLLLSSGRDNTVLLWNPESAEQ 292

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 98/211 (46%), Gaps = 29/211 (13%)

Query: 18  WALKLQPLQHGNNGLLTSLSNGEVHYLDPST---LTTIQKYNISET-SINDLQLINHNPT 73
           +AL   PL      LLT   +G++++    T   +T  Q + ++   SI D+Q    + T
Sbjct: 277 YALDWSPLTK-TGALLTGDCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQW---SRT 332

Query: 74  SSPLFTTATSNS-VKIFDIHSTKEVATIH---SQGNVPFPSLDSRHG-LLACGTELKGVD 128
            S +F +A  +  ++I+D  S K    I    S  +V   S   + G LLA G +    +
Sbjct: 333 ESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDD----N 388

Query: 129 AAIYIYDIRKWD-------QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
               ++D+R++        QPV +  D H   +T + ++P D +I+  GS D    ++DL
Sbjct: 389 GTWGVWDLRQFSPENAGSVQPV-AQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDL 447

Query: 182 S-EAEEEDSLHQVINFASIHSCGWLSPRRIF 211
           S EA++E+   Q      +     + P+ +F
Sbjct: 448 SVEADDEEIKQQAAETKELQQ---IPPQLLF 475

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 60/115 (52%), Gaps = 9/115 (7%)

Query: 75  SPLFTTATSNSVKIFDIHSTKEVATIHS---QGNVPFPSLDSRHGLLACGTELKGVDAAI 131
           S L     SN + I+DI  ++E  TI S   +  +     +  + L+    +  G    +
Sbjct: 262 SLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASADTVG---NV 318

Query: 132 YIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILL-SGSTDGYTNVYDLSEAE 185
           +I+DIRK ++ V+++   H   ++ ++W+PN   IL  +G  DG   ++D++++E
Sbjct: 319 HIWDIRKSNEIVKTI--PHGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTDSE 371

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 86/178 (48%), Gaps = 24/178 (13%)

Query: 31  GLLTSLSNGEVHYLDPST---LTTIQKYNISET-SINDLQLINHNPTSSPLF-TTATSNS 85
            LLT   +G++      T   +T  Q +  +   S+ D+Q    +PT S +F T+ T   
Sbjct: 294 ALLTGDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQW---SPTESTVFATSGTDGY 350

Query: 86  VKIFDIHSTK---EVATIHSQGNVPFPSLDSRHG-LLACGTELKGVDAAIYIYDIRKWD- 140
           V+I+D  S K    ++T  S  +V   S + + G LLA G +    + +  ++D+R++  
Sbjct: 351 VRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDD----NGSWGVWDLRQFSP 406

Query: 141 ------QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQ 192
                 QPV +  D H   +T + ++P D +++   S D    ++DLS   ++D + Q
Sbjct: 407 ANSEGVQPV-AQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVEADDDEIQQ 463

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 48/115 (41%), Gaps = 4/115 (3%)

Query: 93  STKEVATIHSQGNVPFPSLDSRHGLLACGTELKG-VDAAIYIYD--IRKWDQPVRSLVDS 149
           S K + TI + GNV    LD    L+  G  L G     I++      KW    +    +
Sbjct: 266 SRKAIHTIRNHGNVEGYGLD-WSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAA 324

Query: 150 HHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVINFASIHSCGW 204
           ++  V  ++W P +  +  +  TDGY  ++D    + + ++    +   ++   W
Sbjct: 325 NNQSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISW 379

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 83/178 (46%), Gaps = 26/178 (14%)

Query: 29  NNGLLTSLSNGEVHYLD-------PSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTA 81
           +N L +  +NGE+   D       PS+ T +     S +S++++  +  N + + +F +A
Sbjct: 121 DNVLASGGNNGEIFIWDMNKCTESPSSYTPLTPGQ-SMSSVDEVNSLAWNQSLAHVFASA 179

Query: 82  -TSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLL------------ACGTELKGVD 128
            +SN   I+D+ + KEV  IH     P   +  +  ++            A G++    D
Sbjct: 180 GSSNFASIWDLKAKKEV--IHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSD---ND 234

Query: 129 AAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
            +I ++D+R  + P+++L   H   +  L W   D N+LLS   D    +++   AEE
Sbjct: 235 PSILVWDLRNANTPLQTLSQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWNPESAEE 292

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 82/175 (46%), Gaps = 24/175 (13%)

Query: 30  NGLLTSLSNGEVHYLDPSTLTTIQKYN-----ISETSINDLQLINHNPTSSPLFTTATSN 84
           N L++  S GE++  D + + T Q Y+     ++ T I ++Q +  N T + +F +A S+
Sbjct: 118 NVLVSGGSQGEIYVWDTNKIAT-QGYSPFGPGVAMTPIEEVQSLAWNQTLAHVFASAGSS 176

Query: 85  S-VKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLL------------ACGTELKGVDAAI 131
               I+D+ + KEV  IH     P   L ++  ++            A G + + V   I
Sbjct: 177 GFASIWDLKAKKEV--IHLSYTSPTSGLKNQLSVVEWHPSNSTKVATATGNDNEPV---I 231

Query: 132 YIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
            ++D+R  + P++ L   H   +  L W   D  +++S   D    +++  EA++
Sbjct: 232 LVWDLRNSNAPLKVLSQGHSKGILSLDWCQQDDKLMISSGRDNTCILWNPEEAQK 286

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 65/132 (49%), Gaps = 13/132 (9%)

Query: 62  INDLQLINHNPTSSPLFTTATSNSV-KIFDIHSTKEVATIHSQGNVPFPSLDSRH---GL 117
           +ND +  N N     LF T + +S+ KI D+   +   T  ++   PF +L   H    L
Sbjct: 211 VNDSKWHNFN---KDLFGTVSEDSLLKINDLR-VENTTTGTAKCPEPFNTLAFSHHSSNL 266

Query: 118 LACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTN 177
           LA      G D+ +Y+YD+R   +P+  +   H D VT L++ P+   +++S  +D    
Sbjct: 267 LAAA----GTDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLI 321

Query: 178 VYDLSEAEEEDS 189
           ++DL +   E +
Sbjct: 322 MWDLKQIGAEQT 333

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 93/198 (46%), Gaps = 28/198 (14%)

Query: 31  GLLTSLSNGEVHYLDPST---LTTIQKYNISE-TSINDLQLINHNPTSSPLFTTATSNS- 85
            LL+   +G++++    T   +T  Q + +S   SI D+Q    + T S +F TA  +  
Sbjct: 289 ALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQW---SRTESTVFATAGCDGY 345

Query: 86  VKIFDIHSTKEVATIH---SQGNVPFPSLDSRHG-LLACGTELKGVDAAIYIYDIRKWD- 140
           ++I+D  S K    I    S  +V   S   + G LLA G +    +    ++D+R++  
Sbjct: 346 IRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGTWGVWDLRQFTP 401

Query: 141 ------QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS-EAEEEDSLHQV 193
                 QPV +  D H   +T + ++P D +I+  GS D    ++DLS EA++E+   Q 
Sbjct: 402 SNADAVQPV-AQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQA 460

Query: 194 INFASIHSCGWLSPRRIF 211
                +     + P+ +F
Sbjct: 461 AETKELQE---IPPQLLF 475

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 85/188 (45%), Gaps = 23/188 (12%)

Query: 11  RSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKY------NISETSIND 64
           R    N + L   P   G   LL+   +G +   D    +T+ K       ++    +ND
Sbjct: 193 RFHKENGYGLSFNPNDKGK--LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVND 250

Query: 65  LQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHS--QGNVPFPSLD-SRHG--LLA 119
            +    N  +S +F + + +S     +H  +E  TI +  +   PF +L  S+H   L+A
Sbjct: 251 CKW---NEFNSNVFASVSEDST--LQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMA 305

Query: 120 CGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVY 179
                 G D+ +Y+YD R    P+ S+ + H D +T L++ P+   +L+S   D    ++
Sbjct: 306 AA----GTDSLVYLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDRRVIMW 360

Query: 180 DLSEAEEE 187
           D+++   E
Sbjct: 361 DINDIGAE 368

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 97/233 (41%), Gaps = 36/233 (15%)

Query: 129 AAIYIYDIRKWDQ-PVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE---- 183
             ++IY+     Q  + S +  H ++   L ++PND   LLSGS DG   ++D+ E    
Sbjct: 173 GTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTL 232

Query: 184 AEEE----DSLHQVINFASIHSCGW--LSPRRIFTLSHMETFAIHELNDKSDTLKEPQPI 237
           A++     DS+H  I    ++ C W   +     ++S   T  +H+  +++  +   +  
Sbjct: 233 AKKPLKIWDSVHNDI----VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIK-- 286

Query: 238 DMGDVREKWGCDYVVDVYPGFIATGKSQ---ERQGELKLIPLQDETIDLTNSIVIPGAHD 294
                          D +     +  SQ      G   L+ L D + +L+  +     H+
Sbjct: 287 -------------TTDPFNTLAFSKHSQYLMAAAGTDSLVYLYD-SRNLSVPLYSMNGHE 332

Query: 295 DEVIRDVYIPSHDSVMMYTCGEDGNVKLWK-NNNGPLNVPEQLWDYSKRVNML 346
           D +    + P  D V++ + G D  V +W  N+ G   +P+   D +  V M+
Sbjct: 333 DSITNLEFSPHTDGVLI-SSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMI 384

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 81/185 (43%), Gaps = 26/185 (14%)

Query: 20  LKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI-----NDLQLINHNPTS 74
           L+  P Q   N L ++ +NGE+   D +   +   Y+ S   I     ++++ ++ N + 
Sbjct: 119 LRFNPKQQ--NVLASAGNNGEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSL 176

Query: 75  SPLFTTA--TSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLL------------AC 120
           + +F +A  T+    I+D+ + KEV  IH     P   L     ++            A 
Sbjct: 177 AHVFASAGDTTTYASIWDLKAKKEV--IHLNYTSPKTGLKPNLAVVEWHPKVTTYVATAS 234

Query: 121 GTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180
           G++    D  I I+D+R  + P+ +L   H   +  L W   D ++LLS   DG   ++D
Sbjct: 235 GSD---SDPVILIWDLRNSNMPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWD 291

Query: 181 LSEAE 185
               E
Sbjct: 292 TKANE 296

>Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,
           581 aa] {ON} complement(43262..43506,43751..45251) [1746
           nt, 582 aa]
          Length = 581

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 55/124 (44%), Gaps = 4/124 (3%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N +  +  NP     F   +S  V+IF   + + V T     +V + +     G L C  
Sbjct: 40  NSVTHVYFNPQHPHDFAVTSSTRVQIFSSRTRQVVKTFSRFKDVVYSASFRNDGKLLCAG 99

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           +  G+ +    Y+ R     +++   +H   VT  K+H  DP  L++ S D  T ++D+S
Sbjct: 100 DATGLVSVYDSYNPRVLLLSIKA--STHPTHVT--KFHTQDPKTLITASDDRVTRLWDIS 155

Query: 183 EAEE 186
            A E
Sbjct: 156 HAYE 159

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 93/198 (46%), Gaps = 28/198 (14%)

Query: 31  GLLTSLSNGEVHYLDPST---LTTIQKYNISE-TSINDLQLINHNPTSSPLFTTATSNS- 85
            LL+   +G++++    T   +T  Q + +S   SI D+Q    + T S +F TA  +  
Sbjct: 287 ALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQW---SRTESTVFATAGCDGY 343

Query: 86  VKIFDIHSTKEVATIH---SQGNVPFPSLDSRHG-LLACGTELKGVDAAIYIYDIRKWD- 140
           ++I+D  S K    I    S  +V   S   + G LLA G +    +    ++D+R++  
Sbjct: 344 IRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGTWGVWDLRQFTP 399

Query: 141 ------QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS-EAEEEDSLHQV 193
                 QPV +  D H   +T + ++P D +I+  GS D    ++DLS EA++E+   Q 
Sbjct: 400 SNADTVQPV-AQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQT 458

Query: 194 INFASIHSCGWLSPRRIF 211
                +     + P+ +F
Sbjct: 459 AETKELQE---IPPQLLF 473

>NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534
          Length = 472

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 55/118 (46%), Gaps = 6/118 (5%)

Query: 68  INHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGV 127
           +  +P++  + + +   + +++D+ +  E+          +     + G L C     G+
Sbjct: 279 VKFHPSNKFIASASFDQTWRLWDVETGAEIQLQEGHAKEVYALGFQQDGALLCSG---GL 335

Query: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAE 185
           D    I+D+R   + + +L + H   + CL W PN   +  +G  DG  N++DL +A+
Sbjct: 336 DNTAIIWDLRS-GKSIMTL-NGHAKPIYCLDWSPNGHEV-ATGGGDGLINIWDLRKAQ 390

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 78/162 (48%), Gaps = 21/162 (12%)

Query: 61  SINDLQLINHNPTSSPLFTTATSNS-VKIFDIHSTKE---VATIHSQGNVPFPSLDSRHG 116
           SI D+Q    + T S +F TA  +  ++I+D  S K    ++T+ S  +V   S + + G
Sbjct: 329 SIEDIQW---SRTESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMG 385

Query: 117 LLACGTELKGVDAAIYIYDIRKWDQ------PVRSLVDSHHDDVTCLKWHPNDPNILLSG 170
            L    + KG      I+D+R++        PV +  D H   +T + ++P D +I+   
Sbjct: 386 YLLASGDDKGTWG---IWDLRQFSPNSEKALPV-AQYDFHKGAITSISFNPLDESIVAVA 441

Query: 171 STDGYTNVYDLS-EAEEEDSLHQVINFASIHSCGWLSPRRIF 211
           S D    ++DLS EA++E+   Q    A I     + P+ +F
Sbjct: 442 SEDNTVTLWDLSVEADDEEIKQQK---AEIKELEQIPPQLLF 480

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 54/124 (43%), Gaps = 4/124 (3%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N +  +  NP     F   +S  V++F   + + + T     +V + +   + G L C  
Sbjct: 40  NSVTHVAFNPQKPHDFAVTSSTRVQVFSSRTRQAIKTFSRFKDVVYSASYRKDGKLLCAG 99

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           +  G+   + +YD       + S+  S H      K+H +D   L+S S D  T V+D+S
Sbjct: 100 DATGL---VSVYDSYNPRTLLVSVAASQHP-THVTKFHDHDLKTLVSASDDRVTRVWDIS 155

Query: 183 EAEE 186
            A E
Sbjct: 156 HAYE 159

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 92/198 (46%), Gaps = 28/198 (14%)

Query: 31  GLLTSLSNGEVHYLDPST---LTTIQKYNISE-TSINDLQLINHNPTSSPLFTTATSNS- 85
            LLT   +G+V+     T   +T  Q +  S   SI D+Q    + T S +F T+  +  
Sbjct: 292 ALLTGDCSGQVYLTQRHTSKWVTDKQPFTFSNNKSIEDIQW---SRTESTVFATSGCDGY 348

Query: 86  VKIFDIHSTK---EVATIHSQGNVPFPSLDSRHG-LLACGTELKGVDAAIYIYDIRKWD- 140
           ++I+D  S K    ++T  S  +V   S + + G LLA G +    D    ++D+R+   
Sbjct: 349 IRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDD----DGRWGVWDLRQLSP 404

Query: 141 ------QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS-EAEEEDSLHQV 193
                 QPV +  D H   +T + ++P D +I+   S D    ++DLS EA++E+   Q 
Sbjct: 405 NNSENVQPV-AQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQA 463

Query: 194 INFASIHSCGWLSPRRIF 211
                +     + P+ +F
Sbjct: 464 AETKELQQ---IPPQLLF 478

>KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 507

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 56/125 (44%), Gaps = 6/125 (4%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHG-LLACG 121
           N +  I+ NPT    F   +S  V++F   + + + T     +V + +   + G LLA G
Sbjct: 40  NSVTSISFNPTHPNDFAITSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMG 99

Query: 122 TELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
                    + IYD       + S+  S H      K+HP D   L++ S D    V+D+
Sbjct: 100 ----DATGRVSIYDSYNPRTQLVSIAASSHP-THVAKFHPADSRTLVTASDDRVVRVWDI 154

Query: 182 SEAEE 186
           ++A+E
Sbjct: 155 TQAQE 159

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEE 187
           D  + ++DI +  +P   L  +  D V  +   P  P+++++GS DG+  ++D    E  
Sbjct: 146 DRVVRVWDITQAQEPQVELTGAA-DYVRSVCMVPQAPHLVVTGSYDGFVRLFDTRSNEAA 204

Query: 188 DSLHQ 192
            +L Q
Sbjct: 205 TTLVQ 209

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 92/198 (46%), Gaps = 28/198 (14%)

Query: 31  GLLTSLSNGEVHYLDPST---LTTIQKYNISET-SINDLQLINHNPTSSPLFTTATSNS- 85
            LL+   +G+++     T   +T  Q + +S   SI D+Q    + T S +F TA  +  
Sbjct: 288 ALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQW---SRTESTVFATAACDGY 344

Query: 86  VKIFDIHSTKEVATIH---SQGNVPFPSLDSRHG-LLACGTELKGVDAAIYIYDIRKWD- 140
           ++I+D  S K    I    S  +V   S   + G LLA G +    +    ++D+R++  
Sbjct: 345 IRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGTWGVWDLRQFTP 400

Query: 141 ------QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS-EAEEEDSLHQV 193
                 QPV +  D H   +T + ++P D +I+  GS D    ++DLS EA++E+   Q 
Sbjct: 401 SNADTVQPV-AQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQA 459

Query: 194 INFASIHSCGWLSPRRIF 211
                +     + P+ +F
Sbjct: 460 AETKELQD---IPPQLLF 474

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 93/197 (47%), Gaps = 28/197 (14%)

Query: 32  LLTSLSNGEVHYLDPST---LTTIQKYNISET-SINDLQLINHNPTSSPLFTTATSNS-V 86
           LL+   +G+V++    T   +T  Q + +S   SI D+Q    + + S +F TA  +  +
Sbjct: 288 LLSGDCSGQVYFTQRHTSRWVTDKQPFTVSNNKSIEDIQW---SRSESTVFATAGCDGYI 344

Query: 87  KIFDIHSTKEVATIH---SQGNVPFPSLDSRHG-LLACGTELKGVDAAIYIYDIRKWD-- 140
           +I+D  S K    I    S  +V   S   + G LLA G +    +    ++D+R++   
Sbjct: 345 RIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGTWGVWDLRQFTPS 400

Query: 141 -----QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS-EAEEEDSLHQVI 194
                QPV +  D H   +T + ++P D +I+  GS D    ++DLS EA++E+   Q  
Sbjct: 401 NADSVQPV-AQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTA 459

Query: 195 NFASIHSCGWLSPRRIF 211
               +     + P+ +F
Sbjct: 460 ETKELQE---IPPQLLF 473

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 126 GVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL---- 181
           G D  +Y+YD+R+  +P+ ++   H D VT +++  +   IL S  +D    ++DL    
Sbjct: 267 GTDTRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325

Query: 182 SEAEEEDSLHQVINFASIHS 201
           +E  +ED+   V     +H+
Sbjct: 326 AEQAQEDADDGVPELMMMHA 345

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180
           D  + ++DI   D+PV S+V +H D V   KWH  D NI  + S D    V+D
Sbjct: 182 DTTVALWDINSTDRPV-SIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHD 233

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 80/183 (43%), Gaps = 25/183 (13%)

Query: 28  GNNGLLTSLSNGEV-HYLDPSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTATSNSV 86
           G +  LT+ SNGEV H  D                 N+   +N   + S L    ++  V
Sbjct: 283 GKSIFLTNNSNGEVIHLCDTE---------------NEYTSLNWVGSGSHLAVGQSNGIV 327

Query: 87  KIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSL 146
           +IFD++  K + T+    +     L     +L  G+     D  I   D+R  D P    
Sbjct: 328 EIFDVNKKKCIRTMLGHSD-RVACLSWNSYILTSGSR----DHNILHRDVRSPD-PFFEK 381

Query: 147 VDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVINFASIHSCGWLS 206
           ++SH  +V  LKW+  D N L+SG  D   NVYD +  +   ++ +  + A++ +  W S
Sbjct: 382 IESHSQEVCGLKWNV-DENKLVSGGNDNIVNVYDRTSTKPFMTMTE--HKAAVKALDWSS 438

Query: 207 PRR 209
            +R
Sbjct: 439 HKR 441

>TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa]
           {ON} Anc_1.34 YCL039W
          Length = 765

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 68/156 (43%), Gaps = 26/156 (16%)

Query: 48  TLTTIQKYNISE--TSINDLQLINHN-PTSSPLFTTATSNSVKIFDIHSTKEVATIHSQG 104
            L  + ++NI    T I+  Q+ + N P +S +  +  SN ++++D H    V     Q 
Sbjct: 615 VLPRVSRFNIPNRMTCISLPQIKDANSPLASLMLVSLKSNELQLWDFHEQILVQKYFGQK 674

Query: 105 NVPF---PSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDV------- 154
              F         + L+A G+E    D  IYI+D  +++  + S++ +H  D        
Sbjct: 675 QEQFIIRSCFGYNNKLVASGSE----DGKIYIWD--RFNGNIISVLTAHISDRPTTNGSS 728

Query: 155 -----TC--LKWHPNDPNILLSGSTDGYTNVYDLSE 183
                TC  + W P D  +  SG  DGY  ++ + +
Sbjct: 729 KKSTKTCNAVVWSPTDKTLFASGGDDGYIKIWRVGK 764

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 68/160 (42%), Gaps = 14/160 (8%)

Query: 73  TSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHG-LLACGTELKGVDAAI 131
           TSS + T A  N+ +++D  +   +AT+    N       S  G  +A G+    +D  +
Sbjct: 155 TSSRMVTGAGDNTARVWDCDTQTPMATLSGHQNWVLCVAWSPDGETIATGS----MDCTV 210

Query: 132 YIYDIRKWDQPVRSLVDSHHDDVTCLKWH------PNDPNILLSGSTDGYTNVYDLSEAE 185
            ++D  K  QP+   +  H   +T L W       P D   L S S DG   ++D S   
Sbjct: 211 RLWD-SKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDTSRRV 269

Query: 186 EEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELN 225
              +L    N  S+    W     +++ SH +T  + ++N
Sbjct: 270 CIYTLSGHTN--SVSCVKWGGQGLLYSGSHDKTVRVWDMN 307

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 78/177 (44%), Gaps = 24/177 (13%)

Query: 29  NNGLLTSLSNGEVHYLDPST-LTTIQKY-----NISETSINDLQLINHNPTSSPLFTTAT 82
           NN L +  S GE++  D +T L   + Y      ++ T I ++  +  N + + +F +A 
Sbjct: 119 NNVLASGGSKGEIYIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAG 178

Query: 83  SNS-VKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLL------------ACGTELKGVDA 129
           S S   I+D+ + KEV  IH     P   L S+  ++            A G++    + 
Sbjct: 179 STSYASIWDLKAKKEV--IHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSD---TEP 233

Query: 130 AIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
            I ++D+R  + P++ L   H   +  L W   D  +LLS   D    +++    +E
Sbjct: 234 LILVWDLRNANTPLQVLSKGHSKGILSLDWCSQDEELLLSSGRDNTIVLWNPESGQE 290

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 96/211 (45%), Gaps = 29/211 (13%)

Query: 18  WALKLQP-LQHGNNGLLTSLSNGEVHYLDPST---LTTIQKYNISE-TSINDLQLINHNP 72
           +AL   P +Q G   LLT   +G++++    T   +T  Q + +S   SI D+Q    + 
Sbjct: 278 YALDWSPSIQTG--ALLTGDCSGQIYFTQRHTSKWVTDKQPFTVSNNKSIEDIQW---SR 332

Query: 73  TSSPLFTTATSNS-VKIFDIHSTKEVATIH---SQGNVPFPSLDSRHGLLACGTELKGVD 128
           T   +F +A  +  ++I+D  S K    I    S  +V   S   + G L    +  GV 
Sbjct: 333 TEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLASGDDNGVW 392

Query: 129 AAIYIYDIRKWD-------QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
               ++D+R++        QPV +  D H   +T + ++P D +I+   S D    ++DL
Sbjct: 393 G---VWDLRQFSPDTANSVQPV-AQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDL 448

Query: 182 S-EAEEEDSLHQVINFASIHSCGWLSPRRIF 211
           S EA++E+   Q      +     + P+ +F
Sbjct: 449 SVEADDEEIKQQAAETKELQQ---IPPQLLF 476

>KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {ON}
           Anc_2.469 YMR093W
          Length = 508

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 54/128 (42%), Gaps = 4/128 (3%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N +  I  NP S   F   +S  V+IF   + + V T     +V + +     G L    
Sbjct: 40  NSVTHIAFNPKSPFDFAVTSSTRVQIFSSKTRQVVKTFSRFKDVVYSASFRNDGKLLVAG 99

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           +  G+   + +YD       + S+  S H      K+HP D   L++ S D  T ++D+S
Sbjct: 100 DATGL---VSVYDAYNPRSILLSINASTHP-THVTKFHPQDNKTLVTTSDDRVTRIWDIS 155

Query: 183 EAEEEDSL 190
            A E   L
Sbjct: 156 HAYEAQEL 163

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 98/211 (46%), Gaps = 29/211 (13%)

Query: 18  WALKLQPLQHGNNGLLTSLSNGEVHYLDPST---LTTIQKYNI-SETSINDLQLINHNPT 73
           +AL   P+   N  LLT   +G++++    T   +T  Q +   +  S+ D+Q    + T
Sbjct: 283 YALDWSPMIK-NGALLTGDCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQW---SRT 338

Query: 74  SSPLFTTATSNS-VKIFDIHSTK---EVATIHSQGNVPFPSLDSRHGLLACGTELKGVDA 129
            S +F +A  +  ++I+D  S K    ++   S  +V   S   + G L       G D 
Sbjct: 339 ESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISWSEKIGYLLAS----GDDN 394

Query: 130 AIY-IYDIRKWD-------QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
            ++ ++D+R++        QPV +  D H   +T + ++P D +I+   S D    ++DL
Sbjct: 395 GLWGVWDLRQFSPDNINDVQPV-AQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDL 453

Query: 182 S-EAEEEDSLHQVINFASIHSCGWLSPRRIF 211
           S EA++E+   Q+     +     + P+ +F
Sbjct: 454 SVEADDEEIKQQIAETKELEK---IPPQLLF 481

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 76/177 (42%), Gaps = 26/177 (14%)

Query: 30  NGLLTSLSNGEVHYLD-------PSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTAT 82
           N L T  + GE+   D       P+  T +   N S T + ++  +  N + + +F +A 
Sbjct: 120 NVLATGGTKGEIFIWDVNKCLENPNDYTPLTPGN-SMTPVEEITSLAWNQSLAHVFASAG 178

Query: 83  SNS-VKIFDIHSTKEVATIHSQGNVPFPSL------------DSRHGLLACGTELKGVDA 129
           S S   I+D+ + KEV  IH     P   L            +S     A G++    D 
Sbjct: 179 STSYASIWDLKAKKEV--IHLSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSD---NDP 233

Query: 130 AIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
           +I ++D+R  + P++ L   H   V  L W   D N+LLS   D    +++  E +E
Sbjct: 234 SILVWDLRNANTPLQVLSQGHSKGVLSLDWCNQDENLLLSSGRDNTVVLWNPQEGQE 290

>Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 63/150 (42%), Gaps = 12/150 (8%)

Query: 44  LDPSTLTTIQKYNISETSI------NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEV 97
           L P   T  Q+Y    TS       N +  I+ NP     F   +S  V+IF   + + +
Sbjct: 15  LLPQQTTPEQRYWRQYTSAQLVKEHNSVTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVI 74

Query: 98  ATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSL-VDSHHDDVTC 156
            T     +V + +     G L C  +  G+   + +YD       + S+   +H   VT 
Sbjct: 75  KTFSRFKDVVYSASFRSDGKLLCAGDATGL---VSVYDSYNPRTILLSMNASTHPTHVT- 130

Query: 157 LKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
            K+H  D  IL + S D  T ++D+S A E
Sbjct: 131 -KFHTQDSKILATASDDRVTRLWDISNAYE 159

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 12/112 (10%)

Query: 77  LFTTATSNSVKIFDIHSTKEVATIHSQGNV--PFPSLD-SRHG--LLACGTELKGVDAAI 131
           +F + + +S     +H  +E  T  SQ  V  PF +L  S+H   L A      G D+ +
Sbjct: 233 VFGSVSEDST--LQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAA----GTDSHV 286

Query: 132 YIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
           Y++D R   +P+ S+   H   VT +++ P+   IL++   D    ++D+ +
Sbjct: 287 YLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICD 337

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 87/200 (43%), Gaps = 30/200 (15%)

Query: 10  SRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSINDLQLIN 69
           +R    +N A+ L    H    L  + S+G V   D      +Q++N+  T+I++ +   
Sbjct: 190 ARRTPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWD------LQRFNVDNTTISETEWEC 243

Query: 70  HNPTSSPLFTTA--------------TSNSVKIFDIHSTKEVATIHSQ---GNVPFPSLD 112
            N  S  +   +               S+S+ +FD  +   VA I +Q     +     +
Sbjct: 244 SNFDSRGVNDVSWMSQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEGINACKFN 303

Query: 113 SRHGLLACGTELKGVDAAIYIYDIRKWD-QPVRSLVDSHHDDVTCLKWHPNDPNILL-SG 170
             + LL   T+  G      ++D+RK   +P+      H   V+ L+W+P+D ++L  +G
Sbjct: 304 WENNLLLASTDSTG---RTNLWDVRKLSAEPIVHF--DHGGSVSTLEWNPHDHSVLATAG 358

Query: 171 STDGYTNVYDLSEAEEEDSL 190
            +DG   ++D S   E+ ++
Sbjct: 359 QSDGLIKIWDTSLEIEDKTI 378

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 65/132 (49%), Gaps = 13/132 (9%)

Query: 62  INDLQLINHNPTSSPLFTTATSNSV-KIFDIHSTKEVATIHSQGNVPFPSLDSRH---GL 117
           +ND++  N N     LF T + +S+ KI D+ +   +     +   PF +L   H    L
Sbjct: 237 VNDIKWHNFN---EKLFGTVSEDSLLKINDVRA-HNITIDAVKCPQPFNTLAFSHHSSNL 292

Query: 118 LACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTN 177
           LA      G+D+ +Y+YD+R   +P+  +   H D VT +++  +   +++S  +D    
Sbjct: 293 LAAA----GMDSHVYLYDLRNMREPLHHM-SGHEDAVTNIEFSTHVDGVVVSSGSDNRLI 347

Query: 178 VYDLSEAEEEDS 189
           ++DL +   E +
Sbjct: 348 MWDLKQIGAEQT 359

>TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1340

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 129 AAIYIYDIRKWDQPVRSLV----DSHHDDVTCLKWHPNDPNILLSGSTDGYT 176
           +AIYI+D+RK + P   L     D H   +T L W   DP  L+S   D ++
Sbjct: 248 SAIYIWDLRKANTPTSVLSNDKSDGHRHPITSLDWCRTDPRFLISSCKDDFS 299

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 39/68 (57%), Gaps = 5/68 (7%)

Query: 126 GVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL---- 181
           G DA +Y++D RK  + + S+   H + VT L++  +   IL SG +D    ++DL    
Sbjct: 266 GTDAMVYLFDSRKPTEALHSM-SGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIG 324

Query: 182 SEAEEEDS 189
           +E +EED+
Sbjct: 325 TEQQEEDA 332

 Score = 36.6 bits (83), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 117 LLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYT 176
           L++C       D +I I+DI+       S+   H D V   KWH +DPNI  S S D + 
Sbjct: 175 LISCSD-----DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFL 229

Query: 177 NVYDLSEAEEEDSLHQVINFASI 199
            ++D    +    L Q   F +I
Sbjct: 230 MIHDKRSEKPLQKLLQKEPFNTI 252

>TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 54/124 (43%), Gaps = 4/124 (3%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N +  I+ NP     F   +S  V++F   + + + T     +V + +     G L C  
Sbjct: 40  NSVTHISFNPQHPHDFAVTSSTRVQLFSSSTRQVIKTFSRFKDVVYSASFRSDGKLLCAG 99

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           +  G+ +    Y+ R     + +   SH   VT  K+H  D   L++ S D  T V+D+S
Sbjct: 100 DATGLVSVYDSYNPRTLLLSINA--SSHPTHVT--KFHTQDSKTLVTASDDRITRVWDIS 155

Query: 183 EAEE 186
            A E
Sbjct: 156 HAYE 159

>TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {ON}
           Anc_1.247 YKR036C
          Length = 730

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 76/169 (44%), Gaps = 31/169 (18%)

Query: 42  HYLDPSTLTTIQKYNISETSINDLQLINHNPTSSPLFTT-ATSNSVKIFDIHSTKEVATI 100
           +Y   S L T++ YN S    N +  ++ +     L++T    NS+K++D++  K++   
Sbjct: 397 YYASGSKLGTLENYNDS----NSISCLDFDIPFGKLYSTNKLDNSIKVWDLNRFKQIGIK 452

Query: 101 HSQ--GNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWD----------QPV----- 143
           H      +    L S   LL  G    G DA + ++DI+             +P+     
Sbjct: 453 HKAHLTTINCIQLYSTKDLLITG----GKDALVKLWDIQSEKFCEDEEENSIEPLNEDSI 508

Query: 144 --RSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSL 190
             +SL D H D++T L  H N+   L++GS D     +DL+  +   SL
Sbjct: 509 SLKSLFDLHSDEITSLFMHENN---LVTGSQDKTIIHWDLNSGKNIQSL 554

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 9/68 (13%)

Query: 118 LACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTN 177
           LA GT+    D  I ++D+R   +  R L+  H D +T LK+   D N ++SGS DG T 
Sbjct: 594 LATGTK----DGIIRLWDLRSG-EIARKLI-GHQDAITSLKF---DTNNIISGSLDGSTR 644

Query: 178 VYDLSEAE 185
           ++DL + +
Sbjct: 645 IWDLRQDQ 652

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSL 190
           I I D+R  + P+ +L + H   V  +KWHP   N+LLS S D     +DL+ +  E   
Sbjct: 377 IIILDMRNPESPILTL-EGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFME--- 432

Query: 191 HQVINFASIHSCG 203
              IN  S+ S G
Sbjct: 433 ---INGGSVKSPG 442

>Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 63/150 (42%), Gaps = 12/150 (8%)

Query: 44  LDPSTLTTIQKYNISETSI------NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEV 97
           L P   T  Q+Y    TS       N +  I+ NP     F   +S  V+IF   + + +
Sbjct: 15  LLPQQTTPEQRYWRQYTSAQLVKEHNSVTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVI 74

Query: 98  ATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSL-VDSHHDDVTC 156
            T     +V + +     G L C  +  G+   + +YD       + S+   +H   VT 
Sbjct: 75  KTFSRFKDVVYSASFRNDGKLLCAGDATGL---VSVYDSYNPRTILLSINASTHPTHVT- 130

Query: 157 LKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
            K+H  D  IL + S D  T ++D+S A E
Sbjct: 131 -KFHTQDNKILATASDDRVTRLWDISHAYE 159

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 56/137 (40%), Gaps = 28/137 (20%)

Query: 74  SSPLFTTATSN-SVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDA--- 129
           S+ LF +   + SV++FD+ S      I+     P  S  S     A    LKG DA   
Sbjct: 299 STQLFASCGGDGSVRVFDLRSLAHSTIIYE----PPSSPASGPNAGATTPSLKGSDALLR 354

Query: 130 -------------------AIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSG 170
                               I I D+R  + P+ +L + H   V  +KWHP   N+LLS 
Sbjct: 355 LEPSPYDPNVLATFAADSNKIIILDMRNPESPILNL-EGHTCSVNEIKWHPTKRNVLLSC 413

Query: 171 STDGYTNVYDLSEAEEE 187
           S D     +DL+ +  E
Sbjct: 414 SDDCQALYWDLNNSFME 430

>YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}
           UTP15Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 513

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 63/150 (42%), Gaps = 12/150 (8%)

Query: 44  LDPSTLTTIQKYNISETSI------NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEV 97
           L P   T  Q+Y    TS       N +  I+ NP     F   +S  V+IF   + + +
Sbjct: 15  LLPQQTTPEQRYWRQYTSAQLVKEHNSVTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVI 74

Query: 98  ATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSL-VDSHHDDVTC 156
            T     +V + +     G L C  +  G+   + +YD       + S+   +H   VT 
Sbjct: 75  KTFSRFKDVVYSASFRSDGKLLCAGDATGL---VSVYDSYNPRTILLSINASTHPTHVT- 130

Query: 157 LKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
            K+H  D  IL + S D  T ++D+S A E
Sbjct: 131 -KFHTQDNKILATASDDRVTRLWDISNAYE 159

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 63/135 (46%), Gaps = 13/135 (9%)

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATI----HSQGNVPFPSLDSRHGLLA 119
           D++  + +PT   + + +  N +K++D  S + ++TI    H+     F    ++  LLA
Sbjct: 209 DVKSCDWHPTMGLIVSGSKDNLIKLWDPRSGQCISTILGFKHTIIKTKFQP--TKGNLLA 266

Query: 120 CGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVY 179
              +    D +  I+DIR+  + ++S  D    D   L WHP + +I   G  DG    +
Sbjct: 267 VVAK----DKSCKIFDIRQNMKELKSFRD--ESDYMSLTWHPINESIFTVGCYDGSLKHF 320

Query: 180 D-LSEAEEEDSLHQV 193
           D L +    +S H +
Sbjct: 321 DLLQDTGSSNSFHDI 335

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 6/125 (4%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHG-LLACG 121
           N +  I  NP     F   +S  V++F   + + + T     +V + +   + G LLA G
Sbjct: 40  NSVTSIAFNPNHPNDFAITSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMG 99

Query: 122 TELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
                    + +YD       + S+  S H      K+HP D   L++ S D    V+D+
Sbjct: 100 ----DATGRVSVYDSYNPRAQLVSIAASSHP-THVAKFHPADSRTLVTASDDRVVRVWDI 154

Query: 182 SEAEE 186
           ++A+E
Sbjct: 155 TQAQE 159

>Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 61/149 (40%), Gaps = 10/149 (6%)

Query: 44  LDPSTLTTIQKYNISETSI------NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEV 97
           L P   T  Q+Y    TS       N +  I+ NP     F   +S  V+IF   + + +
Sbjct: 15  LLPQQTTPEQRYWRQYTSAQLVKEHNSVTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVI 74

Query: 98  ATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCL 157
            T     +V + +     G L C  +  G+   + +YD       + S+  S H      
Sbjct: 75  KTFSRFKDVVYSASFRSDGKLLCAGDATGL---VSVYDSYNPRTILLSINASTHP-AHVT 130

Query: 158 KWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
           K+H  D  +L + S D  T ++D+S A E
Sbjct: 131 KFHTQDNKVLATASDDRVTRLWDISHAYE 159

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 69/141 (48%), Gaps = 14/141 (9%)

Query: 52  IQKYNISETSI-NDLQLINHNPTSSPLFTTATSNSVKIFDIHST-KEVATIHSQG---NV 106
           IQ++  S + I ND Q   H   ++   + +  +++++FD  +  K    I S+G   ++
Sbjct: 190 IQEWTTSHSDIVNDCQW--HCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSI 247

Query: 107 PFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNI 166
            F    S +   A GT        IY+YDIR   + + S+   H + VT L++  +   I
Sbjct: 248 AFSGF-SENLFAAAGTT-----NNIYLYDIRNTGKILHSMT-GHEEPVTSLEFSNDKDGI 300

Query: 167 LLSGSTDGYTNVYDLSEAEEE 187
           L+SGS+D    ++DL E   E
Sbjct: 301 LISGSSDRRVIMWDLFEIGAE 321

>KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.469
           YMR093W
          Length = 509

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 55/124 (44%), Gaps = 4/124 (3%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N +  I  NP S   F   +S  V+IF   + + V T     +V + +     G L    
Sbjct: 40  NAVTEIAFNPKSPFDFAVTSSTRVQIFSSRTRQVVKTFSRFKDVVYCANFRADGKLLVAG 99

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           +  G+ +    Y+ R     +++   +H   VT  K+HP D   L++ S D  T ++D+S
Sbjct: 100 DATGLVSVYDSYNPRNVLVSIQA--STHPTHVT--KFHPMDSKTLITSSDDRVTRLWDIS 155

Query: 183 EAEE 186
            A E
Sbjct: 156 HAYE 159

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 37.4 bits (85), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 76/167 (45%), Gaps = 14/167 (8%)

Query: 39  GEVHYLDPSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVA 98
           G+  +L  +T   +     SE+    L  ++   + S L    +S  V+I+D+   K + 
Sbjct: 298 GKSIFLSDNTTNDVTHLATSESDFTSLSWVD---SGSHLAVGLSSGIVEIYDVLKNKCIR 354

Query: 99  TIHSQGNV-PFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCL 157
           T+   G+V     L   + +L+ G+     D  I   D+R   +P    +D+H  +V  L
Sbjct: 355 TL--SGHVDRVACLSWNNHVLSSGSR----DRKILHRDVRA-PEPFFEQIDTHSQEVCGL 407

Query: 158 KWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVINFASIHSCGW 204
           KW+ N+ N L SG  D    VYD +  +   S+ +  + A++ +  W
Sbjct: 408 KWNVNE-NKLASGGNDNMVYVYDGTLRQPMLSMEE--HTAAVKAMAW 451

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 82/178 (46%), Gaps = 26/178 (14%)

Query: 29  NNGLLTSLSNGEVHYLD-------PSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTA 81
           +N L +  +NGE+   D       P+  T +     S +S++++  +  N + + +F +A
Sbjct: 121 DNVLASGGNNGEIFIWDMNKCTESPANYTPLTPGQ-SMSSVDEVNSLAWNQSLAHVFASA 179

Query: 82  -TSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLL------------ACGTELKGVD 128
            +SN   I+D+ + KEV  IH     P   +  +  ++            A G++    D
Sbjct: 180 GSSNFASIWDLKAKKEV--IHLCYTSPNSGIKQQLSVVEWHPKNSTRVATATGSD---ND 234

Query: 129 AAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
            +I ++D+R  + P+++L   H   +  L W   D N+LLS   D    +++   AE+
Sbjct: 235 PSILVWDLRNANTPLQTLNQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWNPELAEQ 292

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 60/142 (42%), Gaps = 20/142 (14%)

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTE 123
           D++  + +P    + + +  N +K +D  S   V+T+          L  +H +++   +
Sbjct: 209 DVKSCDWHPKMGLIVSGSKDNLIKFWDPRSGSCVSTM----------LGFKHTIISTKFQ 258

Query: 124 LK--------GVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGY 175
            K          D    +YDIR+  + + S+ D    D   L+WHP D  +   G  DG 
Sbjct: 259 PKQGNLLSVISKDKTCKVYDIRQQAKELFSVRDD--VDYMTLQWHPIDETVFTVGCYDGS 316

Query: 176 TNVYDLSEAEEEDSLHQVINFA 197
              +DLS+  + +     I +A
Sbjct: 317 IKHFDLSQENQPNKPTHNIPYA 338

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 9/123 (7%)

Query: 62  INDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLD-SRHGL-LA 119
           I+D+  +  +P    +FT ++  + +++DI +T E   +      P  S+  +  GL LA
Sbjct: 637 ISDVDCVTFHPNGCYIFTGSSDKTCRMWDI-TTGESVRLFIGHTAPILSVAVAPDGLRLA 695

Query: 120 CGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVY 179
            G+E    D  I+I+DI    + ++ L+      V  L ++  + NIL+SG +D    ++
Sbjct: 696 TGSE----DGVIHIWDIGT-GKSLKKLIGHGKSAVNSLSYN-KESNILVSGGSDNSVRIW 749

Query: 180 DLS 182
           DL+
Sbjct: 750 DLT 752

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 75/182 (41%), Gaps = 16/182 (8%)

Query: 4   SYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSIN 63
           S+ +     F  N   +K      G+N L+   SNGE    D  + T +Q+ ++ + ++N
Sbjct: 240 SWRIAEKHFFFQNQAKVKCVTFHPGSNLLVVGFSNGEFRLYDLPSFTLVQQLSMGQNAVN 299

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTE 123
            + +  +N      F ++    + +++  S  E   +  QG+      DS +GL      
Sbjct: 300 TVSI--NNTGEWLAFGSSALGQLLVYEWQS--ESYILKQQGH-----FDSLNGLTYSPDG 350

Query: 124 LKGVDAA----IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVY 179
            + V AA    I ++D+        +    H   VT +++      +L S S DG    +
Sbjct: 351 ARVVTAANDGKIKVWDVVS--GFCLATFSEHTSSVTAVQF-AKRGQVLFSSSLDGTVRAW 407

Query: 180 DL 181
           DL
Sbjct: 408 DL 409

>ABL096W Chr2 (217132..218472) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR030C (RAD28)
          Length = 446

 Score = 36.6 bits (83), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 80/194 (41%), Gaps = 29/194 (14%)

Query: 154 VTCLKWHPNDPNILLSGSTDGYTNVYD------LSEAEEEDSLHQVINFASIHSCGWLSP 207
           V C+ ++  D  + ++   +G   ++D      L E +   + HQ+    S+  C    P
Sbjct: 173 VDCV-FYGQDNGMFVTAGRNGTVRLWDTESCRPLHEVQLPHAAHQLHARGSLLLCALADP 231

Query: 208 R-RIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVREKWGCDYVVDVYPGFIATGKSQE 266
             R+  L H        +  ++     P       +  ++  D V D  P F+A G   +
Sbjct: 232 HPRVLDLRHPRG---EGMQLRAGARARP---GANALCARFLADAVDD--PRFVAAG---D 280

Query: 267 RQGELKLIPLQDETIDLTNSIV--IPGAHDDEV--IRDVYIPSHDSVMMYTCGEDGNVKL 322
             G L +  L+     + N  V  +PGAH   V  +  +++P+H + +  T G DG  +L
Sbjct: 281 HAGGLAVWDLR-----MANRRVAAVPGAHPGFVNALATLHVPAHVATLA-TAGADGRCRL 334

Query: 323 WKNNNGPLNVPEQL 336
           W   NG L +   L
Sbjct: 335 WTWANGALRLRRPL 348

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 82/178 (46%), Gaps = 26/178 (14%)

Query: 29  NNGLLTSLSNGEVHYLD-------PSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTA 81
           +N L +  +NGE+   D       PS  T +     S +S++++  +  N + + +F +A
Sbjct: 121 DNVLASGGNNGEIFIWDMNKCTESPSNYTPLTPGQ-SMSSVDEVISLAWNQSLAHVFASA 179

Query: 82  -TSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLL------------ACGTELKGVD 128
            +SN   I+D+ + KEV  IH     P   +  +  ++            A G++    D
Sbjct: 180 GSSNFASIWDLKAKKEV--IHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSD---ND 234

Query: 129 AAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
            +I I+D+R  + P+++L   H   +  L W   D ++LLS   D    +++   AE+
Sbjct: 235 PSILIWDLRNANTPLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPESAEQ 292

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 130 AIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
           +I I D+R    PV +L + H   V  +KWHP   N+LLS   D     +DL+E
Sbjct: 350 SILILDMRNPGSPVLTL-EGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNE 402

>CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 aa]
           {ON} highly similar to uniprot|P41811 Saccharomyces
           cerevisiae YGL137w SEC27
          Length = 902

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 30/161 (18%), Positives = 72/161 (44%), Gaps = 9/161 (5%)

Query: 32  LLTSLSNGEVHYLDPSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTATSNSVKIFDI 91
           +LT+L +G V   +  T   ++   +++T +   + I      + +   +  N V++F+ 
Sbjct: 28  VLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRK---NWIVVGSDDNKVRVFNY 84

Query: 92  HSTKEVATIHSQGN-VPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSH 150
           ++ ++VA   +  + +   ++      +  G++    D  + +++    D  +      H
Sbjct: 85  NTGEKVADFVAHPDYIRSIAVHPSKPYILTGSD----DLTVKLWNWEN-DWSLEQTFKGH 139

Query: 151 HDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLH 191
              V C+ ++P DPN+  SG  D    V+ L ++    +LH
Sbjct: 140 EHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLH 180

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 65/133 (48%), Gaps = 15/133 (11%)

Query: 62  INDLQLINHNPTSSPLFTTATSNSV-KIFDIHSTKEVATIHS-QGNVPFPSLDSRH---G 116
           IND +  N N     LF T + +S+ KI D+ +     TI + +   PF +L   H    
Sbjct: 211 INDNKWHNFN---KDLFGTVSEDSLLKINDVRANN--TTIDTVKCPQPFNTLAFSHHSSN 265

Query: 117 LLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYT 176
           LLA      G+D+ +Y+YD+R   +P+  +   H D V  L++  +   +++S  +D   
Sbjct: 266 LLAAA----GMDSYVYLYDLRNMKEPLHHM-SGHEDAVNNLEFSTHVDGVVVSSGSDNRL 320

Query: 177 NVYDLSEAEEEDS 189
            ++DL +   E +
Sbjct: 321 MMWDLKQIGAEQT 333

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 56/139 (40%), Gaps = 32/139 (23%)

Query: 74  SSPLFTTATSN-SVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT--ELKGVDA- 129
           S+ LF +   + SV++FD+ S      I+       P   S  GL A  T    KG DA 
Sbjct: 299 STQLFASCGGDGSVRVFDLRSLAHSTIIYE------PPASSAPGLNADTTTPASKGSDAL 352

Query: 130 ---------------------AIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILL 168
                                 I I D+R  + P+ +L + H   V  +KWHP   N+LL
Sbjct: 353 LRLEPSPYDPNVLATFAAESNKIIILDMRNPESPILNL-EGHSSSVNEIKWHPTKRNVLL 411

Query: 169 SGSTDGYTNVYDLSEAEEE 187
           S   D     +DL+ +  E
Sbjct: 412 SCGDDCQVLYWDLNNSFME 430

>ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 510

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 4/124 (3%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N +  I  NP     F   +S  V++F   + + + T     +V + +     G L C  
Sbjct: 40  NSVTHIAFNPVHPHDFAVTSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAG 99

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           +  G+ +    Y+ R     + +   +H   VT  K+H +D   L++ S D  T V+D+S
Sbjct: 100 DATGLVSVYDSYNPRALLVSINA--STHPTHVT--KFHSHDSKSLVTASDDRITRVWDIS 155

Query: 183 EAEE 186
           ++ E
Sbjct: 156 QSYE 159

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 49/109 (44%), Gaps = 13/109 (11%)

Query: 86  VKIFDIHSTKEVATIHSQGNVPFPSLD---SRHGLLACGTELKGVDAAIYIYDIRKWDQP 142
           V+ F     K +A + +Q + P  ++     +H +L  G    G    IYI+D  K + P
Sbjct: 86  VEFFSPSEYKSIAKL-AQHSTPVKTVRFNAKQHNVLCSG----GSKGEIYIWDANKIETP 140

Query: 143 -----VRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
                V     +  D++  L W+ N  ++  S  + G+ +++DL   +E
Sbjct: 141 GYAPFVPGTAMTPMDEIYSLAWNQNQGHVFASAGSSGFASIWDLKAKKE 189

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 75/169 (44%), Gaps = 20/169 (11%)

Query: 20  LKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKY----NISETSINDLQLINHNPTSS 75
           ++    QH  N L +  S GE++  D + + T          + T ++++  +  N    
Sbjct: 110 VRFNAKQH--NVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQG 167

Query: 76  PLFTTATSNS-VKIFDIHSTKEV------ATIHSQGN----VPFPSLDSRHGLLACGTEL 124
            +F +A S+    I+D+ + KEV      ++I  Q N    V +   +S     A G++ 
Sbjct: 168 HVFASAGSSGFASIWDLKAKKEVIHLSHTSSITGQKNQLSIVEWHPNNSTRIATASGSD- 226

Query: 125 KGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTD 173
              D +I ++D+R  + P+++L   H   V  L W   D  +LLS   D
Sbjct: 227 --SDPSILVWDLRNANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRD 273

>Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124C
           (DSE1) - Daughter Specific Expression 1 [contig 210]
           FULL
          Length = 553

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 127 VDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
           +D  + ++DIR      +  V+ H   +  LK+H ND   L S   +GYT  +DL   + 
Sbjct: 316 IDNQVKVWDIRS--TGAKCTVNGHKGSIKGLKYH-NDTRRLYSSDDEGYTIAWDLQGIDN 372

Query: 187 EDSLHQVINFAS--------IHSCG--WLSPRRIFTLSHME 217
               H    F S        I  CG   ++P+ + T+S ++
Sbjct: 373 VSECHLATGFLSITEEKISEIKQCGNVVVAPKNLRTVSSIK 413

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 66/140 (47%), Gaps = 18/140 (12%)

Query: 60  TSINDLQLINHNPTSSPLFTTATSNS-VKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLL 118
           T I+++Q +  N + + +F +A S+    I+D+ + KEV  IH     P   L ++  ++
Sbjct: 151 TPIDEVQSLAWNQSLAHVFASAGSSGFASIWDLKAKKEV--IHLSYTSPHSGLKNQLAVV 208

Query: 119 ------------ACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNI 166
                       A G + + V   I ++D+R  + P++ +   H   +  L W  +D  +
Sbjct: 209 EWHPSNSTRVATATGNDNEPV---ILVWDLRNANMPLQVMSQGHSKGILSLDWCKHDEKL 265

Query: 167 LLSGSTDGYTNVYDLSEAEE 186
           +LS   D    +++  EA++
Sbjct: 266 MLSSGRDNTCILWNPEEAQK 285

>Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {ON}
           YMR102C - Hypothetical ORF [contig 55] FULL
          Length = 743

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 137 RKW--DQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTD 173
           R W  D+P    V +H D VTC K+HPND    +SG  D
Sbjct: 296 RLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLD 334

>CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112w MDV1
          Length = 711

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 58/123 (47%), Gaps = 14/123 (11%)

Query: 105 NVPF-PSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPND 163
           N P   S+ S    LA GT+    D  I ++D+R  +  V  +++ H D +T LK+   D
Sbjct: 563 NTPIIGSIQSFDAALATGTK----DGLIRLWDMRTGE--VVRVLEGHMDAITSLKF---D 613

Query: 164 PNILLSGSTDGYTNVYDLSEAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHE 223
              ++SGS DG   ++DL      ++L  +I++    S      + I   S+     I++
Sbjct: 614 ATTIISGSLDGTIRLWDL----RSNNLTDIISYEKPISSLDFDAKHIVVASNEHNTHIYD 669

Query: 224 LND 226
            ND
Sbjct: 670 RND 672

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 83/177 (46%), Gaps = 22/177 (12%)

Query: 31  GLLTSLSNGEVHYLDPST---LTTIQKYNI-SETSINDLQLINHNPTSSPLFTTATSNS- 85
            LLT   +GE+      T   +T  Q +++ +  SI D+Q    + T   +F TA  +  
Sbjct: 305 ALLTGDCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDIQW---SKTEQTVFATAGCDGY 361

Query: 86  VKIFDIHSTK---EVATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWD-- 140
           ++I+D  S K    ++T  S  +V   S + +   L    + KGV     ++D+R++   
Sbjct: 362 IRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLASGDDKGVWG---VWDLRQFSPS 418

Query: 141 ----QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS-EAEEEDSLHQ 192
                PV +  D H   +T + ++P D + +   S D    ++DLS EA++E+   Q
Sbjct: 419 QENASPV-AQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQ 474

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 51/131 (38%), Gaps = 11/131 (8%)

Query: 84  NSVKIFDI-------HSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKG-VDAAIYIYD 135
           N VK F I        S + + TI S GNV    LD    L+  G  L G     I++  
Sbjct: 261 NQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLD-WSPLIKSGALLTGDCSGEIFLTS 319

Query: 136 --IRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQV 193
               KW    +S    ++  +  ++W   +  +  +   DGY  ++D    + + ++   
Sbjct: 320 RHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIRIWDTRSKKHKPAISTR 379

Query: 194 INFASIHSCGW 204
            +   ++   W
Sbjct: 380 ASNVDVNVISW 390

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 51/119 (42%), Gaps = 25/119 (21%)

Query: 85  SVKIFDIHSTKEVATIHSQ-GNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIR------ 137
           +VKI+D+   K++  +      +    +D  +G L  G    G DAA+ ++++       
Sbjct: 416 TVKIWDLSKRKKIGELAGHLATINCMQIDRDYGTLVTG----GRDAALKLWNLNLAEQLY 471

Query: 138 -----------KWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAE 185
                      + D P     ++H D+VT L     DPN L+SGS D     +DL   +
Sbjct: 472 QETQNLTCPASQIDSPCVFTFEAHIDEVTALSL---DPNFLVSGSQDRTIRQWDLCSGK 527

>TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1549

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 75/171 (43%), Gaps = 13/171 (7%)

Query: 21   KLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKY---NISETSINDLQLINHNPTSSPL 77
            KL       N L+T+     +   D  +     K+   N   T I  LQLIN +  +  L
Sbjct: 1188 KLIKFSQFENYLITADERDNITVFDWESSQICSKFSNGNPYGTKITSLQLINEDDNA--L 1245

Query: 78   FTTATSNS-VKIF-DIHSTKEVATIHSQGNVPFPSLDSRH-GLLACGTELKGVDAAIY-I 133
              T +SN  VK+F ++H +++V  I+S   +    L  R  GLL    ++KG   A   +
Sbjct: 1246 LLTGSSNGIVKVFKNMHDSEDVEVINSWRALTDMLLTPRSSGLLLEWQQMKGYLLATGDV 1305

Query: 134  YDIRKWDQPVRSL-VDSHHDDVTCLKWHPNDP---NILLSGSTDGYTNVYD 180
              IR WD    S+ VD      + +    +D    NI + G TDG   VYD
Sbjct: 1306 KVIRIWDAHTESMEVDIPAKTSSLITSITSDQLSGNIFVCGFTDGSLRVYD 1356

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 18/123 (14%)

Query: 74  SSPLFTTATSN-SVKIFDIHSTKEVATIHSQGNVPFPSLD---SRHGLLACGTELKGVDA 129
           S+ LF +   + SV++FD+ S      I+     P  + D    ++ LL    E    DA
Sbjct: 336 STQLFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRL--EPSPTDA 393

Query: 130 -----------AIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNV 178
                       I I D+R  + PV  +++ H   +  +KWHP    ILLS S D     
Sbjct: 394 NVIATFVSESNKILILDMRNSESPVL-VLEGHKSAINQIKWHPTKRYILLSCSDDCQVLY 452

Query: 179 YDL 181
           +DL
Sbjct: 453 WDL 455

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEA 184
           I I D+R  + P+  +++ H   V  +KWHP   N+LLSG  D     +DL++ 
Sbjct: 355 ILILDMRNPESPLM-ILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKC 407

>AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YJL112W (MDV1) and YKR036C
           (CAF4)
          Length = 715

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 59/123 (47%), Gaps = 19/123 (15%)

Query: 85  SVKIFDIHSTKEVATIHSQ-GNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKW---- 139
           ++K++++   K VA+I      V    +D  + L+  G      DA + ++DI+K     
Sbjct: 435 TIKVWNLSKNKHVASITGHLATVSCMQMDQYNTLITGGR-----DALLKMWDIQKAIDND 489

Query: 140 ----DQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVIN 195
               D+      DSH D++T L +  N+   L+SGS D     +DL+  +   +L   IN
Sbjct: 490 SIPSDEVCIYTFDSHIDEITALSFEANN---LVSGSQDRTIRQWDLNNGKCVQTLD--IN 544

Query: 196 FAS 198
           FA+
Sbjct: 545 FAT 547

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 69/160 (43%), Gaps = 14/160 (8%)

Query: 73  TSSPLFTTATSNSVKIFDIHSTKEVATIHSQGN-VPFPSLDSRHGLLACGTELKGVDAAI 131
           TSS + T A  N+ +I+D ++   ++T+    N V   S      L+A G+    +D  I
Sbjct: 155 TSSRMITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGS----MDNTI 210

Query: 132 YIYDIRKWDQPVRSLVDSHHDDVTCLKWH------PNDPNILLSGSTDGYTNVYDLSEAE 185
            +++  K  QPV   +  H   +T L W       P     L S S DG   ++D +   
Sbjct: 211 RLWEGNK-GQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRV 269

Query: 186 EEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELN 225
              +L    + +S+    W     +++ SH +T    ++N
Sbjct: 270 CLITLSG--HTSSVSCIKWGGQGVLYSGSHDKTIRAWDMN 307

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEA 184
           I I D+R  + PV +L   H   +  +KWHP + NILLS + D     +DL+ +
Sbjct: 373 IIILDMRNPETPVLTL-QGHSSSLNQIKWHPTERNILLSCADDCQVLYWDLNSS 425

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 79/174 (45%), Gaps = 31/174 (17%)

Query: 31  GLLTSL-SNGEVHYLDPSTLTTIQKYNISETSINDLQLIN-------------HNPTSSP 76
           GLL S  S+G++   D      ++KY+ S+  + D  L+N             H    S 
Sbjct: 206 GLLASCYSSGQIQLWD------LKKYSNSKLEM-DTPLLNVDFDALGVNDVNWHPSHDSI 258

Query: 77  LFTTATSNSVKIFDIHSTKEVATIHSQ---GNVPFPSLDSRHGLLACGTELKGVDAAIYI 133
           L  +  SN + +FD     E+   + +   G +     +S    L    + +G    I +
Sbjct: 259 LAASGESNIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSLLISGDSEG---RINL 315

Query: 134 YDIRKWD-QPVRSLVDSHHDDVTCLKWHPNDPNILLS-GSTDGYTNVYDLSEAE 185
           +D+RK D +P+++L   H   ++ L+W+PN   I+ S G  DG   ++D+S  E
Sbjct: 316 WDLRKLDGEPIKTL--HHGSSISTLEWNPNLETIVASAGQDDGLVKLWDVSTDE 367

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 142 PVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVINFASIHS 201
           PVR L   H  DV C+ +HPN    + +GS+D  + ++DLS     DS+   I  +S  +
Sbjct: 837 PVRILA-GHLSDVDCVSFHPNG-QYVFTGSSDKTSRMWDLSSG---DSVRLFIGHSSAVT 891

Query: 202 CGWLSP 207
              +SP
Sbjct: 892 ATAVSP 897

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 74/178 (41%), Gaps = 24/178 (13%)

Query: 19  ALKLQPLQHGNNGLLTSLSNG---------EVHYLD--PSTLTTIQKY-NISETSINDLQ 66
            + L P+  G++ + T   NG         E++ +D  P +   I +  N  E  I  L+
Sbjct: 9   GVSLNPIYAGSSAVATVSENGTILATPMLDEINIIDLTPGSRNIIHRISNEDEQEITALK 68

Query: 67  LINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKG 126
           L    P    L   + +  +KIF + + K V ++           DS   LLA G    G
Sbjct: 69  L---TPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVG----G 121

Query: 127 VDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPN-DPNI--LLSGSTDGYTNVYDL 181
            D +I + DI   +  +      H   ++ LK++   D  I  L SG T+G   V+DL
Sbjct: 122 TDGSIIVVDIE--NGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWDL 177

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1310

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 7/84 (8%)

Query: 129 AAIYIYDIRKWDQPVRSLVDS---HHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAE 185
             I IYDI K ++  ++L+ S   H   V    ++  D N+L+SG  DG   ++DL    
Sbjct: 203 TVISIYDINKAEKLDKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCIKIWDLRTGS 262

Query: 186 EEDSLHQVINFA----SIHSCGWL 205
              S    IN      SI    W+
Sbjct: 263 LNGSTRSDININTASDSIRDVKWM 286

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEA 184
           I I D+R  + P  +L   H   V  +KWHP   N+LLS S D     +DL+ A
Sbjct: 372 ILILDMRNPESPALTL-KGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDLNTA 424

>KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1299

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 31/65 (47%), Gaps = 3/65 (4%)

Query: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEE 187
           D +I I+D+R  + P++ L   H   V  L W   D  +LLS   D   NV  L   EE 
Sbjct: 228 DPSILIWDLRNANVPMQVLSQPHTKGVLSLDWCKQDETLLLSSGRD---NVCVLWNPEEG 284

Query: 188 DSLHQ 192
            SL Q
Sbjct: 285 QSLTQ 289

>TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {ON}
           Anc_2.469 YMR093W
          Length = 509

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 4/124 (3%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N +  I  NP  +  F   +S  V+IF   + + V T     +V + +     G L    
Sbjct: 40  NSVTHIAFNPQHTHDFAVTSSTRVQIFSSRTRQVVKTFSRFKDVVYSASFRNDGKLLVAG 99

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           +  G+ +    Y+ R     +   V +H   VT  K+H  D   L++ S D  T ++D+S
Sbjct: 100 DATGLVSVFDSYNPRTLLLSIN--VSTHPVHVT--KFHSQDSKTLVTASDDRVTRLWDIS 155

Query: 183 EAEE 186
            A E
Sbjct: 156 YAYE 159

>Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 141 QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSL 190
           QP+   +D H   +  ++WHP   N ++S + DG+   +  S+ E E  L
Sbjct: 208 QPLAQKLDPHKGKIGAVQWHPESNNQIISCAEDGHIKNFQYSKEEGEIKL 257

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 126 GVDAAIYIYDIRKW---DQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           G   ++ +YDI K    D P+ + +  H   +  + ++ +  N+L+SG  DG   V+DL 
Sbjct: 201 GTSTSVSVYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGCIKVWDLR 260

Query: 183 EAEE 186
            ++ 
Sbjct: 261 SSQR 264

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 89/207 (42%), Gaps = 30/207 (14%)

Query: 1   MSSSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLT--TIQKYNIS 58
           +S +++L+N ++F S++W   ++         L +L   +V  +  S L   TI K N S
Sbjct: 109 LSCNWNLINKQTFVSSSWDGTVKIWTPNRKESLRTL---QVQPVMQSQLVDNTIAKTNGS 165

Query: 59  ETSI----NDLQLINHNPTSSPLFTTATSNS-VKIFDIH----STKEVATIHSQGNVPFP 109
             +I    N +     +P    L    + NS V +FD+     + K+   +   G+    
Sbjct: 166 RGTISANKNCIYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLT 225

Query: 110 SLDSRHGLLACGTELKGVDAAIYIYDIRKW-------------DQPVRSLVDSHHDDVTC 156
              +++      T   GVD++I I+DIR                  +  +  +H   V  
Sbjct: 226 CDFNKYRPTVVATS--GVDSSIRIWDIRMLVNLGPQSQHINSSAACINEITRAHELAVRK 283

Query: 157 LKWHPNDPNILLSGSTDGYTNVY-DLS 182
           + W P+ PN+LLS S D   +V+ DLS
Sbjct: 284 VAWSPHHPNVLLSASYDMTCSVWQDLS 310

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 7/95 (7%)

Query: 86  VKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRS 145
           ++I+D+   K + T+    +     L     +L  G+     D  I   D+R  D P   
Sbjct: 492 IEIYDVTKRKCIRTLSGHTDRT-ACLSWNSHILTSGSR----DRTILHRDVRMKD-PFFE 545

Query: 146 LVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180
            + SH  +V  LKW+ +D N L+SG  D   N+YD
Sbjct: 546 RIKSHTQEVCGLKWNESD-NKLVSGGNDNTVNIYD 579

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 62/308 (20%), Positives = 114/308 (37%), Gaps = 47/308 (15%)

Query: 44  LDPSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTATSN-SVKIFDIHSTKEVATIHS 102
           L P  L      N      N    +  NP    L +TA+S+ SV IFD     +    H 
Sbjct: 103 LPPKNLQIQLTINFPHGDCNRATYLPQNPD---LISTASSDGSVYIFDRTKRGKSPISHL 159

Query: 103 QGNVPFPSLDSRHG-------LLACGTELKGVDAAIY------IYDIRKWD-------QP 142
           +G      L + +G        L    +++G+ A+ Y      I+DI+K++       QP
Sbjct: 160 RGPFEAQLLPNNNGSPIGETVALDWNRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQP 219

Query: 143 VRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVINFASIHSC 202
               +D+       + W P+   +L     D    ++D              N AS  +C
Sbjct: 220 SADFIDTESQGFNDVSWMPSHDCLLSIAREDNIMTLFDTRTNGNIAQTGPSTNHASGINC 279

Query: 203 GWLSPRRIFTLSH------METFAIHELNDKSDTLKEPQPIDMGDVREKWGCDYVVDVYP 256
              +P +   ++       ++ + I +L++   T+    P+   +   +          P
Sbjct: 280 TKFNPSQPLLVATASGDGLVQLWDIRKLHNPIKTINCESPLSALEWNPQ---------LP 330

Query: 257 GFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIPSHDSVMMYTCGE 316
             +ATG  ++  G +KL    +  +  T+   + G      + D+    HD  +M +   
Sbjct: 331 TVLATGGQED--GLVKLWNASNGQLLFTHGGHMLG------VNDIAWSPHDKWLMCSVAN 382

Query: 317 DGNVKLWK 324
           D +  LWK
Sbjct: 383 DNSTHLWK 390

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 11/79 (13%)

Query: 134 YDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQV 193
           +DIR+ +Q V   +++H     CL WHPN  + + +G  DG   ++ + +         V
Sbjct: 325 FDIRQPNQ-VEKKINAHTGPGLCLNWHPNQ-DYIATGGRDGKCCIWYIGD---------V 373

Query: 194 INFASIHSCGWLSPRRIFT 212
           +N A + S G ++P  + T
Sbjct: 374 VNDAPVTSLGSMTPNTLHT 392

>ZYRO0C14762g Chr3 complement(1148438..1149568) [1131 bp, 376 aa]
           {ON} highly similar to uniprot|P38328 Saccharomyces
           cerevisiae YBR234C ARC40 Essential subunit of the ARP2/3
           complex which is required for the motility and integrity
           of cortical actin patches
          Length = 376

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 18/26 (69%), Gaps = 1/26 (3%)

Query: 154 VTCLKWHPNDPNILLSGSTDGYTNVY 179
           VTCL WH N   +L SGSTDGY  V+
Sbjct: 152 VTCLSWHENGV-LLASGSTDGYMRVF 176

>CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis
          Length = 640

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 7/95 (7%)

Query: 86  VKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRS 145
           V+I+D+   K + T+    +     L   + +L+ G+     D  I   D+R  D P   
Sbjct: 400 VEIYDVTKEKCIRTLSGHLDR-VACLSWNNHILSSGSR----DRTILHRDVRMAD-PFFE 453

Query: 146 LVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180
            +++H  ++  LKW+ ND N L SG  D    VYD
Sbjct: 454 KIETHEQEICGLKWNTND-NKLASGGNDNMVFVYD 487

>KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 aa]
           {ON} weakly similar to uniprot|Q12206 YOR229W
           Saccharomyces cerevisiae WTM2 WD repeat containing
           transcriptional modulator 2
          Length = 449

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%)

Query: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           D  I  YDIR   +P+ ++ + H   +TC    P    + ++GS  G   ++DL
Sbjct: 254 DNGIRFYDIRGDGKPLWTVFEPHDGKLTCYDVSPTLETLFITGSDTGVLKLWDL 307

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 29/59 (49%)

Query: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
           D  I ++D+R    P++++   H   +  L W   D N+LLS   D    +++   A++
Sbjct: 228 DPVILVWDLRNAKAPLQAMSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWNPQTAQK 286

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEE 187
           I I D+R  + P+ +L   H   V  +KWHP   N+LLS   D     +DL+ +  E
Sbjct: 375 IIILDMRNPESPILNL-QGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDLNSSFME 430

>TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6.135
           YGL116W
          Length = 689

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 13/97 (13%)

Query: 115 HGLLACGTELK---------GVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPN 165
           H    CG E K         G D A+ I+D R    P + +  +H+  V  +KW PN  N
Sbjct: 415 HSGEVCGLEYKSDGLQLASGGNDNAVIIWDTRT-SMP-QFIKHNHNAAVKAIKWSPNIAN 472

Query: 166 ILLSGS--TDGYTNVYDLSEAEEEDSLHQVINFASIH 200
           +L +G   +D Y + ++ +   +  S++     +S+H
Sbjct: 473 LLATGGGQSDQYVHFWNTTTGNKTGSINTGSQVSSLH 509

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 74/178 (41%), Gaps = 24/178 (13%)

Query: 19  ALKLQPLQHGNNGLLTSLSNG---------EVHYLD--PSTLTTIQKY-NISETSINDLQ 66
            + L P+  G++ + T   NG         E++ +D  P +   + K  N  E  I  L+
Sbjct: 9   GISLNPIYAGSSAVATVSENGKILATPVLDEINIIDLTPGSRKILHKISNEDEQEITALK 68

Query: 67  LINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKG 126
           L    P    L   + +  +KIF + + K V ++           DS   LLA G    G
Sbjct: 69  L---TPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVG----G 121

Query: 127 VDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPN---ILLSGSTDGYTNVYDL 181
            D +I + DI   +  +      H   ++ LK++    +   +L SG T+G   V+DL
Sbjct: 122 TDGSIIVVDIE--NGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDL 177

>KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {ON}
           weakly similar to uniprot|Q03177 Saccharomyces
           cerevisiae YMR102C Protein of unknown function
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 780

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 2/39 (5%)

Query: 137 RKW--DQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTD 173
           R W  D+P       H D VTC K+HPND    LSG  D
Sbjct: 295 RLWHCDRPKALKTFEHPDFVTCAKFHPNDDRFFLSGCLD 333

>ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {ON}
           highly similar to uniprot|Q04491 Saccharomyces
           cerevisiae YLR208W SEC13 Component of both the Nup84
           nuclear pore sub-complex and of the COPII complex (Sar1p
           Sec13p Sec16p Sec23p Sec24p Sec31p Sfb2p and Sfb3p)
           which is important for the formation of ER to Golgi
           transport vesicles
          Length = 294

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 6/80 (7%)

Query: 249 DYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIPSHDS 308
           D V+D Y   +AT  S +    +K+  ++ ET  L  ++     H+  V R  +      
Sbjct: 14  DAVLDYYGRRLATCSSDKT---IKIFEVEGETHKLVETL---SGHEGPVWRVAWAHPKFG 67

Query: 309 VMMYTCGEDGNVKLWKNNNG 328
            ++ +C  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 75/167 (44%), Gaps = 25/167 (14%)

Query: 38  NGEV-----HYLDPSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTATSNS-VKIFDI 91
           NGE+     + LD + LT      +  T  N++  +  N + S +F+ +++ S V IFD+
Sbjct: 134 NGEILIWDLNNLDKTPLTP----GMPMTPTNEITSLAWNKSLSHVFSCSSNTSNVSIFDL 189

Query: 92  HSTKEVATIHSQGNVPFPSLDSRHGLLA--------CGTELKGVDA----AIYIYDIRKW 139
            + KEV  IH     P  ++ S   ++           T     D+    +I+I+D+R  
Sbjct: 190 KAKKEV--IHLNYTNPVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNS 247

Query: 140 DQPVRSLV-DSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAE 185
             P++ L  D H + +  L W   D N+LLS   D    +++    E
Sbjct: 248 HTPLQILSKDGHSNGILSLDWCSTDENLLLSSGRDNSVMLWNPENGE 294

>AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL247C
          Length = 438

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
           + I D+R    P+  L++ H   V  LKWHP+ PN+L +   D     +DL E
Sbjct: 324 VIILDMRYPGSPML-LLEGHAAPVNQLKWHPSKPNVLATCGDDCQILYWDLLE 375

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 12/118 (10%)

Query: 73  TSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHG-LLACGTELKGVDAAI 131
           TSS + T A  N+ +I+D  +   + T+    N       S  G ++A G+    +DA I
Sbjct: 153 TSSRMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGS----MDATI 208

Query: 132 YIYDIRKWDQPVRSLVDSHHDDVTCLKWH------PNDPNILLSGSTDGYTNVYDLSE 183
            ++D  K  Q +   +  H   +T L W       P +   L S S DG   ++D + 
Sbjct: 209 RLWDSEK-GQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTR 265

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 67/160 (41%), Gaps = 14/160 (8%)

Query: 73  TSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHG-LLACGTELKGVDAAI 131
           TSS + T A  N+ +I+D  +   + T+    N       S  G L+A G+    +D  I
Sbjct: 155 TSSRMVTGAGDNTARIWDCDTQTPMVTLSGHTNWVLCVAWSPDGELIATGS----MDNTI 210

Query: 132 YIYDIRKWDQPVRSLVDSHHDDVTCLKWHP------NDPNILLSGSTDGYTNVYDLSEAE 185
            +++ +   +P    +  H   +T L W P       +   L + S DG   V+D     
Sbjct: 211 RLWEGKN-GKPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIKVWDTGRRV 269

Query: 186 EEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELN 225
              +L   +N  S+    W     +++ SH +T  + ++N
Sbjct: 270 CLYTLSGHVN--SVSCVKWGGKNLLYSGSHDKTVRVWDMN 307

>TBLA0E03890 Chr5 complement(977425..981744) [4320 bp, 1439 aa]
          {ON} Anc_2.253 YIL115C
          Length = 1439

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%)

Query: 60 TSINDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVA 98
          TSI++L ++N+  TS+PLF  ATS  V I D+ S +  A
Sbjct: 36 TSIHNLDILNYPSTSTPLFIAATSTKVIIGDLQSLRNFA 74

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 59/122 (48%), Gaps = 12/122 (9%)

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATI----HSQGNVPFPSLDSRHGLLA 119
           D++  + +P    + + +  N +K++D  + + V+TI    H+     F    ++  LLA
Sbjct: 207 DVKSCDWHPKMGLIVSGSKDNLIKLWDPRTGRNVSTILGLKHTVIKTKFQP--TQGNLLA 264

Query: 120 CGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVY 179
             ++    D +I IYD+R+  + ++++ D    D   L WHP +  I   G  +G    +
Sbjct: 265 VVSK----DKSIKIYDMRQHMRELQTIRDDM--DYMSLSWHPINETIFSVGCYNGAIKHF 318

Query: 180 DL 181
           DL
Sbjct: 319 DL 320

>AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR057C (PWP2)
          Length = 922

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 38/216 (17%), Positives = 74/216 (34%), Gaps = 53/216 (24%)

Query: 4   SYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSIN 63
           S+ +     F + N  +K       +N L+   SNGE    +    T IQ+ ++ + ++N
Sbjct: 258 SWRITKKNYFYAKNAKVKCAAFHADSNMLIVGFSNGEFRMYELPDFTFIQQLSMGQNAVN 317

Query: 64  D----------------------------------------LQLINHNPTSSPLFTTATS 83
                                                    L  + ++P  + + T A  
Sbjct: 318 TVAVNRSGEWLAFGSSTLGQLLVYEWQSESYILKQQGHFDALNALAYSPDGARIVTAAED 377

Query: 84  NSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWD--- 140
             +KI+DI S   +AT     +       +++G +   + L G         ++ WD   
Sbjct: 378 GKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQIMFSSSLDGT--------VKAWDLMR 429

Query: 141 -QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGY 175
            +  R+   +     +CL   P    ++ +GS D Y
Sbjct: 430 FRNFRTFTATERIQFSCLAADPT-GEVVCAGSLDNY 464

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 89/197 (45%), Gaps = 27/197 (13%)

Query: 31  GLLTSLSNGEVHYLDPST---LTTIQKYNI-SETSINDLQLINHNPTSSPLFTT-ATSNS 85
            LLT   +G V     ++   +T  Q + + +  SI D   I  +P+ + +F T      
Sbjct: 300 ALLTGDCSGRVFLTQRTSSKWITDKQPFTVDNNKSIED---IKWSPSENTVFATCGVDGH 356

Query: 86  VKIFDIHSTKEVATIH---SQGNVPFPSLDSRHG-LLACGTELKGVDAAIYIYDIRKWDQ 141
           V+I+DI S K    +    S  +V   S + +   LLA G +    +    ++D+R++  
Sbjct: 357 VRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDD----NGTWGVWDLRQFSN 412

Query: 142 ------PVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS-EAEEEDSLHQVI 194
                 PV +  D H   +T + ++P D +I+   S D    ++DLS EA++E+   Q  
Sbjct: 413 QQGGVSPV-AQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQA- 470

Query: 195 NFASIHSCGWLSPRRIF 211
             A +     + P+ +F
Sbjct: 471 --AEVKELQQIPPQLLF 485

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 100/211 (47%), Gaps = 29/211 (13%)

Query: 18  WALKLQPLQHGNNGLLTSLSNGEVHYLDPST---LTTIQKYNI-SETSINDLQLINHNPT 73
           +AL   PL      LLT   +G+++    +T   +T  Q + + +  S+ D+Q    + T
Sbjct: 282 YALDWSPLIK-TGALLTGDCSGQIYLTQRNTSKWVTDKQPFTVGNNKSVEDIQW---SRT 337

Query: 74  SSPLFTTATSNS-VKIFDIHSTK---EVATIHSQGNVPFPSLDSRHG-LLACGTELKGVD 128
            + +F +   +  V+I+D  S +    ++   S  +V   S + + G LLA G +    +
Sbjct: 338 EATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDD----N 393

Query: 129 AAIYIYDIRKWD-------QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
            +  ++D+R++        QPV +  D H   +T + ++P + +I+   S D    ++DL
Sbjct: 394 GSWGVWDLRQFTPDNINNVQPV-AQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDL 452

Query: 182 S-EAEEEDSLHQVINFASIHSCGWLSPRRIF 211
           S EA++E+   Q      + S   + P+ +F
Sbjct: 453 SVEADDEEIKQQAAETKELES---IPPQLLF 480

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 126 GVDAAIYIYDIRK---WDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           G   ++ IYDI K    + P+ +++  H   +  + ++    ++L+SGS DG   V+DL 
Sbjct: 185 GTSTSVSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLISGSQDGCIKVWDLR 244

Query: 183 EAE 185
            ++
Sbjct: 245 SSQ 247

>ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR093W
          Length = 518

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 4/124 (3%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N +  I  NP     F   +S  V++F   + + + T     +V + S     G L    
Sbjct: 40  NAVTHIEFNPQHPHDFAVTSSTRVQLFSSRTRQVIKTFSRFKDVVYSSSFRPDGKLLAAG 99

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           +  G+ +    Y+ R     +++   +H   VT  K+HP D   L++ + D    V+D+S
Sbjct: 100 DATGLVSVYDSYNPRNLLVSIKA--STHPAHVT--KFHPLDKQTLVTATDDRVVRVWDIS 155

Query: 183 EAEE 186
            A E
Sbjct: 156 HAYE 159

>Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 110 SLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLS 169
           SL+   GLLA G    G D +  ++DI   D+PV+  V  H   V  + + P   ++L +
Sbjct: 397 SLNEHSGLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLAT 452

Query: 170 G 170
           G
Sbjct: 453 G 453

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 76/186 (40%), Gaps = 33/186 (17%)

Query: 28  GNNGLLTSLSN-GEVHY--LDPSTL------TTIQKYNISETSINDLQLINHNP------ 72
           G NG+L  L      H+   DP+ L      TT   +++   +    QLI H+       
Sbjct: 202 GTNGVLGELPPITSFHWNPTDPNLLISSSIDTTCIVWDLQSANYIKTQLIAHDSEVFDVR 261

Query: 73  ---TSSPLFTTATSN-SVKIFDI----HSTKEVATIHSQGNVPFPSLDSRHGLLACGTE- 123
               S+ LF +   + SV++FD+    HST         G    PS      LL      
Sbjct: 262 FLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEPSP 321

Query: 124 -------LKGVDAA-IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGY 175
                     +D++ + I D+R    P+ +L ++H   +  +KWHP   N+LLS S D  
Sbjct: 322 FDPNVIATFAIDSSKVLILDMRSPGSPLLTL-EAHTAPINQIKWHPTRRNVLLSASDDCQ 380

Query: 176 TNVYDL 181
              +DL
Sbjct: 381 VLYWDL 386

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 154 VTCLKWHPNDPNILLSGSTDGYTNVYDLSEA 184
           +T   W+P DPN+L+S S D    V+DL  A
Sbjct: 213 ITSFHWNPTDPNLLISSSIDTTCIVWDLQSA 243

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 61/135 (45%), Gaps = 22/135 (16%)

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLAC--- 120
           D++  + +PT   + + +  N +K++D  S + ++TI          L  +H +++    
Sbjct: 211 DVRSCDWHPTMGLIASGSKDNLIKLWDPRSGQCISTI----------LGCKHTIISTKFQ 260

Query: 121 ---GTELKGV--DAAIYIYDIRKWDQPVRSL-VDSHHDDVTCLKWHPNDPNILLSGSTDG 174
              G  L  +  D +  ++DIR   Q ++ L V     D   L WHP + +I   G  DG
Sbjct: 261 PTKGNMLAVISKDKSCRVFDIR---QNMKELAVYRDESDYMSLTWHPINESIFTVGCYDG 317

Query: 175 YTNVYDLSEAEEEDS 189
               +DL +  ++ S
Sbjct: 318 SMKHFDLMQEPQDSS 332

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEE 187
           +Y++D+RK   P+ S+++ H   V  + ++P +   ++S   DG    +D ++ E+E
Sbjct: 182 VYVWDVRKGTSPL-SVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 126 GVDA-AIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           G+D  AI I D+R    PV  ++  H   V  +KWHP+ P +LLS   D     +DL+
Sbjct: 433 GLDKKAILILDMRNPGVPVL-VLSGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDLN 489

>Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W
           (REAL)
          Length = 297

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 249 DYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIPSHDS 308
           D V+D Y   +AT  S +    +K+  ++ ET  L +++     H+  V R  +      
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKIFEVEGETHKLVDTLT---GHEGPVWRVDWAHPKFG 67

Query: 309 VMMYTCGEDGNVKLWKNNNG 328
            ++ +C  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} similar
           to uniprot|P18851 YOR212W Saccharomyces cerevisiae STE4
           G protein beta subunit
          Length = 421

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 48/111 (43%), Gaps = 13/111 (11%)

Query: 77  LFTTATSNSVKIFDIHSTKEVATIHSQ-GNV-----PFPSLDSRHGLLACGTELKGVDAA 130
           + T +   +  ++DI   K VA      G+V     P P       + A G    G D  
Sbjct: 188 VITASGDMTCALWDIPKAKRVAEFSDHLGDVLALALPPPKTQPEKTVFASG----GSDGY 243

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           +YI+D R         V     DV+ LK+  N+ N +L+G+ DG   ++DL
Sbjct: 244 VYIWDTRMRTAGQSFFVS--ESDVSTLKFF-NNGNAILTGTDDGIARMFDL 291

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 73/175 (41%), Gaps = 18/175 (10%)

Query: 19  ALKLQPLQHGNNGLLTSLSNG---------EVHYLDPSTLTTIQKYNISETSINDLQLIN 69
            + L P+  G++ + T   +G         E++ +D +  +    + IS     ++  + 
Sbjct: 9   GVSLNPIYAGSSAVATVSEDGKILATPILDEINIIDLTADSRKILHKISNEDEQEITALQ 68

Query: 70  HNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDA 129
             P    L   + +  +KIF + + K V ++           DS   LLA G    G D 
Sbjct: 69  LTPDGQYLTYVSQAQLLKIFQLKTGKVVRSMKISSPSYILDTDSTSTLLAVG----GTDG 124

Query: 130 AIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPN---ILLSGSTDGYTNVYDL 181
           +I + DI   +  +   +  H   ++ LK++    +   +L SG T+G   V+DL
Sbjct: 125 SIIVVDIE--NGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDL 177

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           I I D+R  D P+  +++ H   +  +KWHP   N L+S S D     +D+S
Sbjct: 368 ILILDMRNPDSPL-VVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDIS 418

>Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178W
           (REAL)
          Length = 470

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 59/132 (44%), Gaps = 7/132 (5%)

Query: 68  INHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGV 127
           + ++P+   + + +   + +++D  + +E+          F       G L C     G+
Sbjct: 276 VKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHSKGVFSLSFQCDGSLVCSG---GM 332

Query: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEE 187
           D+   ++DIR     V +L   H   V  + W PN   +  +G  DG  NV+D+ +  +E
Sbjct: 333 DSLTMLWDIRS-GSKVMTLA-GHSKPVYTVAWSPNGYQVA-TGGGDGLINVWDIRQ-RDE 388

Query: 188 DSLHQVINFASI 199
             L+Q++   +I
Sbjct: 389 GQLNQILAHRNI 400

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 141 QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEE 187
           QP+   +DSH   +  ++WHP+  N ++S + DG    +     E E
Sbjct: 213 QPLSQKLDSHVGKIGAVEWHPSSNNQMVSCAEDGLIKNFQYLNKEGE 259

>TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.469
           YMR093W
          Length = 511

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 4/124 (3%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N +  +  NP     F   +S  V+IF   + + V T     +V + +     G L    
Sbjct: 40  NSVTHLAFNPQHPYDFAVTSSTRVQIFSSRTRQVVKTFSRFKDVVYSASFRNDGKLLVAG 99

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           +  G+ +    Y+ R     + +   SH   VT  K+H +D   LL+ S D  T ++D+S
Sbjct: 100 DATGLVSVYDSYNPRTLLLSINA--SSHPTHVT--KFHAHDTTTLLTSSDDRVTRLWDIS 155

Query: 183 EAEE 186
            A E
Sbjct: 156 HAYE 159

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 72/176 (40%), Gaps = 27/176 (15%)

Query: 22  LQPLQHGNNGLLTSLSNGE-----------VHYLDPST--LTTIQKYNISETSINDLQLI 68
           L+P+  G+  + T+  +G            V  L P+   L TI+  N  E  I  L+L 
Sbjct: 12  LRPIYAGSGAICTTSEDGSILATPVLDEINVIQLKPTQKLLHTIE--NDDEQEITALRL- 68

Query: 69  NHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVD 128
              P    L   + +  +KIF + S K   ++           DS   L+A G    G D
Sbjct: 69  --TPDGRYLCYVSQAQQLKIFSLDSMKITRSMKISSPSYVMDSDSTSTLIAIG----GTD 122

Query: 129 AAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHP---NDPNILLSGSTDGYTNVYDL 181
            +I + D+   +  +      H   ++ LK+H     D  +L SG T+G   V+DL
Sbjct: 123 GSISVVDVE--NGYITHSFKGHGGTISSLKFHGELNGDKWLLASGDTNGVAKVWDL 176

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 126 GVDA-AIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTD 173
           G D+ ++ I D+R    PV +L D H   +  +KWHP   N +LS S D
Sbjct: 385 GADSNSVLILDMRNPGTPVLTL-DGHSAPINQIKWHPTKKNTILSSSDD 432

>ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004C RPN14 Putative non-ATPase subunit of the 19S
           regulatory particle of the 26S proteasome localized to
           the cytoplasm
          Length = 391

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 26/36 (72%), Gaps = 1/36 (2%)

Query: 148 DSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
           ++H D++TCLK+ P+   +LLSGSTD    ++ L++
Sbjct: 121 EAHLDEITCLKFFPSG-QVLLSGSTDMRLKIWSLAD 155

>SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|Q04305 Saccharomyces cerevisiae
           YMR093W UTP15 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 515

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 51/122 (41%), Gaps = 4/122 (3%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N +  +  NP     F   +S  V+IF   + + + T     +V + +     G L C  
Sbjct: 40  NSVTHLAFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAG 99

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           +  G+   + +YD       + S+  S H      K+HP +   L+S S D    ++D+S
Sbjct: 100 DATGL---VSVYDSYNPHTLLLSIKASSHPTHVS-KFHPMENKTLISASDDRTVRLWDIS 155

Query: 183 EA 184
            A
Sbjct: 156 HA 157

>Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON}
           (90456..91340) [885 nt, 295 aa]
          Length = 294

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 249 DYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIPSHDS 308
           D V+D Y   +AT  S +    +K+  ++ E+  L  ++V    H+  V R  +      
Sbjct: 14  DTVLDYYGKRLATCSSDKT---IKIFEIEGESHKLVETLV---GHEGPVWRVDWAHPKFG 67

Query: 309 VMMYTCGEDGNVKLWKNNNG 328
            ++ +C  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W
           (REAL)
          Length = 297

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 249 DYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIPSHDS 308
           D V+D Y   +AT  S +    +K+  ++ ET  L +++     H+  V R  +      
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKIFEVEGETHKLIDTLT---GHEGPVWRVDWAHPKFG 67

Query: 309 VMMYTCGEDGNVKLWKNNNG 328
            ++ +C  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1321

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 129 AAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEED 188
            A+  +D+R+ +QP +  +++H     CL WHP+  + + SG  DG   ++   +  E+ 
Sbjct: 328 GALLKFDMRQPNQPEKR-INAHTGPGLCLNWHPHQ-DYIASGGRDGKCCLWYFGDRMEQS 385

Query: 189 SLHQVINFASIH 200
           + +   N A  H
Sbjct: 386 ATNLQANSAYQH 397

>YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}
           SEC13Structural component of three distinct complexes;
           subunit of the Nup84 nuclear pore sub-complex (NPC), the
           COPII vesicle coat, and the Seh1-associated (SEA)
           complex; the COPII vesicle coat is required for vesicle
           formation in ER to Golgi transport; the Nup84 subcomplex
           contributes to nucleocytoplasmic transport, NPC
           biogenesis and processes that may require localization
           of genes or chromosomes at the nuclear periphery
           including transcription; homologous to human SEC13
          Length = 297

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 249 DYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIPSHDS 308
           D V+D Y   +AT  S +    +K+  ++ ET  L +++     H+  V R  +      
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKIFEVEGETHKLIDTLT---GHEGPVWRVDWAHPKFG 67

Query: 309 VMMYTCGEDGNVKLWKNNNG 328
            ++ +C  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar to
           Ashbya gossypii ADR077C
          Length = 1201

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 67/138 (48%), Gaps = 14/138 (10%)

Query: 68  INHNPTSSPLFTTATSN-SVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKG 126
           ++ +PT  PLF +   + +VK++ + S K + T+H  G++ +      H       EL  
Sbjct: 59  VDFHPTQ-PLFVSGGDDYTVKVWSLDSRKCLFTLH--GHLDYVRTVFFH------NELPW 109

Query: 127 VDAAIYIYDIRKWDQPVR---SLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
           + +A     IR W+   R   + +  H+  V C ++HPN+ ++++S S D    V+D+S 
Sbjct: 110 IISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPNE-DLVISASLDETVRVWDISG 168

Query: 184 AEEEDSLHQVINFASIHS 201
             +  S     NF  + S
Sbjct: 169 LRKRHSAPGSQNFDEVIS 186

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1333

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 134 YDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEED 188
           +DIR+ +Q V   +++H     CL WHPN  N + +G  DG   V++L +    D
Sbjct: 319 FDIRQPNQ-VEQKINAHTGPGLCLNWHPN-LNYITTGGRDGKLCVWNLGDRNISD 371

>Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W
           (WTM2) - Transcriptional modulator [contig 67] FULL
          Length = 381

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 25/54 (46%)

Query: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           D  I  YD R   +P+  + D H   +TC    P    + ++GS  G   ++DL
Sbjct: 186 DNKIRFYDTRGDGKPLWEVCDPHDGRLTCFDVSPALETLFVTGSDTGVLKLWDL 239

>Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar to
           Ashbya gossypii ABL044C
          Length = 517

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 53/122 (43%), Gaps = 4/122 (3%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N +  I+ NP     F   +S  V++F   + + + T     +V + +   + G L    
Sbjct: 40  NAVTHISFNPQHPHDFAVTSSTRVQVFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLVAG 99

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           +  G+ +    Y+ R  +Q V     SH   VT  K+HP D   L + + D    ++D+S
Sbjct: 100 DATGLVSIYDSYNPR--NQLVTFQASSHPTHVT--KFHPMDSKSLTTANDDRVVRLWDIS 155

Query: 183 EA 184
            A
Sbjct: 156 HA 157

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180
           D  + ++DI    QP+  L  +  D V  + + P  P++++SGS DG   +YD
Sbjct: 146 DRVVRLWDISHAYQPILELTGAS-DYVRSICFLPGTPHMVVSGSYDGVIRLYD 197

>NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {ON}
           Anc_2.469 YMR093W
          Length = 514

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 60/146 (41%), Gaps = 12/146 (8%)

Query: 46  PSTLTTIQKY--NISETSI----NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVAT 99
           P   T  Q+Y    S T +    N +  I  NP     F   +S  V+IF   + + + T
Sbjct: 17  PQQTTPEQRYWRQFSSTQLVKEHNSVTHIAFNPQHPHDFAVTSSTRVQIFSSRTRQVIKT 76

Query: 100 IHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSL-VDSHHDDVTCLK 158
                +V + +     G L C  +  G+   + IYD       + S+   +H   VT  K
Sbjct: 77  FSRFKDVVYSASFRSDGKLLCAGDATGL---VSIYDSYNPRTILLSINASTHPTHVT--K 131

Query: 159 WHPNDPNILLSGSTDGYTNVYDLSEA 184
           +H  D   L++ S D    ++D+S A
Sbjct: 132 FHSQDNKTLITASDDRVIRLWDISNA 157

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 128 DAAIYIYDIRKWDQPVRSLVDS--HHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180
           D  I ++DI    QP   L  +  +   VTC+   P+ P++++SGS DG   +YD
Sbjct: 146 DRVIRLWDISNAYQPTLELTAATDYVRSVTCV---PSAPHMIVSGSYDGVVRLYD 197

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 69/160 (43%), Gaps = 14/160 (8%)

Query: 73  TSSPLFTTATSNSVKIFDIHSTKEVATIHSQGN-VPFPSLDSRHGLLACGTELKGVDAAI 131
           TSS + T A  N+ +I+D  +    AT+    N V   S      ++A G+    +D  I
Sbjct: 155 TSSRMVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCPNGEVIATGS----MDNTI 210

Query: 132 YIYDIRKWDQPVRSLVDSHHDDVTCLKWH------PNDPNILLSGSTDGYTNVYDLSEAE 185
            ++D +   +P+   +  H   +T L W       P +   L S S DG   ++D++   
Sbjct: 211 RLWDSKD-GKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRV 269

Query: 186 EEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELN 225
              ++    N  S+    W     I++ SH +T  + ++N
Sbjct: 270 CLYTMSGHTN--SVSCIKWSGQGIIYSGSHDKTVRVWDMN 307

>TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.77
           YGR145W
          Length = 713

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 9/101 (8%)

Query: 89  FDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQP----VR 144
           F +   +E AT    G V   S++S +GL+A G E    D+ +  +D R   +     + 
Sbjct: 176 FKLDINEEKATAVGGGGVNHVSINSANGLVAVGLE----DSVVEFWDPRARSRVSKLYLE 231

Query: 145 SLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAE 185
           + +D+    VT   +  ND      G+++GY+ +YDL  +E
Sbjct: 232 NTIDNSDFTVTTTSFR-NDGINFACGTSNGYSYLYDLRASE 271

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 126 GVDAAIYIYDIRKW---DQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           G   ++ IYDI +    D P   ++  H   +  + ++    ++L+SGS DG   V+DL 
Sbjct: 185 GTSTSVSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCIKVWDLR 244

Query: 183 EAE 185
            ++
Sbjct: 245 SSQ 247

>SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q12021 Saccharomyces cerevisiae YDR030C RAD28
           Protein involved in transcription-coupled repair
           nucleotide excision repair of UV-induced DNA lesions
           homolog of human CSA protein
          Length = 478

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 46/107 (42%), Gaps = 26/107 (24%)

Query: 92  HSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQP--------- 142
           +ST++  T+HS+  VP               ++ G+   +  Y   K +QP         
Sbjct: 143 NSTRQPQTLHSKVKVPL-------------YKVPGMSREMMSYVHNKTNQPPTVVKRTSS 189

Query: 143 ----VRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAE 185
                +   DSH   +T +KW+ +D  +  +GS+D    ++D +E E
Sbjct: 190 TLERQKEEQDSHSFAITSIKWYSHDNGMFFTGSSDREVKIWDTNEFE 236

>NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.338
           YLR208W
          Length = 300

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 249 DYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIPSHDS 308
           D V+D Y   +AT  S +    +K+  ++ E   L ++++    H+  V R  +      
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKIFEVEGENYKLIDTLI---GHEGPVWRVDWAHPKFG 67

Query: 309 VMMYTCGEDGNVKLWKNNNG 328
            ++ +C  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {ON}
           similar to uniprot|Q03177 Saccharomyces cerevisiae
           YMR102C Protein of unknown function transcription is
           activated by paralogous transcription factors Yrm1p and
           Yrr1p along with genes involved in multidrug resistance
          Length = 966

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%)

Query: 150 HHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAE 185
           H D VTC+K+HPND    +SG  D    ++ + + E
Sbjct: 435 HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDE 470

>Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W
           (REAL)
          Length = 297

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 249 DYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIPSHDS 308
           D V+D Y   +AT  S +    +K+  ++ ET  L +++     H+  V R  +      
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKVFEVEGETHKLIDTLT---GHEGPVWRVDWAHPKFG 67

Query: 309 VMMYTCGEDGNVKLWKNNNG 328
            ++ +C  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {ON}
           Anc_2.450 YKL121W
          Length = 908

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 150 HHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAE 185
           H D VTC+++HP D    +SG  D    ++ + E E
Sbjct: 367 HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402

>SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]
           {ON} similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 555

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 54/124 (43%), Gaps = 9/124 (7%)

Query: 86  VKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRS 145
           V+I+DI   K + T+    +     L   + +L  G+     D  I   D+R   +P   
Sbjct: 315 VEIYDIVKRKCIRTLSGHMDR-VACLSWNNHILTSGSR----DRKILHRDVR-MPEPYFE 368

Query: 146 LVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVINFASIHSCGWL 205
            V++H  +V  LKW+  D N L SG  D    VYD      + +L    + A++ +  W 
Sbjct: 369 QVETHTQEVCGLKWN-TDENRLASGGNDNVVYVYD--GTSRKPTLKLAEHTAAVKAIAWS 425

Query: 206 SPRR 209
             +R
Sbjct: 426 PHKR 429

>TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1300

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 64/140 (45%), Gaps = 12/140 (8%)

Query: 57  ISETSINDLQLINHNPTSSPLFTTATSNS-VKIFDIHSTKEVATIHSQGNVPFPSLDSRH 115
           ++ T + ++  +  N + S +F +A + S   I+D+ + KEV  IH     P  SL  + 
Sbjct: 155 MAMTPVEEITSLAWNQSLSHVFASAGNTSYASIWDLKAKKEV--IHLSYTSPSSSLKPQL 212

Query: 116 GLLACGTELKGVDAA---------IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNI 166
            ++    E     A          I I+D+R  + P++ L + +   +  L W  +D N+
Sbjct: 213 SVVEWHPENSTRVATASNSDNEPIILIWDLRNANTPLQILENGNSKGILSLDWCKHDSNL 272

Query: 167 LLSGSTDGYTNVYDLSEAEE 186
           LLS   D    +++  E +E
Sbjct: 273 LLSSGRDNTAVLWNPEEGKE 292

>NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa]
           {ON} Anc_1.247
          Length = 589

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 4/59 (6%)

Query: 129 AAIYIYDIRKWDQPVRSLV---DSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEA 184
           A  Y   I+ WD      V   D H   VTC++ HP D   L++GS D    ++DL  A
Sbjct: 312 AGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHP-DSKTLITGSKDATLKLWDLGLA 369

>NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa]
           {ON} Anc_5.631 YDR267C
          Length = 349

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 10/80 (12%)

Query: 105 NVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVD-----SHHDDVTCLKW 159
           N    SLD  HGLLA G+     D  I I ++    +   SL+D      H   + C+ W
Sbjct: 13  NDKLWSLDYSHGLLATGS----TDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAW 68

Query: 160 HPNDPNILLSGSTDGYTNVY 179
            P+  N+L +GS D   +++
Sbjct: 69  RPH-SNLLAAGSFDSTVSIW 87

>Kpol_1010.25 s1010 complement(55113..58259) [3147 bp, 1048 aa] {ON}
           complement(55113..58259) [3147 nt, 1049 aa]
          Length = 1048

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 19/107 (17%)

Query: 167 LLSGSTDGYTNVYDLSEAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELND 226
           + +G ++G   ++D S AE ED+    +N  SI + G             + FA+  ++ 
Sbjct: 506 IATGHSNGSVRIWDASPAELEDTSVYEVNLGSILNVG-------------KNFAVTNISF 552

Query: 227 KSDTLKEPQPIDMGDVREKWGCDYVVDVYPGFIATGKSQERQGELKL 273
            +DTL+    I+ GDV       +  +  P +   G + E+Q E+K 
Sbjct: 553 SADTLELSVAIESGDV-----VFFKFETNPNYSPNG-ANEKQMEMKF 593

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1321

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 46/93 (49%), Gaps = 11/93 (11%)

Query: 92  HSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKW---DQPVRSLVD 148
            +TK+++TI    +V     + ++ +  CGT       ++ IYDI K    D PV + + 
Sbjct: 171 RTTKKISTI---SDVKAGFYNHKNYVAICGTS-----TSVAIYDINKTSAIDNPVVTSLS 222

Query: 149 SHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
            H   +  + ++    ++L+SG  DG   ++DL
Sbjct: 223 EHTRSINSVDFNMVQTSLLISGGQDGCIKIWDL 255

>YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 465

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 23/45 (51%)

Query: 141 QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAE 185
           QP+   +DSH   +  + WHP+  N ++S + DG    +  S  E
Sbjct: 208 QPLTQKLDSHVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNEE 252

>CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa]
           {ON} highly similar to uniprot|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I
          Length = 455

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 70/153 (45%), Gaps = 17/153 (11%)

Query: 32  LLTSLSNGEVHYLDPSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTATSNSVKIF-- 89
           L+ +  +GE    + S+ T        +TS+  ++   ++     + +     ++KI+  
Sbjct: 97  LIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTMK---YSHAGDWMISGDADGTIKIWQP 153

Query: 90  DIHSTKEVATIHSQG--NVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLV 147
           + +  KE+  IH++G  +V F + DS+   + C       D  + I++     Q    ++
Sbjct: 154 NFNMVKELDRIHTEGIRDVAFSNNDSK--FVTCSD-----DNILKIWNFSNGQQ--ERVL 204

Query: 148 DSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180
             HH DV    WHP +  +++SGS D    ++D
Sbjct: 205 SGHHWDVRSCDWHP-ELGLIVSGSKDNLVKLWD 236

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 61/135 (45%), Gaps = 22/135 (16%)

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLAC--- 120
           D++  + +PT   + + +  N VK++D  + + ++TI          L  +H +++    
Sbjct: 211 DVRSCDWHPTMGLIASGSKDNLVKLWDPRAGQCISTI----------LGCKHTIISTKFQ 260

Query: 121 ---GTELKGV--DAAIYIYDIRKWDQPVRSL-VDSHHDDVTCLKWHPNDPNILLSGSTDG 174
              G  L  +  D +  I+DIR   Q ++ L V     D   L WHP + ++   G  DG
Sbjct: 261 PTKGNMLAVISKDKSCRIFDIR---QNMKELAVYRDESDYMSLTWHPINESMFTVGCYDG 317

Query: 175 YTNVYDLSEAEEEDS 189
               +DL +  ++ S
Sbjct: 318 SMKHFDLLQEPQDSS 332

>KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1541

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 59/128 (46%), Gaps = 8/128 (6%)

Query: 60   TSINDLQLINHNPTSSPLFTTATSNSVKIF-DIHSTKEVATIHSQGNVPFPSLDSR-HGL 117
            T I DL+ IN +  S+ L T ++   +KIF DI+S   V  I +   +    L  R +GL
Sbjct: 1237 TKITDLKFINED-DSTLLMTGSSDGIIKIFKDINSNSSVELIAAWRGLTEMLLTPRSNGL 1295

Query: 118  LACGTELKGVDAAIY-IYDIRKWDQPVRSL-VD---SHHDDVTCLKWHPNDPNILLSGST 172
            L    +++G   A   +  IR WD    ++ VD        VT L       NI ++G  
Sbjct: 1296 LTEWHQMRGALLATGDVKIIRIWDAHTETVEVDIPAKTSSLVTSLTSDQLAGNIFVAGFA 1355

Query: 173  DGYTNVYD 180
            DG   VYD
Sbjct: 1356 DGTLRVYD 1363

>Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 57/129 (44%), Gaps = 19/129 (14%)

Query: 86  VKIFDIHSTKEVATIHSQGNV-PFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVR 144
           V+I+D+   K + T+   G+V     L   + +L  G+     D  I   D+R  D P  
Sbjct: 326 VEIYDVIKRKCIRTL--SGHVDRVACLSWNNHVLTSGSR----DHRILHRDVRMPD-PFF 378

Query: 145 SLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVINF----ASIH 200
             ++SH  +V  LKW+  D N L SG  D   NVY      E  S   ++ F    A++ 
Sbjct: 379 ETIESHTQEVCGLKWNVAD-NKLASGGNDNMVNVY------EGTSKSPILTFDEHKAAVK 431

Query: 201 SCGWLSPRR 209
           +  W   +R
Sbjct: 432 AMAWSPHKR 440

>ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR102C and YKL121W
          Length = 734

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 150 HHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSL 190
           H D VTC+++HP+D     SG  D     + + E E  ++ 
Sbjct: 253 HPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILEGEVAEAF 293

>TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {ON}
           Anc_8.631 YOR212W
          Length = 417

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 15/114 (13%)

Query: 75  SPLFTTATSNSVKIFDIHSTKEVATIHSQ-GNV------PFPSLDSRHGLLACGTELKGV 127
           S + TT+   +  ++DI   K V    +  G+V      P  + +S +   +CG+     
Sbjct: 190 SRVITTSGDMTCALWDIPKAKRVTEYANHLGDVLAMSLPPHNTENSSNLFASCGS----- 244

Query: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           D   YI+DIR     V++   S   DV  +K+  ND N +++GS DG  +++DL
Sbjct: 245 DGYAYIWDIRS-PAAVQNFFVSD-SDVNAIKYF-NDGNSIVTGSDDGIIHMFDL 295

>KLLA0A04653g Chr1 complement(417313..419415) [2103 bp, 700 aa] {ON}
           similar to uniprot|P48234 Saccharomyces cerevisiae
           YGR145W ENP2 Essential nucleolar protein of unknown
           function contains WD repeats interacts with Mpp10p and
           Bfr2p and has homology to Spb1p
          Length = 700

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 77/188 (40%), Gaps = 37/188 (19%)

Query: 29  NNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTATSNSVKI 88
           N+  +   + G +HY      T I K+  S         + +N  +  L+  A+SN +  
Sbjct: 119 NDRTIQFQNKGGIHYT-----TRIPKFGRS---------LAYNKVNCDLYVGASSNELYR 164

Query: 89  FDIHSTKEV--ATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSL 146
            ++   + +    + ++G V   S++  +GLLA   E   V+          WD   RS 
Sbjct: 165 LNLEQGRFLNPFKLDTEG-VNHVSINEVNGLLAASMETNVVEF---------WDPRSRSR 214

Query: 147 V---------DSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVINFA 197
           V         DS    VTC  +  ND      G+++GY+ +YDL  +E      Q   FA
Sbjct: 215 VAKLHLENNLDSADFQVTCSSF-KNDGLNFACGTSNGYSYIYDLRTSEPSIVKDQGYGFA 273

Query: 198 SIHSCGWL 205
            ++   WL
Sbjct: 274 -VNKIIWL 280

>SAKL0B09306g Chr2 complement(788332..790824) [2493 bp, 830 aa] {ON}
           similar to uniprot|Q06096 Saccharomyces cerevisiae
           YPR105C COG4 component of oligomeric Golgi complex
          Length = 830

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 66/163 (40%), Gaps = 21/163 (12%)

Query: 135 DIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVI 194
           D RK D+ V+ ++D  H  V         PN    G+ +   +   +SE      L  +I
Sbjct: 314 DGRKIDRIVKEIIDWEHKTVQ----RSQSPN---EGTDEEIEDPITISE------LTNLI 360

Query: 195 NFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVREKWGCDYVVDV 254
           N  S     W    R F +   E F+ H+L+ K   L+ P PI  G    K      +D 
Sbjct: 361 NEYSSIFQNWSMYCRFFAVKWNE-FSGHDLSSKPQELQVPAPISDGKFSRKINEQGGIDN 419

Query: 255 YPGFIA--TGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDD 295
           +   +     +S ER  EL+ +P  +  I LT     P  HDD
Sbjct: 420 FRVLVKHHLYRSFERSVELEDLPSLNPYISLT-----PYKHDD 457

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 150 HHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
           H D V  L  H ND N + SGS DG    +D+S  E+
Sbjct: 66  HQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQ 102

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 62/147 (42%), Gaps = 15/147 (10%)

Query: 41  VHYLDPSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATI 100
           V ++D ++       N  E  I  LQL   +P    L   +T+  +KI++I   K V ++
Sbjct: 43  VKFIDNNSYLLDNVSNDDEQEITALQL---SPDGKYLCYASTNQLLKIYNIVEKKFVKSL 99

Query: 101 HSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWH 160
                    S+D    LLA G    G D ++ + DI   +  +      H   ++ +K++
Sbjct: 100 KISSPSYVMSIDQTSTLLAVG----GTDGSVTVIDIE--NSYITHSFKGHGATISAVKFY 153

Query: 161 P------NDPNILLSGSTDGYTNVYDL 181
                  N+  +L SG T G   V D+
Sbjct: 154 SDASTQNNEGWLLFSGDTAGMIKVCDM 180

>TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7.405
           YER107C
          Length = 361

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 4/79 (5%)

Query: 282 DLTNSIVIPGAHDDEVIRDVYIPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSK 341
           D+ N IVI    +D  I DV   + +  +      DG VK+W  NNG    P+ +  YS 
Sbjct: 21  DMANDIVINNPAEDS-ISDVAFSTQNEFVFSASSWDGKVKIWNINNGN---PQAVAQYSH 76

Query: 342 RVNMLEDTLLAPSEVVTAG 360
              +L          V +G
Sbjct: 77  SAPVLSTRWSGDGTKVASG 95

>Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON}
           similar to Ashbya gossypii ADL186C
          Length = 1317

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 126 GVDAAIYIYDIRKWD---QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           G   ++ IYDI +      P+ +    H   +  + ++    N+++SG  DGY  V+DL
Sbjct: 213 GTSTSLSIYDINRTSDIGSPLVATYSEHSRSINSVDFNMGQTNLIISGGQDGYIKVWDL 271

>NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {ON}
           Anc_6.135
          Length = 644

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 41/103 (39%), Gaps = 21/103 (20%)

Query: 113 SRHGLLACGTELK---------GVDAAIYIYDIRK----WDQPVRSLVDSHHDDVTCLKW 159
           S H    CG   K         G D  + I+D RK    W      +  +H   V  L W
Sbjct: 413 SEHKGEVCGLAYKSDGLQLASGGNDNTMMIWDTRKAMPQW------IKRNHTAAVKALSW 466

Query: 160 HPNDPNILLSGS--TDGYTNVYDLSEAEEEDSLHQVINFASIH 200
            P  PN+L SG   TD Y + ++ +      S++     +S+H
Sbjct: 467 CPYKPNLLASGGGQTDKYIHFWNSTNGARIGSINSGSQVSSLH 509

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           + I D+R    P+ +L + H+  +  L+WHP+ PN+L +   D     +DL
Sbjct: 321 VIILDMRYPGSPILTL-NGHYCALNQLRWHPSKPNVLATCGDDCQILYWDL 370

>CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004c
          Length = 412

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSL 190
           I +YD  +W   + SLV +H  DVT +K  P++  +LLSGSTD    V+ L +     +L
Sbjct: 123 INVYD-HEWMSKL-SLVGAHVSDVTTVKIFPSNA-VLLSGSTDMQLKVWSLEDGSNPRTL 179

>KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON}
           Anc_4.275 YLR409C
          Length = 940

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 62/138 (44%), Gaps = 15/138 (10%)

Query: 54  KYNISETSINDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATI-----HSQGNVPF 108
           K+ I++    D+  +NH  T        T +++ +F+I + K + T      H     P 
Sbjct: 160 KFQITKIQGGDIVSLNHLATYLNKLVVVTKSNILLFNIRTGKLLYTSAEFPDHITSAEPA 219

Query: 109 PSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILL 168
           P+LD    ++A GT    V   I ++++RK  + VR+ +      ++ + +  +  + L 
Sbjct: 220 PALD----IIALGT----VTGDIIMFNLRK-GRKVRT-IKVPQIRISSISFRTDGSSHLC 269

Query: 169 SGSTDGYTNVYDLSEAEE 186
            G T+G    YDL   + 
Sbjct: 270 VGGTNGDLIFYDLDRRQR 287

>NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 128 DAAIYIYDIRKWDQPVRSLVDS--HHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180
           D  I ++DI    QP   L  S  +   VTC+   P+ P++++SGS DG   +YD
Sbjct: 146 DRVIRLWDISNAYQPQLELTGSTDYVRSVTCV---PSAPHMIVSGSYDGIIRLYD 197

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 53/125 (42%), Gaps = 6/125 (4%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N +  I  NP     F   +S  V+IF   + + + T     +V + +     G L    
Sbjct: 40  NSVTHIAFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLVAG 99

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSL-VDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           +  G+   + +YD       + S+   +H   VT  K+HP D   L++ S D    ++D+
Sbjct: 100 DATGL---VSVYDSYNPRTILLSINASTHPTHVT--KFHPQDNKTLITASDDRVIRLWDI 154

Query: 182 SEAEE 186
           S A +
Sbjct: 155 SNAYQ 159

>KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {ON}
           Anc_7.405 YER107C
          Length = 363

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 282 DLTNSIVIPGAHDDEVIRDVYIPSHDSVMMYTCGEDGNVKLWKNNNG 328
           DL N IVIP   +D  I D+   S    +      DG V++W   NG
Sbjct: 22  DLANDIVIPNPAEDS-ISDIAFSSQRDFLFAVSSWDGKVRIWDVQNG 67

>NDAI0B01710 Chr2 (407575..408939) [1365 bp, 454 aa] {ON} Anc_7.180
           YIR012W
          Length = 454

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 73/185 (39%), Gaps = 28/185 (15%)

Query: 26  QHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTATSNS 85
           Q+G + +   +SN  V Y D  T              + +  I+H+PT   + T    N 
Sbjct: 62  QNGEDIIEIDMSNNSVSYFDKHT--------------DSVFTISHHPTLPLICTGGGDNV 107

Query: 86  VKIFDIHS--TKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRK----W 139
             ++  HS   K   T+         S  +  G      ++ G    I ++   K    W
Sbjct: 108 AHLWTSHSHPPKFAGTLQGHTESVIASGFTMDGKFLITGDMNG---KILLHKSNKSGSQW 164

Query: 140 DQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEED-SLHQVIN-FA 197
            Q V  L +   D+V  LK HP  P I   G+ DG    Y +++   +D SL Q+++ FA
Sbjct: 165 KQ-VSQLQEV--DEVVWLKCHPTVPGIFAFGAADGSVWCYQINDNGSDDVSLEQLMSGFA 221

Query: 198 SIHSC 202
               C
Sbjct: 222 HQQDC 226

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 70/166 (42%), Gaps = 20/166 (12%)

Query: 73  TSSPLFTTATSNSVKIFDIHSTKEVATIHSQGN-VPFPSLDSRHGLLACGTELKGVDAAI 131
           TSS + T A  N+ +I+D  +   +AT+    N V   S      ++A G+    +D+ I
Sbjct: 151 TSSRMVTGAGDNTARIWDCDTQTPLATLEGHSNWVLCVSWSPDGEVIATGS----MDSTI 206

Query: 132 YIYDIRKWDQPV------RSLVDSHHDDVTCLKWHP------NDPNILLSGSTDGYTNVY 179
            +++  K  +PV       S +  H   +T L W P           L S S DG   ++
Sbjct: 207 RLWESTK-GKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPRLASASKDGTIKIW 265

Query: 180 DLSEAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELN 225
           D +      +L    N  S+    W     +++ SH +T  + ++N
Sbjct: 266 DTARRVCLYTLSGHSN--SVACVKWGGEGLLYSGSHDKTVRVWDMN 309

>KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.405
           YER107C
          Length = 362

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 61/148 (41%), Gaps = 13/148 (8%)

Query: 46  PSTLTT-------IQKYNISETSINDLQLINHNPTSSPLFTTAT-SNSVKIFDIHSTKEV 97
           PSTL T       I   N ++ S++D+     +P    +F+ ++    V+I+D+ S    
Sbjct: 13  PSTLATENDLAKDIVIQNPADDSVSDIAF---SPQQDFMFSVSSWDGKVRIWDVQSG--T 67

Query: 98  ATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCL 157
           A   SQ     P L +R           G D AI I+D+         L D+    V  +
Sbjct: 68  AQGRSQYEHAAPVLSTRWSNDGTKVASGGCDNAIKIFDVATGQSQQLGLHDAPVKAVRFV 127

Query: 158 KWHPNDPNILLSGSTDGYTNVYDLSEAE 185
              P +  +L++GS D     +D  + +
Sbjct: 128 NCGPTNTEMLVTGSWDKSIKYWDFRQPQ 155

>CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {ON}
           highly similar to uniprot|P40066 Saccharomyces
           cerevisiae YER107c GLE2
          Length = 369

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 4/58 (6%)

Query: 282 DLTNSIVIPGAHDDEVIRDVYIPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDY 339
           DL N IVI    DD +    + P HD  +      DG V++W   NG   VP+    Y
Sbjct: 23  DLQNEIVINNPADDSISDIAFSPQHD-FLFSVSSWDGKVRIWDAQNG---VPQGKAQY 76

>Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa]
           {ON} YBR175W (SWD3) - YBR175W [contig 22] FULL
          Length = 316

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 116 GLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGY 175
           G L C   +   D +I I+DI      +R+L  +H + V  +   P DP+IL SGS DG 
Sbjct: 111 GNLLCSCSM---DESIKIWDILS-GTLLRTL-SAHSEPVVSIDLPPFDPSILSSGSYDGL 165

Query: 176 TNVYD 180
             ++D
Sbjct: 166 IRIFD 170

>Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa]
           {ON} YLR208W (SEC13) - cytoplasmic protein involved in
           release of transport vesicles from the ER [contig 161]
           FULL
          Length = 294

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 249 DYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIPSHDS 308
           D V+D Y   +AT  S +    +K+  ++ ET  L  ++     H+  V +  +      
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKIFEVEGETHKLVETL---HGHEGPVWQVDWAHPKFG 67

Query: 309 VMMYTCGEDGNVKLWKNNNG 328
           V++ +C  DG V +WK  NG
Sbjct: 68  VILASCSYDGKVLIWKEENG 87

>TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {ON}
           Anc_8.631 YOR212W
          Length = 431

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 7/73 (9%)

Query: 109 PSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILL 168
           P   ++  + A G    G D+ ++I+D R      +  +   + DV  +K++ ND N ++
Sbjct: 241 PERSNKTNMFATG----GSDSYVHIWDTRAPSSVQKFYI--SNSDVNTVKFY-NDGNAIV 293

Query: 169 SGSTDGYTNVYDL 181
           SGS DG   +YDL
Sbjct: 294 SGSDDGIIRLYDL 306

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 59/261 (22%), Positives = 105/261 (40%), Gaps = 39/261 (14%)

Query: 72  PTSSPLFTTATSN-SVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDAA 130
           P +  +   A+S+ ++ IFD   TK  +T   Q  +  P             E+K + + 
Sbjct: 139 PQNPDIIAGASSDGAIYIFD--RTKHGSTRIRQSKISHP------------FEIKLLGSH 184

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSL 190
             I D+   D    SLVD   ++ T L W+     +LLS  ++G   V+D+ +   ++ +
Sbjct: 185 GVIQDVETMDT---SLVDI--NEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPI 239

Query: 191 HQV------INFASIHSCGWLSPRRIFTLSHMETFAIH--ELNDKSDTLKEPQPIDMGDV 242
             V       + +S++   W+        +  E  A+   +L  K + LK    I  G V
Sbjct: 240 IDVPLMSIDSDGSSVNDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHGGGV 299

Query: 243 REKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVY 302
                C +    Y   +    S +  G L L  ++    ++  + +    H   V    +
Sbjct: 300 N---SCKF---NYKNSLILA-SADSNGRLNLWDIR----NMNENPIATMEHGASVSTLEW 348

Query: 303 IPSHDSVMMYTCGEDGNVKLW 323
            P+ D+V+     EDG VKLW
Sbjct: 349 SPNFDTVLATAGQEDGLVKLW 369

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 77/175 (44%), Gaps = 22/175 (12%)

Query: 35  SLSNGEVHYLDPSTLTTIQKYNISETSIN--------DLQLINHNPTSSPLFTTATSNSV 86
           S SN +  ++  S    ++ +N S   +         D++  + +P    + + +  N V
Sbjct: 181 SFSNNDSKFVTCSDDNVLKIWNFSNGQVERTLSGHHWDIKSCDWHPEMGLIVSASKDNLV 240

Query: 87  KIFDIHSTKEVATI----HSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQP 142
           K++D  S + ++TI    H+     F    +R  LLA  ++    D +  ++DIR   + 
Sbjct: 241 KLWDPRSGQCISTIIKFKHTVLKTRFQP--TRGNLLAAISK----DKSCRVFDIRHSMKE 294

Query: 143 VRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVINFA 197
           +  + D    D   L W+P + ++   G+ DG    +DL +  E  S   VI +A
Sbjct: 295 LMCVRD--EVDYMTLTWNPINESMFTVGNYDGAMKYFDLLQDLEGPS--HVIPYA 345

>NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa]
           {ON} Anc_3.259 YDR030C
          Length = 478

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 21/36 (58%)

Query: 148 DSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
           +SHH  +T +KW+  D  +  +GS D    ++D ++
Sbjct: 170 ESHHGGITTMKWYGEDNGMFFTGSNDKIIKIWDTNQ 205

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 73/188 (38%), Gaps = 14/188 (7%)

Query: 7   LVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSINDL- 65
            V    +G  +    +    H  N L T+ ++G V Y + ST   +  +      I+ L 
Sbjct: 58  FVGQLGYGHRDGVYTIAKNYHVLNKLATASADGVVKYWNMSTREEVCSFKAHYGLIHGLC 117

Query: 66  ---QLINHNPTSSPLFTTATSNSVKIF-----DIHSTKEVATIHSQGNVPFPSLDSRHGL 117
              Q ++ N   + + +     +VK++     D  S +    +   GN    +    H  
Sbjct: 118 VTPQHLSQNKNENYMLSCGDDRTVKLWSVNTDDFSSERGDEEVIKSGNGLIKTFHGEHAF 177

Query: 118 LACGTELKGVDAAIYIYDIRKWD----QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTD 173
           L         +      +I  WD    +P+ +L     D+V+ +K++ N+ +I  S  +D
Sbjct: 178 LGIDHHRSNSNFVTGGAEINLWDSTRSRPITNL-SWGADNVSTVKFNQNETDIFASAGSD 236

Query: 174 GYTNVYDL 181
               +YDL
Sbjct: 237 NSVVLYDL 244

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           + I D+R    PV  +++ H   V  ++WHP+  N+LLS + D     +DL
Sbjct: 379 VLILDMRNPGSPVL-VLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYWDL 428

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 16/74 (21%)

Query: 154 VTCLKWHPNDPNILLSGSTDGYTNVYDL--------------SEAEEEDSLHQVINFASI 199
           +T   W+P DPN+L+S S D    V+DL              SE  +   L Q     S 
Sbjct: 246 ITSFHWNPVDPNLLISSSIDTTCIVWDLQSSNYVRTQLIAHDSEVYDVRFLTQTTQLFS- 304

Query: 200 HSCGWLSPRRIFTL 213
            SCG     R+F L
Sbjct: 305 -SCGGDGSVRVFDL 317

>Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {ON}
           complement(76168..77499) [1332 nt, 444 aa]
          Length = 443

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 147 VDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
           + +H   ++CLK H +    L+SG  DG ++++DLS
Sbjct: 240 IQAHRTSISCLKMHKSGK-FLISGGEDGISSIWDLS 274

>KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {ON}
           Anc_7.338 YLR208W
          Length = 304

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 249 DYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIPSHDS 308
           D V+D Y   +AT  S +    +K+  ++ E+  L +++     H+  V R  +      
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKIFEVEGESQKLVSTLT---GHEGPVWRVDWAHPKFG 67

Query: 309 VMMYTCGEDGNVKLWKNNNG 328
            ++ +C  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVIIWKEENG 87

>Kwal_27.10573 s27 complement(399825..402872) [3048 bp, 1015 aa]
           {ON} YBL106C (SRO77) - yeast homolog of the Drosphila
           tumor suppressor, lethal giant larvae [contig 34] FULL
          Length = 1015

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 71/173 (41%), Gaps = 21/173 (12%)

Query: 19  ALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSINDLQLINHNPTSSPLF 78
           AL  +P+Q   + L  +   GE+H      +  +   + S++ + +L+ +        L 
Sbjct: 47  ALAFEPVQ---SLLAMATDAGEIHVFGKQQVEVVFTLD-SKSIVKELRFVK----GIYLV 98

Query: 79  TTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRK 138
              + ++V I  +HS K +    + G +     D     +  G +      A  IYDI K
Sbjct: 99  AVDSKDTVLILSLHSKKVLTAFFAPGKISCIETDPSLDWMLIGLQ----SGATVIYDIDK 154

Query: 139 -WDQPVR-------SLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
               P+R        +  +H   V  ++W+P D  ++L  S +  T VY L E
Sbjct: 155 DCLSPLRIENLQKTYMPKAHLSPVVSIQWNPRDYGVILI-SYNLLTVVYSLVE 206

>CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa]
           {ON} similar to uniprot|Q03177 Saccharomyces cerevisiae
           YMR102c
          Length = 978

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 143 VRSLVDSHHDD-VTCLKWHPNDPNILLSGSTDGYTNVYDLSEAE 185
           +RSL    H D VTC+K+HP D    +SG  D    ++ + + E
Sbjct: 443 MRSLKSFQHPDFVTCVKFHPTDDRFFISGCLDQKCRLWSILDDE 486

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 86/216 (39%), Gaps = 22/216 (10%)

Query: 149 SHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVINFA-----SIHSCG 203
           +H   V  LK++    N+L+SGS  G   V+D ++A++ D +      A      I S  
Sbjct: 104 THTSSVKTLKFNSKQENVLVSGSNKGEIFVWDTNKAKQTDYVPMTPGTAMTPLEEITSLS 163

Query: 204 W-LSPRRIFTLSHMETFA-IHELNDKSDTLKEPQPIDMGDVREKWGCDYVVDVYPG---F 258
           W  S   +F  +    +A I +L  K + +          ++ +     VV+ +P     
Sbjct: 164 WNQSLAHVFASAGATVYASIWDLKAKKEVIHLSYTSPATGLKSQLS---VVEWHPNNSTR 220

Query: 259 IATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIPSHDSVMMYTCGEDG 318
           +AT    +    + +  L++    L    V+   H   +I   +    D  +M + G D 
Sbjct: 221 VATATGNDNDPSILVWDLRNANTPLQ---VLDQGHSKGIISLDWC-HEDESLMLSSGRDN 276

Query: 319 NVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTLLAPS 354
            V LW   +G     E+L  +  R N    T  AP+
Sbjct: 277 TVLLWNPESG-----EKLSQFPTRSNWCFKTKFAPA 307

>SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [1326
           bp, 441 aa] {ON} weakly similar to uniprot|Q12206
           YOR229W Saccharomyces cerevisiae WTM2 WD repeat
           containing transcriptional modulator 2
          Length = 441

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL-----S 182
           D  +  +D+R  D+PV SL D  +  +TC    P    + ++G++ G   ++DL     S
Sbjct: 244 DNRLRFWDVRS-DKPVWSLSDPKNGSLTCFDVSPVIDTLFVTGTSTGVLKLWDLRAVAAS 302

Query: 183 EAEEEDSLHQVINFASIHSCG 203
              ++D   ++++    HS G
Sbjct: 303 SGHDDDCTTEIVSL--YHSGG 321

>NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135
          Length = 624

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 56/132 (42%), Gaps = 18/132 (13%)

Query: 77  LFTTATSNSVKIFDIHSTKEVATI--HSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIY 134
           + T   S  ++I D+     + +     QG +   S  S    LA G    G D  + I+
Sbjct: 365 IATGCRSGEIQINDVRIKDHIVSTWKKHQGEICGLSYKSDGLQLASG----GNDNTVMIW 420

Query: 135 DIR----KWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGS--TDGYTNVYDLSEAEEED 188
           D R    +W      +  +H+  V  L W P  PN+L +G   TD Y + ++ +   +  
Sbjct: 421 DTRTSMPQW------IKRNHNAAVKALSWCPYIPNLLATGGGQTDKYIHFWNSTTGAKMG 474

Query: 189 SLHQVINFASIH 200
           S++     +S+H
Sbjct: 475 SINSGSQVSSLH 486

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 62/138 (44%), Gaps = 21/138 (15%)

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLAC--- 120
           D++  + +P    + + +  N VK +D  S + V+TI          L+ +H +L     
Sbjct: 211 DVKSCDWHPEMGLIVSGSKDNLVKFWDPRSGQCVSTI----------LNFKHTVLRTRFQ 260

Query: 121 ---GTELKGV--DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGY 175
              G  L G+  D +  ++DIR   + + ++ D    D   L WHP + ++    + DG 
Sbjct: 261 PTRGNYLLGISKDKSCRVFDIRNHTKELLTVRD--EVDFMTLSWHPINESVFTLANYDGS 318

Query: 176 TNVYDLSEAEEEDSLHQV 193
              +D+ E + E  +H +
Sbjct: 319 IKHFDILE-DLEKPIHTI 335

>Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON}
           YDR142C (REAL)
          Length = 376

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 87/220 (39%), Gaps = 50/220 (22%)

Query: 1   MSSSYSLVNSRSFGSNNW--ALKL-QPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNI 57
            S +++LVN ++F S++W  ++K+  PL+  +   LT         +DP     + K   
Sbjct: 108 FSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMSLTPRPLEITKMVDPLNAILLNKKKF 167

Query: 58  SETSIND--LQLINHNPTSSPLFTTATSNS-VKIFDI-------------HSTKEVATIH 101
           +  S N   +     +P    L  + + NS   +FDI             HS  E  T  
Sbjct: 168 AGISKNRNCVYQAQFSPHDQNLIISCSGNSYASLFDIRLPPSKSQSNFLVHSGLEALTCD 227

Query: 102 SQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVD------------- 148
                P+        ++A G    GVD AI I+DIR  +    + +D             
Sbjct: 228 FNKYRPY--------VVATG----GVDNAIRIWDIRMLNAIGSTAIDRTTHNKSHNSACI 275

Query: 149 -----SHHDDVTCLKWHPNDPNILLSGSTDGYTNVY-DLS 182
                +H   V  + W P+  NIL+S S D    ++ DLS
Sbjct: 276 NEIPNAHELAVRKVAWSPHHSNILMSASYDMTCRIWKDLS 315

>NDAI0I01440 Chr9 (343925..345076) [1152 bp, 383 aa] {ON} Anc_6.143
           YBR234C
          Length = 383

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 8/39 (20%)

Query: 141 QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVY 179
           +P++S ++       CL WH N   +L SG TDGY  V+
Sbjct: 150 KPIKSTIN-------CLSWHANGV-LLASGGTDGYVRVF 180

>NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.338
           YLR208W
          Length = 297

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 35/80 (43%), Gaps = 6/80 (7%)

Query: 249 DYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIPSHDS 308
           D V+D Y   +AT  S +    +K+  ++ ET      +     HD  V R  +      
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKIFEVEGET---HKEVATLEGHDGPVWRVDWAHPKFG 67

Query: 309 VMMYTCGEDGNVKLWKNNNG 328
            ++ +C  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 40/197 (20%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 1   MSSSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISET 60
           M +  +LV+ +      W +K  P+ H       + S+ +   L   +   I    I   
Sbjct: 570 MDTHTTLVSYKGHNHPVWDVKFSPMGH----YFATASHDQTARL--WSCDHIYPLRIFAG 623

Query: 61  SINDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLAC 120
            +ND++ ++ +P    +FT +   + +++DI +   V            +  +  G   C
Sbjct: 624 HLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLC 683

Query: 121 GTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180
                G D  I ++DI    + ++ +     + +    ++  + NIL+SG  D    V+D
Sbjct: 684 ---TGGEDGVINVWDIGTGKR-LKQMRGHGKNAIHSFSFN-KEGNILISGGADHSVRVWD 738

Query: 181 LSEAEEEDSLHQVINFA 197
           L +A  E S      FA
Sbjct: 739 LKKATPEPSAEPEQPFA 755

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 74/184 (40%), Gaps = 34/184 (18%)

Query: 152 DDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVINFASIHSCGW--LSPRR 209
           D++T +K++ N+ ++LLS  +D    +YDL          +++     +S  W  + P  
Sbjct: 216 DNITAVKFNQNEADLLLSSGSDNSVVLYDL---RTNSPTQKIVQTMKTNSMCWNPMEPFN 272

Query: 210 IFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVREKWGCDYVVDVYPGFIATGKSQERQG 269
             T +  +    +++ + S  L           ++       VD+ P            G
Sbjct: 273 FVTANEDQNAYYYDMRNMSRALHV--------FKDHVSAIMDVDISP-----------TG 313

Query: 270 ELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIP-------SHDSVMMYTCGEDGNVKL 322
           E  +    D+TI + N   I   H  EV     +        + DS  + +  +DGNV+L
Sbjct: 314 EEIVTGSYDKTIRIFN---IKHGHSREVYHTKRMQHVFQVKFTMDSKYIVSGSDDGNVRL 370

Query: 323 WKNN 326
           W++N
Sbjct: 371 WRSN 374

>NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {ON}
           Anc_3.95 YDR488C
          Length = 626

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 147 VDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180
           V+ H  DVT L++HP + ++L SGS D   +++D
Sbjct: 487 VNFHSSDVTSLRFHPQNDDLLCSGSMDWNCHLWD 520

>KNAG0F02350 Chr6 (441601..442767) [1167 bp, 388 aa] {ON} Anc_6.143
           YBR234C
          Length = 388

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 13/67 (19%)

Query: 118 LACGTELKGVDAAIYIYDIRKW-----DQPVRSLVDSHHDDVTCLKWHPNDPNILLSGST 172
            A G+  + +    Y +D   W      +P++S V+       CL+WH N   +L  G T
Sbjct: 127 FAVGSSARIIAVCYYEHDNNWWVSKHIKKPIKSTVN-------CLEWHSNGV-LLACGGT 178

Query: 173 DGYTNVY 179
           DG+  V+
Sbjct: 179 DGFVRVF 185

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 10/77 (12%)

Query: 116 GLLACGTELKGVDAAIYIYDIRKWDQPVRSLV--DSHHDDVTCLKWHPNDPNILLSGSTD 173
           G L C     G+D+  +++D+R      RSL+  + H   +  + W PN  ++  +GS D
Sbjct: 325 GSLLCSA---GLDSVGHVWDMR----TGRSLMVLEGHAKPIYGVSWSPNGHHVA-TGSGD 376

Query: 174 GYTNVYDLSEAEEEDSL 190
           G   V+D+ +A +  S+
Sbjct: 377 GTVQVWDIRKANKPSSI 393

>ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR212W (STE4)
          Length = 467

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 9/59 (15%)

Query: 126 GVDAAIYIYDIRKWDQPVRSLVDSHH---DDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           G D  +YI     WD+ V + V S      DV+ +K+  N  N + +GS DG TN+YDL
Sbjct: 281 GSDGYLYI-----WDKRVPTSVQSFFVSDSDVSKVKFFRNG-NTIATGSDDGCTNLYDL 333

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 126 GVDAAIYIYDIR-KWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183
           G+D  I I+D R K  +P  S V + + DV  + W      +L SG  DG   V+DL +
Sbjct: 353 GIDGYIRIWDTRSKKHKPAIS-VKASNTDVNVISWSEKIGYLLASGDDDGTWGVWDLRQ 410

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 76/188 (40%), Gaps = 13/188 (6%)

Query: 1   MSSSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISET 60
           M +  +LVN +      W +K  PL H       S S+ +   L       I    I   
Sbjct: 562 MDTHTALVNYKGHNHPVWDVKFSPLGH----YFASASHDQTARL--WACDHIYPLRIFAG 615

Query: 61  SINDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGL-LA 119
             ND+  ++ +P    +FT ++  + +++D+ +   V            +  S  G  LA
Sbjct: 616 HTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLA 675

Query: 120 CGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVY 179
            G+E    D  I ++DI    + ++ +     + V  L ++  + N+L+SG  D    V+
Sbjct: 676 TGSE----DGVICLWDIGTGKR-IKQMRGHGKNAVHSLSFN-KEGNVLISGGADHSVRVW 729

Query: 180 DLSEAEEE 187
           D+     E
Sbjct: 730 DVKHGTTE 737

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 63/142 (44%), Gaps = 22/142 (15%)

Query: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLAC--- 120
           D++  + +P    + + +  N +K++D  S + V+T+          L+ +H +L     
Sbjct: 214 DVKSCDWHPEMGLIVSASKDNLIKLWDPRSGQCVSTL----------LNFKHTVLKTKFQ 263

Query: 121 ---GTELKGV--DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGY 175
              G  L  +  D +  ++DIR   + +  + D    D   L WHP + ++    S DG 
Sbjct: 264 PTKGNLLAAISKDKSCRVFDIRYHMKELTVIRD--EVDYMTLLWHPTNESMFTIASYDGA 321

Query: 176 TNVYDLSEAEEEDSLHQVINFA 197
              +D+ +  EE    QVI +A
Sbjct: 322 IKHFDILQNLEEP--QQVIPYA 341

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 93/232 (40%), Gaps = 28/232 (12%)

Query: 19  ALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSINDLQLINHNPTSSPLF 78
           AL+L P       L  +  N  + + D  T  T +   IS  +     +++ + +S+ L 
Sbjct: 65  ALRLTP---DGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAY----VLDCDESSTLLA 117

Query: 79  TTATSNSVKIFDI------HSTK-EVATIHSQGNVPF-PSLDSRHGLLACGTELKGVDAA 130
              T  SV +FDI      HS K   ATI S   V F   +DS   LLA G      +  
Sbjct: 118 VGGTDGSVNVFDIANGYVTHSLKGHGATISS---VKFYGEVDSGMWLLASG----DTNGM 170

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCL--KWHPNDPNILLSGSTDGYTNVYDLSEAEEED 188
           + I+D+ K  +     V  H   V  L  +      ++LLSG  D   +V+     ++  
Sbjct: 171 VKIWDLVK--RRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHVHHFDMKKKCK 228

Query: 189 SLHQVINFASIHSCGWL--SPRRIFTLSHMETFAIHELNDKSDTLKEPQPID 238
            L  +     I SCG++  +   I+T      + I  L       +  QP++
Sbjct: 229 LLQTIPVKRQIESCGFIGDNTSLIYTAGGDAVYQIISLESGKSIKQTAQPVE 280

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 141 QPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           + ++  +D H +  T L + PN  N+LLSG  D    V+D 
Sbjct: 145 KKIKYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDF 185

>TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.122
           YGL003C
          Length = 631

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 64/147 (43%), Gaps = 9/147 (6%)

Query: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122
           N+   +N   T S L    ++  V+I+DI   K + T+    +     L   + +L+ G+
Sbjct: 368 NEFTSLNWVGTGSHLAVGQSNGLVEIYDIIKRKCIRTLSGHSD-RVSCLSWNNHILSSGS 426

Query: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182
                D  I   D+R  D    + +++H  +V  LKW+  D N L SG  D    VYD  
Sbjct: 427 R----DRKILHRDVRSPDSYF-TQIETHTQEVCGLKWNIED-NRLASGGNDNIVYVYD-- 478

Query: 183 EAEEEDSLHQVINFASIHSCGWLSPRR 209
               + +L    + A++ +  W   RR
Sbjct: 479 GVNSKPTLMFTEHTAAVKAMTWSPHRR 505

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 130 AIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           A+ I D+R    P+ +L + H   V  ++WHP   N+LL+   D     +D+
Sbjct: 304 AVLILDMRYPGSPILTL-EGHSSAVNQMRWHPTQRNVLLTCGDDCQVLYWDI 354

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 58/124 (46%), Gaps = 17/124 (13%)

Query: 65  LQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQG-----NVPFPSLDSRHGLLA 119
            Q I+H+ ++S   T      ++++D   +K  + + S G     +V F   DS   +LA
Sbjct: 175 FQGIDHHRSNSAFVTGGAQ--IQLWDTSRSKSTSNL-SWGADNITSVKFNQNDS--NILA 229

Query: 120 CGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVY 179
                 G D +I +YD+R  + P + +V     +  C  W+P +P   ++G+ D     Y
Sbjct: 230 ST----GSDNSIVLYDLRT-NSPTQKIVQQMRTNSLC--WNPMEPFNFVTGNEDHNAYYY 282

Query: 180 DLSE 183
           D+ +
Sbjct: 283 DMRK 286

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 137 RKWDQP-VRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEE 186
           R + QP V  L   H D V  +  H +D N + +GS DG    +++S +EE
Sbjct: 52  RMFAQPFVGQLGYGHRDGVYAVAKHYHDLNKMATGSGDGVVKFWNMSSSEE 102

>Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {ON}
           complement(187786..188673) [888 nt, 296 aa]
          Length = 295

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 6/99 (6%)

Query: 249 DYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYIPSHDS 308
           D V+D Y   +A+  S +    +K+  L  E+  L +++     H+  V R  +  S   
Sbjct: 14  DSVLDYYGKRLASCSSDKT---VKIFALDGESFKLLDTL---RGHEAPVWRVSWAHSKFG 67

Query: 309 VMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLE 347
            ++ +C  DG + +W+   G   + + L  +S  VN +E
Sbjct: 68  EILASCSFDGKIIIWEEVRGKWTMIDSLSVHSGSVNSIE 106

>ZYRO0C08976g Chr3 complement(684862..686514) [1653 bp, 550 aa] {ON}
           highly similar to uniprot|P40055 Saccharomyces
           cerevisiae YER082C
          Length = 550

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 9/87 (10%)

Query: 37  SNGEVHYLDPSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKE 96
           +NG V    PS    + K   +   + DL +   + +   + TT T  S+KI+DI + KE
Sbjct: 248 NNGTVSLWSPSMPEPLVKLLTARGPVTDLAI---DRSGHYMVTTGTDKSMKIWDIRNFKE 304

Query: 97  VATIHSQGNVPFPSLD---SRHGLLAC 120
              +H+  N+P P+ +   S  GLLA 
Sbjct: 305 ---LHTVKNLPTPASNVTISDSGLLAV 328

>NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8.316
           YDR142C
          Length = 398

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 19/67 (28%)

Query: 126 GVDAAIYIYDIR-------------------KWDQPVRSLVDSHHDDVTCLKWHPNDPNI 166
           GVD AI ++D+R                   +  +P+  ++++H   V  +KW P+  N+
Sbjct: 260 GVDKAIKMWDMRFIPSTFSPQSTSTTPILSRRQQEPINEIINAHDLAVKTIKWSPHHSNL 319

Query: 167 LLSGSTD 173
           ++S S D
Sbjct: 320 MVSTSYD 326

>ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38262 Saccharomyces cerevisiae YBR103W SIF2
           Sir4p-Interacting Factor 535 amino acid protein
           containing 4 WD-40 repeats and a nuclear localization
           signal
          Length = 504

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 50/241 (20%), Positives = 94/241 (39%), Gaps = 37/241 (15%)

Query: 117 LLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHH------------DDVTCLKWHPNDP 164
           +LACG    G D+ + +  +   ++ ++S ++  H            ++VTCL W P   
Sbjct: 160 ILACG----GRDSVVTVLRVDVSNKNIKSKIELRHPFAPSSSAGKTTNEVTCLAWSPRGD 215

Query: 165 NILLSGSTDGYTNVYDLSEAEEEDSLHQVINF--ASIHSCGWLSPRRIFTLSHMETFAIH 222
            I ++G  +G   ++++     E  L  + NF    I +  W      F  + +E   I 
Sbjct: 216 EI-VTGVENGELRLWNV-----EGKLQNIFNFHRGPIVAIEWNENATHFITTDVENITIL 269

Query: 223 ELNDKSDTLKEPQPIDMGDVREKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETID 282
                   L+  +  D     E  G D     +  F+  G     QG L +  + DE   
Sbjct: 270 WNAVTGTALQHFELRDQSSTAESLGVDIEWIEHDKFVLPGP----QGSLMVFQM-DEDKP 324

Query: 283 LTNSIVIPGAHDDEVIRDVYIPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKR 342
           +   +   GA     I  +   SH S M+ +  +D  +++W+   G  N     + +S+ 
Sbjct: 325 IGKLLGHRGA-----IGVLEFNSH-SRMLLSASDDHTLRIWR--GGSCNSSNTFYGHSQS 376

Query: 343 V 343
           +
Sbjct: 377 I 377

>NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON}
           Anc_7.356 YLR196W
          Length = 581

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 136 IRKWD----QPVRSLVDSHH-DDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEED 188
           ++ WD    Q  RSL   H   +V+  +WHP + +ILL+G  D    + D+  + E++
Sbjct: 316 VKLWDLNNGQTARSLASVHSGKNVSASEWHPTNGSILLTGGYDSRVALSDVRISNEKE 373

>KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.119
           YGL004C
          Length = 409

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTD 173
           I +Y+ +   + VR + D+H  D+T LK+ P+   +LLS STD
Sbjct: 123 IAVYNAKY--ETVREIEDAHASDITSLKFFPSGE-VLLSASTD 162

>YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}
           PEX7Peroxisomal signal receptor for the N-terminal
           nonapeptide signal (PTS2) of peroxisomal matrix
           proteins; WD repeat protein; defects in human homolog
           cause lethal rhizomelic chondrodysplasia punctata (RCDP)
          Length = 375

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 90/220 (40%), Gaps = 50/220 (22%)

Query: 1   MSSSYSLVNSRSFGSNNW--ALKL-QPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNI 57
            S +++LVN ++F S++W  ++K+  PL+  +   LT         +DP     ++K + 
Sbjct: 108 FSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMTLTPRPLEITKMVDPLNAIILKKKSF 167

Query: 58  SETSIND--LQLINHNPTSSPLFTTATSNS-VKIFDI-------------HSTKEVATIH 101
           +  S N   +     +P    L  + + NS   +FDI             HS  E  T  
Sbjct: 168 TGISKNRNCVYQAQFSPHDQNLVLSCSGNSYASLFDIRLPSGKNQNNFLVHSGLEALTCD 227

Query: 102 SQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQ------------------PV 143
                P+        ++A G    GVD AI I+DIR  ++                   +
Sbjct: 228 FNKYRPY--------VVATG----GVDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCI 275

Query: 144 RSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVY-DLS 182
             + ++H   +  + W P+  NIL+S S D    ++ DLS
Sbjct: 276 NEIPNAHGLAIRKVTWSPHHSNILMSASYDMTCRIWRDLS 315

>Ecym_8336 Chr8 (677880..679250) [1371 bp, 456 aa] {ON} similar to
           Ashbya gossypii ACR116W
          Length = 456

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 58/140 (41%), Gaps = 29/140 (20%)

Query: 193 VINFASIHSCGW-----LSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVREKWG 247
           VI  +SI S  W     L+P R+ T    E+F  ++     D +                
Sbjct: 147 VIAISSIGSLAWFKNGTLTPVRVLTEEVAESFRDNKALSHKDMI---------------S 191

Query: 248 CDYVVDVYPGFIATGKS----QERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYI 303
            D+ +      I   +S     ++Q  LK+I   D+  ++T++I IPG     V++  + 
Sbjct: 192 VDFAMSTDQKVIVKSQSVMVDNKKQSLLKIIDNADKLGNVTHTIPIPGTSVTPVVK--FQ 249

Query: 304 PSHDSVMMYTCGEDGNVKLW 323
            +H   +  TC +D  ++ W
Sbjct: 250 SAH---LFSTCSDDNVLRFW 266

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 75/176 (42%), Gaps = 17/176 (9%)

Query: 18  WALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSINDLQLINHNPTSSPL 77
           W +K  PL H       ++S+ +   L   +   I    I    +ND+  +  +P  + +
Sbjct: 573 WDVKFSPLGH----YFATVSHDQTARL--WSCDHIYPLRIFAGHLNDVDCVAFHPNGTYV 626

Query: 78  FTTATSNSVKIFDIHSTKEVATI--HSQGNVPFP-SLDSRHGLLACGTELKGVDAAIYIY 134
            T ++  + +++DI +   V     H+   V    S D R   L  G+E    D  I ++
Sbjct: 627 LTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGR--WLTTGSE----DGVIIVW 680

Query: 135 DIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDSL 190
           DI    + ++ +       V  L ++  + NIL+SG  D    V+DL +   E +L
Sbjct: 681 DIGTGKR-IKQMRGHGKSAVNSLSFN-KEGNILVSGGADQSVRVWDLKKFTNEPAL 734

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 72/175 (41%), Gaps = 18/175 (10%)

Query: 19  ALKLQPLQHGNNGLLTSLSNG---------EVHYLDPSTLTTIQKYNISETSINDLQLIN 69
            + L P+  G++ + T   +G         E++ +D +       + IS     ++  + 
Sbjct: 9   GVSLNPIYAGSSAVATVSEDGKILATPILDEINIIDLTLGCRKILHKISNEDEQEITALR 68

Query: 70  HNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGVDA 129
             P    L   + +  +KIF + + + V ++           D    LLA G    G D 
Sbjct: 69  LTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLKISSPSYILDTDPTSTLLAVG----GTDG 124

Query: 130 AIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHP---NDPNILLSGSTDGYTNVYDL 181
           +I I DI   +  +   +  H   ++ LK++    ++  +L SG T+G   V+DL
Sbjct: 125 SIVIVDIE--NGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDL 177

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 126 GVDAAIYIYDIRKW---DQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181
           G   ++ IYDI +    D P+ + +  H   +  + ++    ++L+SG  DG   V+DL
Sbjct: 203 GTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCIKVWDL 261

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,856,436
Number of extensions: 2077187
Number of successful extensions: 7395
Number of sequences better than 10.0: 477
Number of HSP's gapped: 7422
Number of HSP's successfully gapped: 545
Length of query: 389
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 278
Effective length of database: 40,753,473
Effective search space: 11329465494
Effective search space used: 11329465494
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)